2RAKA

Pi(3)p bound px-bar membrane remodeling unit of sorting nexin 9
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
382
structure length
382
Chain Sequence
PGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title The PX-BAR membrane-remodeling unit of sorting nexin 9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 128
structure length 382
sequence length 382
ec nomenclature
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2rakA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2rakA02
2RAIA 4AKVA 4DYLA 4WPEA 2X3VA 2C08A 3LUIA 3IQ2A 2I4KA 4AVMA 3I2WA 4DCNC 1OCSA 2IWLX 1I4DA 2REDA 2CSKA 4WPCA 1X03A 4IKDA 2ELBA 2Z0NA 1I4TA 3LLLA 2V6VA 4NSWA 2RAKA 2L73A 1KMDA 4I1QA 2REAA 2D4CA 3PLTA 4FZSA 4P2IA 4PQOA 2AR5A 2CZOA 1X04A 2YKTA 3OK8A 4OXWA 2EFKA 2V0OA 1XTNA 3QNIA 3SYVA 3DYTA 3HAIA 3M3WA 4ATMA 2V14A 1KQ6A 2Q12A 4HASA 1I4LA 3P0CA 1XTEA 4H8SA 3Q0KA 4BNEA 2EFLA 1H6HA 3G9GA 4P2JA 1O7KA 3HAJA 4ON3A 4NQIA 4IKBA 3Q84A 5C5BA 2RAJA 1OCUA 3FOGA 3HPCX 2Z0VA 2Q13A 4PZGA 3HAHA 3ABHA 2X3WA 2FICA 2X3XA 3SOGA 2YPSA 2DYBA 4AZ9A 4BGJA 2Z0OA 3ACOA 3CAZA 3QWEA 3QE6A 3HPBA 1GD5A 2WWEA 1I49A 1URUA 4PQPA 2D1LA 4IKBB 2ETTA 1WDZA 5C5BB 1Y2OA 1ZWWA
chains in the Genus database with same CATH superfamily
1GNTA 2QFFA 2RAIA 4DYLA 2Z8YA 2WINM 4R5IA 3IQ2A 2JNKA 3I2WA 4DCNC 2CSKA 1UPXA 1I4TA 2MI7A 4E3CA 2V6VA 3EJSA 4UDYX 2F18A 2NCZA 4IWQA 1TQSA 4IWPA 1QWUA 2YLLA 3PLTA 3BUIA 4KIKA 3GI7A 3DX4A 2YL5A 3D50A 2V0OA 1GNLA 3T49A 1YWMA 3DYTA 2F7OA 3KAWA 1KQ6A 2Q12A 1I4LA 1DKZA 3CZSA 1H6HA 1HTYA 4P2JA 2F7QA 1R5EA 2OO2A 4NQIA 4EZRA 4EZOA 4F00A 2OBLA 4EZUA 1JQKA 2YI9A 2DYBA 5TKYA 4D8JA 4EZTA 3BVTA 3C7NA 2X5CA 2WYIA 3QE6A 3BVVA 3UITA 1LQ7A 4PQPA 3VEBA 2D1LA 2YIBA 3FD9A 1HWWA 4H6HA 3RV1A 1WDZA 2ELBA 2OBMA 2X3VA 2YLAA 2C08A 3T47A 3VKHA 4EZXA 3LUIA 4AZCB 3OHXM 3B51X 1SU7A 4WPCA 4R5LA 4IKDA 3T4AG 3LLLA 2YL9A 2ALWA 4AZIA 1KMDA 2F7RA 3KDRA 3QA8A 4PQOA 1R33A 1X04A 2YKTA 