2RAKA

Pi(3)p bound px-bar membrane remodeling unit of sorting nexin 9
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
382
structure length
382
Chain Sequence
b'PGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title The PX-BAR membrane-remodeling unit of sorting nexin 9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 128
structure length 382
sequence length 382
ec nomenclature
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2rakA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2rakA02
4FZSA 1WDZA 2RAKA 3M3WA 1X04A 4IKBA 3HAJA 2REAA 2X3XA 2ELBA 2V0OA 3G9GA 2X3WA 2RAIA 4PQPA 1GD5A 2V6VA 2C08A 3HPBA 4ON3A 3HAHA 4AVMA 2WWEA 2YKTA 1OCSA 3LLLA 3Q84A 2Q12A 1OCUA 3HAIA 2D4CA 2X3VA 4ATMA 3QNIA 3HPCX 4DCNC 5C5BA 3I2WA 3IQ2A 2Z0NA 4P2JA 2Z0VA 4I1QA 1X03A 2I4KA 3ACOA 4NSWA 4WPCA 1KMDA 1I49A 4IKBB 3SYVA 4DYLA 2RAJA 2Z0OA 1I4DA 5C5BB 1XTNA 1O7KA 2ETTA 4PZGA 4IKDA 2REDA 4NQIA 2FICA 1URUA 2YPSA 3PLTA 4WPEA 3OK8A 1ZWWA 3QWEA 3CAZA 2AR5A 3FOGA 1Y2OA 4AZ9A 3DYTA 2L73A 3Q0KA 1KQ6A 2CZOA 2D1LA 4OXWA 3P0CA 2EFKA 4BGJA 2DYBA 2Q13A 3QE6A 4P2IA 4PQOA 2V14A 3SOGA 2EFLA 3ABHA 1H6HA 4AKVA 2IWLX 1I4TA 3LUIA 4H8SA 4BNEA 4HASA 1XTEA 2CSKA 1I4LA
chains in the Genus database with same CATH superfamily
4AZBA 1WDZA 4IKBA 4JLCA 3HAJA 1GN9A 1LQ7A 2V0OA 3G9GA 4AZ5A 2YL6A 2RAIA 1GD5A 3L3PA 1TQWA 3BVUA 4JNEA 4AVMA 2PY6A 2WWEA 2OBMA 2YKTA 3D4ZA 3D50A 3Q84A 3ERCC 2KHOA 1TQTA 3EJRA 2YIBA 3KAVA 4EZSA 4ATMA 5C5BA 3D2EA 4R5IA 1W9MA 2Z0VA 2OBLA 3DX1A 3D52A 4UDXX 4IM0A 2QKWA 4AZCB 3RV1A 2MI7A 2QFFA 2ETTA 4HR1B 3T4AG 3DDFA 1URUA 2YPSA 3BUDA 3QWEA 4FZPA 2F7PA 1GNTA 3BVVA 3BVWA 2YL8A 1OAOA 2F7QA 3A98A 2O0I1 2ZXQA 3T46A 3P0CA 2EFKA 3EJQA 2RT6A 4EZYA 3BLBA 3D4YA 2Q13A 3QE6A 4PQOA 3O3NB 2EFLA 3ABHA 4AKVA 4R5LA 3LUIA 3CVRA 2FYVA 4EZZA 3CKDA 3CZSA 3ER8C 1X04A 1PS3A 3B52X 3ER9B 3QNJA 2V6VA 4JWEA 3T47A 4ON3A 2OO2A 4R5KA 3C7NA 4IM3A 2F18A 3DX2A 1OCUA 4F01A 1R5EA 3LMFA 