2RAKA

Pi(3)p bound px-bar membrane remodeling unit of sorting nexin 9
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
382
structure length
382
Chain Sequence
PGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title The PX-BAR membrane-remodeling unit of sorting nexin 9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 128
structure length 382
sequence length 382
ec nomenclature
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2rakA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2rakA02
2RAJA 2V6VA 1X03A 2ELBA 1I4LA 3HAHA 4AVMA 2CZOA 3G9GA 2I4KA 4HASA 2V14A 2Q13A 4AKVA 2X3VA 1XTEA 4NQIA 1XTNA 2YPSA 1H6HA 2AR5A 2CSKA 3LUIA 1GD5A 2RAIA 4I1QA 2L73A 4IKBB 1I4DA 1OCUA 2REAA 2Z0OA 2FICA 3Q84A 3CAZA 4PQPA 1I49A 2YKTA 4FZSA 1O7KA 3P0CA 2EFLA 3Q0KA 4P2IA 2Q12A 5C5BA 3DYTA 4BNEA 3SOGA 1ZWWA 3HAJA 1OCSA 2REDA 3QWEA 1X04A 3IQ2A 2V0OA 2X3XA 1URUA 4AZ9A 3HPCX 3I2WA 3ACOA 3HPBA 4DCNC 4P2JA 4BGJA 2IWLX 1WDZA 2WWEA 3LLLA 2DYBA 4WPCA 2Z0NA 4IKDA 1KQ6A 2RAKA 1I4TA 2EFKA 2Z0VA 4DYLA 3OK8A 1KMDA 2C08A 2D1LA 4PQOA 3HAIA 3SYVA 4ATMA 2ETTA 3PLTA 4IKBA 5C5BB 3M3WA 1Y2OA 4WPEA 4NSWA 4H8SA 3FOGA 4ON3A 4OXWA 4PZGA 2X3WA 3QNIA 2D4CA 3ABHA 3QE6A
chains in the Genus database with same CATH superfamily
2V6VA 3EJRA 4IWPA 2CZOA 3G9GA 2I4KA 4IM3A 4NPHA 3B53X 4AZIA 2ND1A 3BLBA 3T48A 4G6QA 4NQIA 3ERCC 1XTNA 1H6HA 3LVTA 4JWDA 2CSKA 4EZWA 1O7DC 2ZXQA 1GD5A 2QXLA 4R5IA 4IKBB 1OCUA 4HY9A 4EZYA 1QX1A 3Q84A 4FZPA 3CAZA 1TQVA 4FZSA 1OA1A 2OZNB 4EZTA 2Q12A 4FZOA 3BVXA 3IQ2A 1LQ7A 4KIKB 4H6IA 1URUA 1PS3A 4UDYX 3I04A 4EZZA 3D4ZA 4F00A 1DKXA 2GAFD 3EJUA 4JNEA 1E1DA 2IWLX 4EZSA 2ND0A 2F7RA 3LLLA 2DYBA 4AZCB 2RAKA 2C08A 3D2EA 3VKHA 3SYVA 3DPPA 3PLTA 4R5KA 5C5BB 1TQTA 5KBPA 4IWOA 3BVWA 4NSWA 3FOGA 4OXWA 3D52A 2OW7A 3QE6A 3DPOA 3CVRA 1E9VA 2OW6A 2LM0A 2V14A 4HR1A 1R33A 2YL6A 1JQKA 2Q13A 4PO2A 2YPSA 2AR5A 2Z8YA 4AZ5A 2YLAA 4E3CA 2RAIA 2L73A 1O7DB 1I4DA 2REAA 1DKYA 