2RASA

Crystal structure of a putative tetr/acrr family transcriptional regulator (saro_0558) from novosphingobium aromaticivorans dsm at 1.80 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
GTEHDAMRARLVDVAQAIVEERGGAGLTLSELAARAGISQANLSRYFETREDLMEAIADYWFHPMVEIMEDVLASDLPPRRKMYEFFARRFVVMRRKWEADPVKLQTYIEVGNDYFEQVRSYIDLADHYLGEIIGEAMSDGAFSGLEVDETISLVNQMCAPYCALNTMTTFMERLSEDKLARIVDAVFDGLSAQDRGARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of predicted transcriptional regulator of TetR/AcrR family (YP_495839.1) from Novosphingobium aromaticivorans DSM 12444 at 1.80 A resolution
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Transcription
total genus 64
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17935 TetR_C_27 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2rasA01
2FD5A 3BNIA 3O8GA 3HTIA 2OERA 5J1YA 4M3EA 3FIWA 5IOZA 3E7QA 1JTYA 5CXIA 3KNWA 3BQZA 5F0FA 4G12A 2NS7A 5D18A 3QPLA 3ZQLA 2HYTA 2Y2ZA 3F1BA 5FHPA 4I76A 3ON2A 5DAJA 3CDLA 3HTAA 1JTXA 4GCLA 4B3AA 2UXPA 2JK3A 5FKOA 3HTJA 2NS8A 3ZQFA 2FX0A 3LHQA 3VW2A 3BHQA 3JSJA 2NX4A 3NXCA 2NP3A 2VKEA 1RKTA 5GPCA 3NI7A 2REKA 3RH2A 4I6ZA 3KZ9A 2YVEA 4AUXA 4NELA 2UXUA 2ZCNA 1JT6A 3CJDA 2O7OA 3GEUA 4X1EA 3DCFA 3LOCA 5D1RA 1JUMA 4M3DA 2XDNA 3BR5A 3LJLA 4MO7A 5F0HA 4DW6A 4UDSA 3QKXA 2VPRA 2DG8A 2FQ4A 3KKDA 2TCTA 2G7GA 3BQYA 4GCKA 2IEKA 3FRQA 2QIBA 2QCOA 2XPVA 5F27A 2XPUA 2F07A 3HIMA 3BJBA 2HKUA 3MNLA 4AC6A 2WGBA 1QVTA 3WHCA 4AF5A 3Q0WA 3T6NA 3S5RA 3BR2A 3HE0A 3DPJA 3VPRA 2WUIA 3LSRA 2QOPA 5GP9A 3HTHA 3BRUA 3AQSA 1ZKGA 3PASA 3ZQHA 3CRJA 1ZK8A 2UXOA 3G1MA 2ZB9A 3B81A 3ON4A 3QQAA 3G1OA 3EGQA 1JUSA 5FKMA 4JL3A 2PBXA 2G7SA 4L62A 2X9DA 4GFKA 2I10A 4ACIA 3EUPA 3Q0VA 2ZCXA 4JYKA 3TP0A 4W97A 2ZOYA 5F0CA 1Z77A 5HSZA 2YVHA 4MXMA 5D19A 2ID3A 5FKNA 2QKOA 5HBUA 2Y30A 2Q24A 1UI6A 1BJZA 2ZCMA 4V2GA 5FGLA 2VKVA 3GZIA 4M3BA 3VW0A 4ABZA 5GPAA 3QPSA 2XGDA 1T33A 5CW8A 1JT0A 3WHBA 2HYJA 3VOXA 3BT9A 3FK7A 5CXGA 4B1RA 3RD3A 3VVYA 2IAIA 2OPTA 3PPBA 3SFIA 3VOKA 1RPWA 3BR3A 5J1UA 3B6AA 2G7LA 3BR1A 2FJ1A 3SDGA 1VI0A 3TP3A 2DG7A 3IH3A 3CCYA 3BCGA 3C07A 4GCTA 3VUQA 4M3GA 4MK6A 2XB5A 5EZHA 3BR6A 3NRGA 3Q3SA 1RKWA 5J3LA 3DEWA 4CGRA 4NN1A 2GBYA 2XRLA 2QWTA 3HGGA 5IP6A 5C4YA 3F0CA 3C2BA 1U9NA 3G1LA 2OF7A 3ZQIA 5K7HA 4D7NA 3LWJA 2DTZA 2XGCA 3VW1A 2GUHA 5HAWA 2D6YA 4ICHA 4JKZA 2HXIA 1QPIA 2FBQA 2JJ7A 3Q0UA 3BTLA 1Z0XA 