3BLBA 4OXWA 3DX0A 3QNIA 3D52A 3SYVA 3HAIA 2YL8A 2V14A 4R5GA 4HASA 4JWDA 1XTEA 4IM3A 2N3KA 4H8SA 2YL6A 4UDXX 4AZGA 4IW0A 1TQWA 3L3OM 4JLCA 2GAFD 4PO2A 2EX3B 4M0MA 4FZPA 4ON3A 4IKBA 3D4YA 3BVXA 3RV0A 5FIGA 1OCUA 1HXKA 3DX2A 2ZXQA 3HPCX 2Z0VA 4IM0A 3T46A 4AZBA 4PZGA 3HAHA 3ABHA 2LM0A 3BUPA 2X3XA 4E81A 2YPSA 4AZ9A 2F7PA 5E84A 4JWIA 3ACOA 3D2FA 2PY6A 1MJGA 1ZYLA 3BUQA 4KIKB 1SU6A 4IKBB 2QKWA 4HR1A 4R5JA 1Y2OA 4IM2A 4HY9A 2OW7A 1ZWWA 4JWEA 2YI8A 2LXYA 3LMFA 2YIAA 4JN4A 3EJRA 3QNJA 4EZYA 3DPQA 1QX1A 2JNSA 3D51A 2I4KA 3CVRA 3DX1A 2IWLX 3LVTA 3DDFA 1X03A 3D2EA 2F1AA 3RPMA 2RAKA 2L73A 1QWNA 2RT6A 5FLEX 2D4CA 4P2IA 2OW6A 3EJTA 3OK8A 1XTNA 3M3WA 4ATMA 4AZ5A 4FM3A 4AZ6A 1R34A 1OAOA 1TQVA 3D4ZA 3Q0KA 1U00A 4H6IA 3G9GA 1O7KA 3O3MB 4JNFA 3HAJA 2PMRA 4FZOA 3ERCC 2EWFA 4JNEA 3FOGA 3DDGA 1E1DA 4EZQA 4AZ7A 4HYBA 2X3WA 3BVWA 1E2UA 4JL9A 4BGJA 1DKXA 2Z0OA 3OWGA 3CAZA 3QWEA 1GN9A 1GD5A 2WWEA 1I49A 4JWCA 4EZNA 1URUA 3I04A 4NPHA 1E9VA 3F7WA 4EZWA 2WYHA 2ND0A 1DKYA 4AKVA 3ER9B 1PS3A 4WPEA 2QXLA 2OZNB 3T48A 3EJUA 2ND1A 3EJPA 4AVMA 3CKDA 3O3NB 4EZVA 2FYVA 4EZSA 1OCSA 1I4DA 2REDA 3DX3A 1O7DB 1OA1A 2GA9D 2GF4A 2Z0NA 4G6QA 3DPPA 1TQUA 4NSWA 4I1QA 2REAA 4FZSA 4EZPA 2AR5A 2CZOA 3DPOA 4R5KA 3O3OB 4F01A 3EJQA 2EFKA 3KAVA 3B52X 3P0CA 3I39X 4HR1B 4BNEA 3A98A 2EFLA 3BUBA 3ER8C 1TQTA 4AZCA 1W9MA 4EZZA 3B53X 3BUDA 2O0I1 3Q84A 5C5BA 3ZEDA 3BVUA 3CZNA 5KBPA 2YIVX 1O7DC 2Q13A 3CV5A 3L3PA 2KHOA 2FICA 3SOGA 4B9QA 2F1BA 1SUFA 3HPBA 3I01A 4AZHA 4IWOA 3VEAA 2ETTA 5C5BB 2RAJA 1SU8A 1OA0A
chains in the Genus database with same CATH topology
2RAIA 4AKVA 4DYLA 4WPEA 2X3VA 2C08A 3LUIA 3IQ2A 2I4KA 4AVMA 3I2WA 4DCNC 1OCSA 2IWLX 1I4DA 2REDA 2CSKA 4WPCA 1X03A 4IKDA 2ELBA 2Z0NA 1I4TA 3LLLA 2V6VA 4NSWA 2RAKA 2L73A 1KMDA 4I1QA 2REAA 2D4CA 3PLTA 4FZSA 4P2IA 4PQOA 2AR5A 2CZOA 1X04A 2YKTA 3OK8A 4OXWA 2EFKA 2V0OA 1XTNA 3QNIA 3SYVA 3DYTA 3HAIA 3M3WA 4ATMA 2V14A 1KQ6A 2Q12A 4HASA 1I4LA 3P0CA 1XTEA 4H8SA 