2Z0OA 4AZBA 3ZEDA 3EJQA 4JN4A 4FM3A 4PQPA 2EWFA 2OO2A 2PMRA 1ZYLA 3CKDA 1O7KA 3EJPA 3P0CA 2YIAA 3Q0KA 2GA9D 4P2IA 2YL8A 4JNFA 1ZWWA 3DX3A 2OBLA 2REDA 4R5JA 2LXYA 4EZQA 3BVTA 2YI9A 4AZ9A 2YL9A 3I2WA 1TQUA 2WINM 2F18A 3CZSA 4AZGA 3DDGA 4DCNC 4EZUA 2MI7A 2QFFA 1TQWA 3DX2A 4AZ6A 4B9QA 4IKDA 3LMFA 3VEBA 3OK8A 2D1LA 2F7OA 3HAIA 3I39X 2ETTA 5FIGA 4IKBA 3DX0A 2EX3B 4WPEA 4ON3A 3DX1A 3QNIA 3ABHA 3ER8C 3D50A 4AZHA 2YLLA 1X03A 2ELBA 2WYIA 2F7QA 1QWUA 3BVUA 3D2FA 3BUQA 3O3NB 1GNLA 4KIKA 1HXKA 4AKVA 3OHXM 5E84A 4EZRA 3LUIA 4JWEA 2YI8A 3RV1A 2FICA 1GNTA 4AZCA 2YIVX 3RV0A 3OWGA 2GF4A 4R5GA 3CZNA 1I49A 2YKTA 2JNKA 2EFLA 3DX4A 5C5BA 3T4AG 3SOGA 2F1BA 4JL9A 2WYHA 3QWEA 3C7NA 3ER9B 2V0OA 3EJSA 3B51X 4EZNA 2X3XA 1GN9A 3HPCX 4EZVA 4IWQA 4IW0A 3QNJA 4JWIA 3KAVA 4IM2A 4UDXX 3A98A 4EZPA 1TQSA 1HWWA 4BGJA 1KQ6A 1I4TA 2EFKA 4JWCA 2QKWA 2Z0VA 4DYLA 1KMDA 3D51A 4ATMA 1UPXA 3T46A 3BUIA 4H6HA 3D4YA 2YIBA 3QA8A 3M3WA 4M0MA 1Y2OA 1MJGA 5TKYA 4H8SA 4PZGA 2X3WA 1OA0A 2N3KA 4E81A 3EJTA 3T47A 2RAJA 3KDRA 2RT6A 1I4LA 3HAHA 4AVMA 1SU7A 4HASA 3KAWA 3O3OB 5FLEX 2KHOA 2X3VA 1XTEA 3BVVA 1R34A 2YL5A 2FYVA 4I1QA 3GI7A 3L3PA 2OBMA 2F1AA 3BUPA 3BUBA 2F7PA 3T49A 3DYTA 4BNEA 1W9MA 3HAJA 1OCSA 3RPMA 3F7WA 4HR1B 1X04A 1SU6A 3VEAA 1U00A 3DDFA 1R5EA 4D8JA 1SU8A 1HTYA 3ACOA 3HPBA 3O3MB 4EZOA 4P2JA 1WDZA 2JNSA 2WWEA 4HYBA 3B52X 4WPCA 2Z0NA 1QWNA 2ALWA 2PY6A 3DPQA 4R5LA 2X5CA 3CV5A 2NCZA 4IM0A 4PQOA 4EZXA 2O0I1 1DKZA 1SUFA 3FD9A 3L3OM 3BUDA 4JLCA 2D4CA 1OAOA 1E2UA 4F01A 1YWMA 3UITA 4AZ7A 3I01A
chains in the Genus database with same CATH topology
2RAJA 2V6VA 1X03A 2ELBA 1I4LA 3HAHA 4AVMA 2CZOA 3G9GA 2I4KA 4HASA 2V14A 2Q13A 4AKVA 2X3VA 1XTEA 4NQIA 1XTNA 2YPSA 1H6HA 2AR5A 2CSKA 3LUIA 1GD5A 2RAIA 4I1QA 2L73A 4IKBB 1I4DA 1OCUA 2REAA 2Z0OA 2FICA 3Q84A 3CAZA 4PQPA 1I49A 2YKTA 4FZSA 1O7KA 3P0CA 2EFLA 3Q0KA 4P2IA 2Q12A 5C5BA 3DYTA 4BNEA 3SOGA 1ZWWA 3HAJA 1OCSA 2REDA 3QWEA 1X04A 3IQ2A 2V0OA 2X3XA 1URUA 