2F1AA 4AZHA 3BUQA 1HWWA 3QNIA 2GF4A 1DKZA 4IM2A 3IQ2A 4R5GA 2Z0NA 4JWCA 3RV0A 1UPXA 3BVTA 5TKYA 1E2UA 2LM0A 3DPPA 2GAFD 3ACOA 3I04A 1KMDA 2YIVX 1I49A 3UITA 2WINM 2QXLA 1MJGA 3I01A 2REDA 2FICA 4JNFA 3DX3A 1TQUA 2JNSA 1ZWWA 4AZ7A 1SU6A 3CAZA 1SU7A 2AR5A 2YLLA 3FOGA 1R34A 4AZ9A 4AZGA 2CZOA 4OXWA 2YL5A 3VKHA 1DKYA 2WYHA 2DYBA 1O7DB 4KIKB 4HYBA 2V14A 3SOGA 3DPQA 4H8SA 4BNEA 4AZIA 4EZNA 5FLEX 4EZQA 3T49A 1I4LA 4FZSA 4E81A 2RAKA 2F7RA 2REAA 2ND1A 2ELBA 4EZOA 3T48A 4EZWA 1SUFA 4M0MA 4PQPA 2C08A 3HPBA 2YIAA 3L3OM 4NPHA 3HAHA 4IWQA 3DPOA 4AZ6A 4R5JA 3VEAA 1OCSA 3LLLA 3O3OB 4EZPA 4AZCA 2OW7A 1E1DA 2D4CA 2X3VA 2ALWA 3HPCX 3BUBA 3I2WA 4P2JA 4HR1A 4I1QA 4JN4A 4DYLA 2RAJA 4EZRA 3D2FA 5C5BB 1XTNA 5KBPA 3FD9A 1O7KA 1DKXA 2PMRA 4PZGA 4FM3A 4IW0A 3OHXM 4NQIA 1QWNA 3EJSA 4JWDA 1U00A 3PLTA 3OK8A 1R33A 2LXYA 4E3CA 2X5CA 1QWUA 2YL9A 3F7WA 1YWMA 1Y2OA 3DYTA 2GA9D 1KQ6A 3RPMA 2YI9A 1OA1A 2D1LA 2OZNB 1TQSA 4BGJA 4PO2A 3CZNA 1E9VA 4P2IA 3B51X 4UDYX 1H6HA 1I4TA 3D51A 1ZYLA 2OW6A 1JQKA 3M3WA 3BUPA 3EJTA 2X3XA 2EX3B 3B53X 3BVXA 3DX0A 3DX4A 2X3WA 2EWFA 1HTYA 4IWPA 3KDRA 4JWIA 3GI7A 4IWOA 1O7DC 2WYIA 2N3KA 3O3MB 4EZVA 2Q12A 2F1BA 4EZUA 3HAIA 2F7OA 4DCNC 3VEBA 4F00A 1HXKA 4G6QA 3ZEDA 1SU8A 4FZOA 1X03A 2I4KA 4H6HA 4NSWA 3I39X 4WPCA 4IKBB 3QA8A 3SYVA 2Z0OA 1I4DA 4D8JA 2ND0A 4IKDA 1QX1A 2Z8YA 3DDGA 4WPEA 3EJUA 1OA0A 2YI8A 4KIKA 3KAWA 3BUIA 4JL9A 2NCZA 2L73A 1TQVA 3Q0KA 1GNLA 4EZXA 3LVTA 3EJPA 5E84A 4EZTA 3CV5A 5FIGA 2YLAA 4B9QA 3OWGA 4HY9A 4H6IA 2IWLX 4HASA 2JNKA 1XTEA 2CSKA
chains in the Genus database with same CATH topology
4FZSA 1WDZA 2RAKA 3M3WA 1X04A 4IKBA 3HAJA 2REAA 2X3XA 2ELBA 2V0OA 3G9GA 2X3WA 2RAIA 4PQPA 1GD5A 2V6VA 2C08A 3HPBA 4ON3A 3HAHA 4AVMA 2WWEA 2YKTA 1OCSA 3LLLA 3Q84A 2Q12A 1OCUA 3HAIA 2D4CA 2X3VA 4ATMA 3QNIA 3HPCX 4DCNC 5C5BA 3I2WA 3IQ2A 2Z0NA 4P2JA 2Z0VA 4I1QA 1X03A 2I4KA 3ACOA 4NSWA 4WPCA 1KMDA 1I49A 4IKBB 3SYVA 4DYLA 2RAJA 2Z0OA 1I4DA 5C5BB 1XTNA 