3Q0KA 4BNEA 2EFLA 1H6HA 3G9GA 4P2JA 1O7KA 3HAJA 4ON3A 4NQIA 4IKBA 3Q84A 5C5BA 2RAJA 1OCUA 3FOGA 3HPCX 2Z0VA 2Q13A 4PZGA 3HAHA 3ABHA 2X3WA 2FICA 2X3XA 3SOGA 2YPSA 2DYBA 4AZ9A 4BGJA 2Z0OA 3ACOA 3CAZA 3QWEA 3QE6A 3HPBA 1GD5A 2WWEA 1I49A 1URUA 4PQPA 2D1LA 4IKBB 2ETTA 1WDZA 5C5BB 1Y2OA 1ZWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAI A;  4AKV A;  4DYL A;  4WPE A;  2X3V A;  2C08 A;  3LUI A;  3IQ2 A;  2I4K A;  4AVM A;  3I2W A;  4DCN C;  1OCS A;  2IWL X;  1I4D A;  2RED A;  2CSK A;  4WPC A;  1X03 A;  4IKD A;  2ELB A;  2Z0N A;  1I4T A;  3LLL A;  2V6V A;  4NSW A;  2RAK A;  2L73 A;  1KMD A;  4I1Q A;  2REA A;  2D4C A;  3PLT A;  4FZS A;  4P2I A;  4PQO A;  2AR5 A;  2CZO A;  1X04 A;  2YKT A;  3OK8 A;  4OXW A;  2EFK A;  2V0O A;  1XTN A;  3QNI A;  3SYV A;  3DYT A;  3HAI A;  3M3W A;  4ATM A;  2V14 A;  1KQ6 A;  2Q12 A;  4HAS A;  1I4L A;  3P0C A;  1XTE A;  4H8S A;  3Q0K A;  4BNE A;  2EFL A;  1H6H A;  3G9G A;  4P2J A;  1O7K A;  3HAJ A;  4ON3 A;  4NQI A;  4IKB A;  3Q84 A;  5C5B A;  2RAJ A;  1OCU A;  3FOG A;  3HPC X;  2Z0V A;  2Q13 A;  4PZG A;  3HAH A;  3ABH A;  2X3W A;  2FIC A;  2X3X A;  3SOG A;  2YPS A;  2DYB A;  4AZ9 A;  4BGJ A;  2Z0O A;  3ACO A;  3CAZ A;  3QWE A;  3QE6 A;  3HPB A;  1GD5 A;  2WWE A;  1I49 A;  1URU A;  4PQP A;  2D1L A;  4IKB B;  2ETT A;  1WDZ A;  5C5B B;  1Y2O A;  1ZWW A; 
#chains in the Genus database with same CATH topology
 1GNT A;  2QFF A;  2RAI A;  4DYL A;  2Z8Y A;  2WIN M;  4R5I A;  3IQ2 A;  2JNK A;  3I2W A;  4DCN C;  2CSK A;  1UPX A;  1I4T A;  2MI7 A;  4E3C A;  2V6V A;  3EJS A;  4UDY X;  2F18 A;  2NCZ A;  4IWQ A;  1TQS A;  4IWP A;  1QWU A;  2YLL A;  3PLT A;  3BUI A;  4KIK A;  3GI7 A;  3DX4 A;  2YL5 A;  3D50 A;  2V0O A;  1GNL A;  3T49 A;  1YWM A;  3DYT A;  2F7O A;  3KAW A;  1KQ6 A;  2Q12 A;  1I4L A;  1DKZ A;  3CZS A;  1H6H A;  1HTY A;  4P2J A;  2F7Q A;  1R5E A;  2OO2 A;  4NQI A;  4EZR A;  4EZO A;  4F00 A;  2OBL A;  4EZU