4AZ9A 3HPCX 3I2WA 3ACOA 3HPBA 4DCNC 4P2JA 4BGJA 2IWLX 1WDZA 2WWEA 3LLLA 2DYBA 4WPCA 2Z0NA 4IKDA 1KQ6A 2RAKA 1I4TA 2EFKA 2Z0VA 4DYLA 3OK8A 1KMDA 2C08A 2D1LA 4PQOA 3HAIA 3SYVA 4ATMA 2ETTA 3PLTA 4IKBA 5C5BB 3M3WA 1Y2OA 4WPEA 4NSWA 4H8SA 3FOGA 4ON3A 4OXWA 4PZGA 2X3WA 3QNIA 2D4CA 3ABHA 3QE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAJ A;  2V6V A;  1X03 A;  2ELB A;  1I4L A;  3HAH A;  4AVM A;  2CZO A;  3G9G A;  2I4K A;  4HAS A;  2V14 A;  2Q13 A;  4AKV A;  2X3V A;  1XTE A;  4NQI A;  1XTN A;  2YPS A;  1H6H A;  2AR5 A;  2CSK A;  3LUI A;  1GD5 A;  2RAI A;  4I1Q A;  2L73 A;  4IKB B;  1I4D A;  1OCU A;  2REA A;  2Z0O A;  2FIC A;  3Q84 A;  3CAZ A;  4PQP A;  1I49 A;  2YKT A;  4FZS A;  1O7K A;  3P0C A;  2EFL A;  3Q0K A;  4P2I A;  2Q12 A;  5C5B A;  3DYT A;  4BNE A;  3SOG A;  1ZWW A;  3HAJ A;  1OCS A;  2RED A;  3QWE A;  1X04 A;  3IQ2 A;  2V0O A;  2X3X A;  1URU A;  4AZ9 A;  3HPC X;  3I2W A;  3ACO A;  3HPB A;  4DCN C;  4P2J A;  4BGJ A;  2IWL X;  1WDZ A;  2WWE A;  3LLL A;  2DYB A;  4WPC A;  2Z0N A;  4IKD A;  1KQ6 A;  2RAK A;  1I4T A;  2EFK A;  2Z0V A;  4DYL A;  3OK8 A;  1KMD A;  2C08 A;  2D1L A;  4PQO A;  3HAI A;  3SYV A;  4ATM A;  2ETT A;  3PLT A;  4IKB A;  5C5B B;  3M3W A;  1Y2O A;  4WPE A;  4NSW A;  4H8S A;  3FOG A;  4ON3 A;  4OXW A;  4PZG A;  2X3W A;  3QNI A;  2D4C A;  3ABH A;  3QE6 A; 
#chains in the Genus database with same CATH topology
 2V6V A;  3EJR A;  4IWP A;  2CZO A;  3G9G A;  2I4K A;  4IM3 A;  4NPH A;  3B53 X;  4AZI A;  2ND1 A;  3BLB A;  3T48 A;  4G6Q A;  4NQI A;  3ERC C;  1XTN A;  1H6H A;  3LVT A;  4JWD A;  2CSK A;  4EZW A;  1O7D C;  2ZXQ A;  1GD5 A;  2QXL A;  4R5I A;  4IKB B;  1OCU A;  4HY9 A;  4EZY A;  1QX1 A;  3Q84 A;  4FZP A;  3CAZ A;  1TQV A;  4FZS A;  1OA1 A;  2OZN B;  4EZT A;  2Q12 A;  4FZO A;  3BVX A;  3IQ2 A;  1LQ7 A;  4KIK B;  4H6I A;  1URU A;  1PS3 A;  4UDY X;  3I04 A;  4EZZ A;  3D4Z A;  4F00 A;  1DKX A;  2GAF D;  3EJU