1O7KA 2ETTA 4PZGA 4IKDA 2REDA 4NQIA 2FICA 1URUA 2YPSA 3PLTA 4WPEA 3OK8A 1ZWWA 3QWEA 3CAZA 2AR5A 3FOGA 1Y2OA 4AZ9A 3DYTA 2L73A 3Q0KA 1KQ6A 2CZOA 2D1LA 4OXWA 3P0CA 2EFKA 4BGJA 2DYBA 2Q13A 3QE6A 4P2IA 4PQOA 2V14A 3SOGA 2EFLA 3ABHA 1H6HA 4AKVA 2IWLX 1I4TA 3LUIA 4H8SA 4BNEA 4HASA 1XTEA 2CSKA 1I4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZS A;  1WDZ A;  2RAK A;  3M3W A;  1X04 A;  4IKB A;  3HAJ A;  2REA A;  2X3X A;  2ELB A;  2V0O A;  3G9G A;  2X3W A;  2RAI A;  4PQP A;  1GD5 A;  2V6V A;  2C08 A;  3HPB A;  4ON3 A;  3HAH A;  4AVM A;  2WWE A;  2YKT A;  1OCS A;  3LLL A;  3Q84 A;  2Q12 A;  1OCU A;  3HAI A;  2D4C A;  2X3V A;  4ATM A;  3QNI A;  3HPC X;  4DCN C;  5C5B A;  3I2W A;  3IQ2 A;  2Z0N A;  4P2J A;  2Z0V A;  4I1Q A;  1X03 A;  2I4K A;  3ACO A;  4NSW A;  4WPC A;  1KMD A;  1I49 A;  4IKB B;  3SYV A;  4DYL A;  2RAJ A;  2Z0O A;  1I4D A;  5C5B B;  1XTN A;  1O7K A;  2ETT A;  4PZG A;  4IKD A;  2RED A;  4NQI A;  2FIC A;  1URU A;  2YPS A;  3PLT A;  4WPE A;  3OK8 A;  1ZWW A;  3QWE A;  3CAZ A;  2AR5 A;  3FOG A;  1Y2O A;  4AZ9 A;  3DYT A;  2L73 A;  3Q0K A;  1KQ6 A;  2CZO A;  2D1L A;  4OXW A;  3P0C A;  2EFK A;  4BGJ A;  2DYB A;  2Q13 A;  3QE6 A;  4P2I A;  4PQO A;  2V14 A;  3SOG A;  2EFL A;  3ABH A;  1H6H A;  4AKV A;  2IWL X;  1I4T A;  3LUI A;  4H8S A;  4BNE A;  4HAS A;  1XTE A;  2CSK A;  1I4L A; 
#chains in the Genus database with same CATH topology
 4AZB A;  1WDZ A;  4IKB A;  4JLC A;  3HAJ A;  1GN9 A;  1LQ7 A;  2V0O A;  3G9G A;  4AZ5 A;  2YL6 A;  2RAI A;  1GD5 A;  3L3P A;  1TQW A;  3BVU A;  4JNE A;  4AVM A;  2PY6 A;  2WWE A;  2OBM A;  2YKT A;  3D4Z A;  3D50 A;  3Q84 A;  3ERC C;  2KHO A;  1TQT A;  3EJR A;  2YIB A;  3KAV A;  4EZS A;  4ATM A;  5C5B A;  3D2E A;  4R5I A;  1W9M A;  2Z0V A;  2OBL A;  3DX1 A;  3D52 A;  4UDX X;  4IM0 A;  2QKW A;  4AZC B;  3RV1 A;  2MI7 A;  2QFF A;  2ETT A;  4HR1 B;  3T4A G;  3DDF A;  1URU A;  2YPS A;  3BUD A;  3QWE A;  4FZP