A;  1JQK A;  2YI9 A;  2DYB A;  5TKY A;  4D8J A;  4EZT A;  3BVT A;  3C7N A;  2X5C A;  2WYI A;  3QE6 A;  3BVV A;  3UIT A;  1LQ7 A;  4PQP A;  3VEB A;  2D1L A;  2YIB A;  3FD9 A;  1HWW A;  4H6H A;  3RV1 A;  1WDZ A;  2ELB A;  2OBM A;  2X3V A;  2YLA A;  2C08 A;  3T47 A;  3VKH A;  4EZX A;  3LUI A;  4AZC B;  3OHX M;  3B51 X;  1SU7 A;  4WPC A;  4R5L A;  4IKD A;  3T4A G;  3LLL A;  2YL9 A;  2ALW A;  4AZI A;  1KMD A;  2F7R A;  3KDR A;  3QA8 A;  4PQO A;  1R33 A;  1X04 A;  2YKT A;  3BLB A;  4OXW A;  3DX0 A;  3QNI A;  3D52 A;  3SYV A;  3HAI A;  2YL8 A;  2V14 A;  4R5G A;  4HAS A;  4JWD A;  1XTE A;  4IM3 A;  2N3K A;  4H8S A;  2YL6 A;  4UDX X;  4AZG A;  4IW0 A;  1TQW A;  3L3O M;  4JLC A;  2GAF D;  4PO2 A;  2EX3 B;  4M0M A;  4FZP A;  4ON3 A;  4IKB A;  3D4Y A;  3BVX A;  3RV0 A;  5FIG A;  1OCU A;  1HXK A;  3DX2 A;  2ZXQ A;  3HPC X;  2Z0V A;  4IM0 A;  3T46 A;  4AZB A;  4PZG A;  3HAH A;  3ABH A;  2LM0 A;  3BUP A;  2X3X A;  4E81 A;  2YPS A;  4AZ9 A;  2F7P A;  5E84 A;  4JWI A;  3ACO A;  3D2F A;  2PY6 A;  1MJG A;  1ZYL A;  3BUQ A;  4KIK B;  1SU6 A;  4IKB B;  2QKW A;  4HR1 A;  4R5J A;  1Y2O A;  4IM2 A;  4HY9 A;  2OW7 A;  1ZWW A;  4JWE A;  2YI8 A;  2LXY A;  3LMF A;  2YIA A;  4JN4 A;  3EJR A;  3QNJ A;  4EZY A;  3DPQ A;  1QX1 A;  2JNS A;  3D51 A;  2I4K A;  3CVR A;  3DX1 A;  2IWL X;  3LVT A;  3DDF A;  1X03 A;  3D2E A;  2F1A A;  3RPM A;  2RAK A;  2L73 A;  1QWN A;  2RT6 A;  5FLE X;  2D4C A;  4P2I A;  2OW6 A;  3EJT A;  3OK8 A;  1XTN A;  3M3W A;  4ATM A;  4AZ5 A;  4FM3 A;  4AZ6 A;  1R34 A;  1OAO A;  1TQV A;  3D4Z A;  3Q0K A;  1U00 A;  4H6I A;  3G9G A;  1O7K A;  3O3M B;  4JNF A;  3HAJ A;  2PMR A;  4FZO A;  3ERC C;  2EWF A;  4JNE A;  3FOG A;  3DDG A;  1E1D A;  4EZQ A;  4AZ7 A;  4HYB A;  2X3W A;  3BVW A;  1E2U A;  4JL9 A;  4BGJ A;  1DKX A;  2Z0O A;  3OWG A;  3CAZ A;  3QWE A;  1GN9 A;  1GD5 A;  2WWE A;  1I49 A;  4JWC A;  4EZN A;  1URU A;  3I04 A;  4NPH A;  1E9V A;  3F7W A;  