A;  4JNE A;  1E1D A;  2IWL X;  4EZS A;  2ND0 A;  2F7R A;  3LLL A;  2DYB A;  4AZC B;  2RAK A;  2C08 A;  3D2E A;  3VKH A;  3SYV A;  3DPP A;  3PLT A;  4R5K A;  5C5B B;  1TQT A;  5KBP A;  4IWO A;  3BVW A;  4NSW A;  3FOG A;  4OXW A;  3D52 A;  2OW7 A;  3QE6 A;  3DPO A;  3CVR A;  1E9V A;  2OW6 A;  2LM0 A;  2V14 A;  4HR1 A;  1R33 A;  2YL6 A;  1JQK A;  2Q13 A;  4PO2 A;  2YPS A;  2AR5 A;  2Z8Y A;  4AZ5 A;  2YLA A;  4E3C A;  2RAI A;  2L73 A;  1O7D B;  1I4D A;  2REA A;  1DKY A;  2Z0O A;  4AZB A;  3ZED A;  3EJQ A;  4JN4 A;  4FM3 A;  4PQP A;  2EWF A;  2OO2 A;  2PMR A;  1ZYL A;  3CKD A;  1O7K A;  3EJP A;  3P0C A;  2YIA A;  3Q0K A;  2GA9 D;  4P2I A;  2YL8 A;  4JNF A;  1ZWW A;  3DX3 A;  2OBL A;  2RED A;  4R5J A;  2LXY A;  4EZQ A;  3BVT A;  2YI9 A;  4AZ9 A;  2YL9 A;  3I2W A;  1TQU A;  2WIN M;  2F18 A;  3CZS A;  4AZG A;  3DDG A;  4DCN C;  4EZU A;  2MI7 A;  2QFF A;  1TQW A;  3DX2 A;  4AZ6 A;  4B9Q A;  4IKD A;  3LMF A;  3VEB A;  3OK8 A;  2D1L A;  2F7O A;  3HAI A;  3I39 X;  2ETT A;  5FIG A;  4IKB A;  3DX0 A;  2EX3 B;  4WPE A;  4ON3 A;  3DX1 A;  3QNI A;  3ABH A;  3ER8 C;  3D50 A;  4AZH A;  2YLL A;  1X03 A;  2ELB A;  2WYI A;  2F7Q A;  1QWU A;  3BVU A;  3D2F A;  3BUQ A;  3O3N B;  1GNL A;  4KIK A;  1HXK A;  4AKV A;  3OHX M;  5E84 A;  4EZR A;  3LUI A;  4JWE A;  2YI8 A;  3RV1 A;  2FIC A;  1GNT A;  4AZC A;  2YIV X;  3RV0 A;  3OWG A;  2GF4 A;  4R5G A;  3CZN A;  1I49 A;  2YKT A;  2JNK A;  2EFL A;  3DX4 A;  5C5B A;  3T4A G;  3SOG A;  2F1B A;  4JL9 A;  2WYH A;  3QWE A;  3C7N A;  3ER9 B;  2V0O A;  3EJS A;  3B51 X;  4EZN A;  2X3X A;  1GN9 A;  3HPC X;  4EZV A;  4IWQ A;  4IW0 A;  3QNJ A;  4JWI A;  3KAV A;  4IM2 A;  4UDX X;  3A98 A;  4EZP A;  1TQS A;  1HWW A;  4BGJ A;  1KQ6 A;  1I4T A;  2EFK A;  4JWC A;  2QKW A;  2Z0V A;  4DYL A;  1KMD A;  3D51 A;  4ATM A;  1UPX A;  3T46 A;  3BUI A;  4H6H A;  3D4Y A;  2YIB A;  3QA8 A;  3M3W A;  4M0M A;  1Y2O A;  1MJG A;  5TKY A;  4H8S A;  