A;  2F7P A;  1GNT A;  3BVV A;  3BVW A;  2YL8 A;  1OAO A;  2F7Q A;  3A98 A;  2O0I 1;  2ZXQ A;  3T46 A;  3P0C A;  2EFK A;  3EJQ A;  2RT6 A;  4EZY A;  3BLB A;  3D4Y A;  2Q13 A;  3QE6 A;  4PQO A;  3O3N B;  2EFL A;  3ABH A;  4AKV A;  4R5L A;  3LUI A;  3CVR A;  2FYV A;  4EZZ A;  3CKD A;  3CZS A;  3ER8 C;  1X04 A;  1PS3 A;  3B52 X;  3ER9 B;  3QNJ A;  2V6V A;  4JWE A;  3T47 A;  4ON3 A;  2OO2 A;  4R5K A;  3C7N A;  4IM3 A;  2F18 A;  3DX2 A;  1OCU A;  4F01 A;  1R5E A;  3LMF A;  2F1A A;  4AZH A;  3BUQ A;  1HWW A;  3QNI A;  2GF4 A;  1DKZ A;  4IM2 A;  3IQ2 A;  4R5G A;  2Z0N A;  4JWC A;  3RV0 A;  1UPX A;  3BVT A;  5TKY A;  1E2U A;  2LM0 A;  3DPP A;  2GAF D;  3ACO A;  3I04 A;  1KMD A;  2YIV X;  1I49 A;  3UIT A;  2WIN M;  2QXL A;  1MJG A;  3I01 A;  2RED A;  2FIC A;  4JNF A;  3DX3 A;  1TQU A;  2JNS A;  1ZWW A;  4AZ7 A;  1SU6 A;  3CAZ A;  1SU7 A;  2AR5 A;  2YLL A;  3FOG A;  1R34 A;  4AZ9 A;  4AZG A;  2CZO A;  4OXW A;  2YL5 A;  3VKH A;  1DKY A;  2WYH A;  2DYB A;  1O7D B;  4KIK B;  4HYB A;  2V14 A;  3SOG A;  3DPQ A;  4H8S A;  4BNE A;  4AZI A;  4EZN A;  5FLE X;  4EZQ A;  3T49 A;  1I4L A;  4FZS A;  4E81 A;  2RAK A;  2F7R A;  2REA A;  2ND1 A;  2ELB A;  4EZO A;  3T48 A;  4EZW A;  1SUF A;  4M0M A;  4PQP A;  2C08 A;  3HPB A;  2YIA A;  3L3O M;  4NPH A;  3HAH A;  4IWQ A;  3DPO A;  4AZ6 A;  4R5J A;  3VEA A;  1OCS A;  3LLL A;  3O3O B;  4EZP A;  4AZC A;  2OW7 A;  1E1D A;  2D4C A;  2X3V A;  2ALW A;  3HPC X;  3BUB A;  3I2W A;  4P2J A;  4HR1 A;  4I1Q A;  4JN4 A;  4DYL A;  2RAJ A;  4EZR A;  3D2F A;  5C5B B;  1XTN A;  5KBP A;  3FD9 A;  1O7K A;  1DKX A;  2PMR A;  4PZG A;  4FM3 A;  4IW0 A;  3OHX M;  4NQI A;  1QWN A;  3EJS A;  4JWD A;  1U00 A;  3PLT A;  3OK8 A;  1R33 A;  2LXY A;  4E3C A;  2X5C A;  1QWU A;  2YL9 A;  3F7W A;  1YWM A;  1Y2O A;  3DYT A;  2GA9 D;  1KQ6 A;  3RPM A;  2YI9 A;  1OA1 A;  2D1L A;  2OZN B;  1TQS A;  4BGJ A;  4PO2 A;  3CZN A;  1E9V A;  4P2I A;  3B51 X;  