4EZW A;  2WYH A;  2ND0 A;  1DKY A;  4AKV A;  3ER9 B;  1PS3 A;  4WPE A;  2QXL A;  2OZN B;  3T48 A;  3EJU A;  2ND1 A;  3EJP A;  4AVM A;  3CKD A;  3O3N B;  4EZV A;  2FYV A;  4EZS A;  1OCS A;  1I4D A;  2RED A;  3DX3 A;  1O7D B;  1OA1 A;  2GA9 D;  2GF4 A;  2Z0N A;  4G6Q A;  3DPP A;  1TQU A;  4NSW A;  4I1Q A;  2REA A;  4FZS A;  4EZP A;  2AR5 A;  2CZO A;  3DPO A;  4R5K A;  3O3O B;  4F01 A;  3EJQ A;  2EFK A;  3KAV A;  3B52 X;  3P0C A;  3I39 X;  4HR1 B;  4BNE A;  3A98 A;  2EFL A;  3BUB A;  3ER8 C;  1TQT A;  4AZC A;  1W9M A;  4EZZ A;  3B53 X;  3BUD A;  2O0I 1;  3Q84 A;  5C5B A;  3ZED A;  3BVU A;  3CZN A;  5KBP A;  2YIV X;  1O7D C;  2Q13 A;  3CV5 A;  3L3P A;  2KHO A;  2FIC A;  3SOG A;  4B9Q A;  2F1B A;  1SUF A;  3HPB A;  3I01 A;  4AZH A;  4IWO A;  3VEA A;  2ETT A;  5C5B B;  2RAJ A;  1SU8 A;  1OA0 A; 
#chains in the Genus database with same CATH homology
 2RAI A;  4AKV A;  4DYL A;  4WPE A;  2X3V A;  2C08 A;  3LUI A;  3IQ2 A;  2I4K A;  4AVM A;  3I2W A;  4DCN C;  1OCS A;  2IWL X;  1I4D A;  2RED A;  2CSK A;  4WPC A;  1X03 A;  4IKD A;  2ELB A;  2Z0N A;  1I4T A;  3LLL A;  2V6V A;  4NSW A;  2RAK A;  2L73 A;  1KMD A;  4I1Q A;  2REA A;  2D4C A;  3PLT A;  4FZS A;  4P2I A;  4PQO A;  2AR5 A;  2CZO A;  1X04 A;  2YKT A;  3OK8 A;  4OXW A;  2EFK A;  2V0O A;  1XTN A;  3QNI A;  3SYV A;  3DYT A;  3HAI A;  3M3W A;  4ATM A;  2V14 A;  1KQ6 A;  2Q12 A;  4HAS A;  1I4L A;  3P0C A;  1XTE A;  4H8S A;  3Q0K A;  4BNE A;  2EFL A;  1H6H A;  3G9G A;  4P2J A;  1O7K A;  3HAJ A;  4ON3 A;  4NQI A;  4IKB A;  3Q84 A;  5C5B A;  2RAJ A;  1OCU A;  3FOG A;  3HPC X;  2Z0V A;  2Q13 A;  4PZG A;  3HAH A;  3ABH A;  2X3W A;  2FIC A;  2X3X A;  3SOG A;  2YPS A;  2DYB A;  4AZ9 A;  4BGJ A;  2Z0O A;  3ACO A;  3CAZ A;  3QWE A;  3QE6 A;  3HPB A;  1GD5 A;  2WWE A;  1I49 A;  1URU A;  4PQP A;  2D1L A;  4IKB B;  2ETT A;  1WDZ A;  5C5B B;  1Y2O A;  1ZWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...