4PZG A;  2X3W A;  1OA0 A;  2N3K A;  4E81 A;  3EJT A;  3T47 A;  2RAJ A;  3KDR A;  2RT6 A;  1I4L A;  3HAH A;  4AVM A;  1SU7 A;  4HAS A;  3KAW A;  3O3O B;  5FLE X;  2KHO A;  2X3V A;  1XTE A;  3BVV A;  1R34 A;  2YL5 A;  2FYV A;  4I1Q A;  3GI7 A;  3L3P A;  2OBM A;  2F1A A;  3BUP A;  3BUB A;  2F7P A;  3T49 A;  3DYT A;  4BNE A;  1W9M A;  3HAJ A;  1OCS A;  3RPM A;  3F7W A;  4HR1 B;  1X04 A;  1SU6 A;  3VEA A;  1U00 A;  3DDF A;  1R5E A;  4D8J A;  1SU8 A;  1HTY A;  3ACO A;  3HPB A;  3O3M B;  4EZO A;  4P2J A;  1WDZ A;  2JNS A;  2WWE A;  4HYB A;  3B52 X;  4WPC A;  2Z0N A;  1QWN A;  2ALW A;  2PY6 A;  3DPQ A;  4R5L A;  2X5C A;  3CV5 A;  2NCZ A;  4IM0 A;  4PQO A;  4EZX A;  2O0I 1;  1DKZ A;  1SUF A;  3FD9 A;  3L3O M;  3BUD A;  4JLC A;  2D4C A;  1OAO A;  1E2U A;  4F01 A;  1YWM A;  3UIT A;  4AZ7 A;  3I01 A; 
#chains in the Genus database with same CATH homology
 2RAJ A;  2V6V A;  1X03 A;  2ELB A;  1I4L A;  3HAH A;  4AVM A;  2CZO A;  3G9G A;  2I4K A;  4HAS A;  2V14 A;  2Q13 A;  4AKV A;  2X3V A;  1XTE A;  4NQI A;  1XTN A;  2YPS A;  1H6H A;  2AR5 A;  2CSK A;  3LUI A;  1GD5 A;  2RAI A;  4I1Q A;  2L73 A;  4IKB B;  1I4D A;  1OCU A;  2REA A;  2Z0O A;  2FIC A;  3Q84 A;  3CAZ A;  4PQP A;  1I49 A;  2YKT A;  4FZS A;  1O7K A;  3P0C A;  2EFL A;  3Q0K A;  4P2I A;  2Q12 A;  5C5B A;  3DYT A;  4BNE A;  3SOG A;  1ZWW A;  3HAJ A;  1OCS A;  2RED A;  3QWE A;  1X04 A;  3IQ2 A;  2V0O A;  2X3X A;  1URU A;  4AZ9 A;  3HPC X;  3I2W A;  3ACO A;  3HPB A;  4DCN C;  4P2J A;  4BGJ A;  2IWL X;  1WDZ A;  2WWE A;  3LLL A;  2DYB A;  4WPC A;  2Z0N A;  4IKD A;  1KQ6 A;  2RAK A;  1I4T A;  2EFK A;  2Z0V A;  4DYL A;  3OK8 A;  1KMD A;  2C08 A;  2D1L A;  4PQO A;  3HAI A;  3SYV A;  4ATM A;  2ETT A;  3PLT A;  4IKB A;  5C5B B;  3M3W A;  1Y2O A;  4WPE A;  4NSW A;  4H8S A;  3FOG A;  4ON3 A;  4OXW A;  4PZG A;  2X3W A;  3QNI A;  2D4C A;  3ABH A;  3QE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...