4UDY X;  1H6H A;  1I4T A;  3D51 A;  1ZYL A;  2OW6 A;  1JQK A;  3M3W A;  3BUP A;  3EJT A;  2X3X A;  2EX3 B;  3B53 X;  3BVX A;  3DX0 A;  3DX4 A;  2X3W A;  2EWF A;  1HTY A;  4IWP A;  3KDR A;  4JWI A;  3GI7 A;  4IWO A;  1O7D C;  2WYI A;  2N3K A;  3O3M B;  4EZV A;  2Q12 A;  2F1B A;  4EZU A;  3HAI A;  2F7O A;  4DCN C;  3VEB A;  4F00 A;  1HXK A;  4G6Q A;  3ZED A;  1SU8 A;  4FZO A;  1X03 A;  2I4K A;  4H6H A;  4NSW A;  3I39 X;  4WPC A;  4IKB B;  3QA8 A;  3SYV A;  2Z0O A;  1I4D A;  4D8J A;  2ND0 A;  4IKD A;  1QX1 A;  2Z8Y A;  3DDG A;  4WPE A;  3EJU A;  1OA0 A;  2YI8 A;  4KIK A;  3KAW A;  3BUI A;  4JL9 A;  2NCZ A;  2L73 A;  1TQV A;  3Q0K A;  1GNL A;  4EZX A;  3LVT A;  3EJP A;  5E84 A;  4EZT A;  3CV5 A;  5FIG A;  2YLA A;  4B9Q A;  3OWG A;  4HY9 A;  4H6I A;  2IWL X;  4HAS A;  2JNK A;  1XTE A;  2CSK A; 
#chains in the Genus database with same CATH homology
 4FZS A;  1WDZ A;  2RAK A;  3M3W A;  1X04 A;  4IKB A;  3HAJ A;  2REA A;  2X3X A;  2ELB A;  2V0O A;  3G9G A;  2X3W A;  2RAI A;  4PQP A;  1GD5 A;  2V6V A;  2C08 A;  3HPB A;  4ON3 A;  3HAH A;  4AVM A;  2WWE A;  2YKT A;  1OCS A;  3LLL A;  3Q84 A;  2Q12 A;  1OCU A;  3HAI A;  2D4C A;  2X3V A;  4ATM A;  3QNI A;  3HPC X;  4DCN C;  5C5B A;  3I2W A;  3IQ2 A;  2Z0N A;  4P2J A;  2Z0V A;  4I1Q A;  1X03 A;  2I4K A;  3ACO A;  4NSW A;  4WPC A;  1KMD A;  1I49 A;  4IKB B;  3SYV A;  4DYL A;  2RAJ A;  2Z0O A;  1I4D A;  5C5B B;  1XTN A;  1O7K A;  2ETT A;  4PZG A;  4IKD A;  2RED A;  4NQI A;  2FIC A;  1URU A;  2YPS A;  3PLT A;  4WPE A;  3OK8 A;  1ZWW A;  3QWE A;  3CAZ A;  2AR5 A;  3FOG A;  1Y2O A;  4AZ9 A;  3DYT A;  2L73 A;  3Q0K A;  1KQ6 A;  2CZO A;  2D1L A;  4OXW A;  3P0C A;  2EFK A;  4BGJ A;  2DYB A;  2Q13 A;  3QE6 A;  4P2I A;  4PQO A;  2V14 A;  3SOG A;  2EFL A;  3ABH A;  1H6H A;  4AKV A;  2IWL X;  1I4T A;  3LUI A;  4H8S A;  4BNE A;  4HAS A;  1XTE A;  2CSK A;  1I4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...