3IH4A 2RASA 2NP5A 3G7RA 5J1RA 3B6CA 3AQTA 4KWAA 4M3FA 2IU5A 5FKKA 1U9OA 2RAEA 2XPWA 3MVPA 4AC0A 2ID6A 2GFNA 2OI8A 5EFYA 4JNNA 2QTQA 2HQ5A 3ANPA 3BTJA 3G56A 3LSPA 3BR0A 5FMPA 3NPIA 3V78A 3CWRA 2W53A 1T56A 3LSJA 3BTIA 5H9TA 2PZ9A 2UXIA 4D5FA 3P9TA 5K7ZA 4W1UA 3O60A 3VP5A 2ZOZA 5F04A 2RHAA 2XGEA 3O8HA 3VVXA 5K58A 1JUPA 3ZQGA 2G3BA 1A6IA 2IBDA 2UXHA 3PM1A 5F08A 2TRTA 5EZGA 5FKLA 1SGMA 5K7FA 2WV1A 3NNRA 3IH2A 3HGYA 1ORKA 4ME9A 5F1JA 2X6OA 2Y31A 3VIBA 2V57A 5IPAA 3ANGA 1QVUA 2GENA 2G0EA 3VVZA 4D5CA 4YZEA 4HKUA 2O7TA 3QBMA 3V6GA 3COLA 4PXIA 4GFLA 4XK4A 5AQCA 5EYRA 5IOYA 2EH3A 3BTCA 3KKCA 4D7MA 4V2FA 3IUVA 3FK6A 1UI5A 2HXOA
chains in the Genus database with same CATH superfamily
2FD5A 3BNIA 3O8GA 3HTIA 2OERA 5J1YA 4M3EA 3FIWA 5IOZA 3E7QA 1JTYA 5CXIA 3KNWA 3BQZA 5F0FA 4G12A 2NS7A 5D18A 3QPLA 3ZQLA 2HYTA 2Y2ZA 3F1BA 5FHPA 4I76A 3ON2A 5DAJA 3CDLA 3HTAA 1JTXA 4GCLA 4B3AA 2UXPA 3KYLA 2JK3A 5FKOA 3HTJA 2NS8A 3ZQFA 2FX0A 3LHQA 3VW2A 3SWHA 3BHQA 3JSJA 2NX4A 3NXCA 2NP3A 2VKEA 1RKTA 5GPCA 3NI7A 2REKA 3RH2A 4I6ZA 3KZ9A 2YVEA 4AUXA 4NELA 2YVXA 2UXUA 2ZCNA 1JT6A 3CJDA 2O7OA 3GEUA 4X1EA 3DCFA 3LOCA 5D1RA 1JUMA 4M3DA 2XDNA 3BR5A 3LJLA 4MO7A 5F0HA 4DW6A 4UDSA 3QKXA 2VPRA 2DG8A 2FQ4A 3KKDA 2TCTA 2G7GA 3BQYA 4GCKA 3DU5A 2IEKA 3FRQA 2QIBA 2QCOA 2XPVA 5F27A 2XPUA 2R7SA 2F07A 3HIMA 3BJBA 2FJI1 2HKUA 3MNLA 4AC6A 2WGBA 1QVTA 3WHCA 4AF5A 3Q0WA 3T6NA 3S5RA 3BR2A 3HE0A 3DPJA 3VPRA 2WUIA 3LSRA 2QOPA 5GP9A 3HTHA 3BRUA 3AQSA 1ZKGA 3PASA 3ZQHA 3CRJA 1ZK8A 2UXOA 3G1MA 2ZB9A 3B81A 3ON4A 3QQAA 3G1OA 3EGQA 1JUSA 5FKMA 4JL3A 2PBXA 2G7SA 4L62A 2X9DA 4GFKA 2I10A 4ACIA 3EUPA 3Q0VA 2ZCXA 4JYKA 4IRVA 3TP0A 4W97A 2ZOYA 5F0CA 1Z77A 5HSZA 2YVHA 4DVYP 4MXMA 5D19A 2ID3A 5FKNA 2QKOA 5HBUA 2Y30A 2Q24A 1UI6A 1BJZA 2ZCMA 2R7RA 4V2GA 5FGLA 3FHNA 2R7UA 2B1EA 2VKVA 3GZIA 4M3BA 3VW0A 4ABZA 5GPAA 3QPSA 4U9NA 2XGDA 1T33A 5CW8A 1JT0A 3WHBA 2HYJA 3VOXA 3BT9A 3FK7A 5CXGA 4B1RA 2R7OA 3RD3A 3VVYA 2IAIA 2OPTA 3PPBA 3SFIA 3VOKA 1RPWA 4OD5A 3BR3A 5J1UA 3B6AA 2G7LA 3BR1A 2FJ1A 3SDGA 1VI0A 3TP3A 2DG7A 3IH3A 2R7QA 3CCYA 3BCGA 3C07A 4GCTA 3VUQA 4M3GA 4MK6A 2XB5A 5EZHA 3BR6A 3NRGA 3Q3SA 2R7WA 1RKWA 5J3LA 3DEWA 4CGRA 4NN1A 2GBYA 2XRLA 2QWTA 3HGGA 5IP6A 5C4YA 3F0CA 3C2BA 1U9NA 3G1LA 2PFVA 2OF7A 4OD4A 3ZQIA 5K7HA 4D7NA 3LWJA 2DTZA 5CQGA 2XGCA 3VW1A 2GUHA 5HAWA 2D6YA 3NS4A 4ICHA 4JKZA 2HXIA 1QPIA 2FBQA 2JJ7A 4WIBA 3Q0UA 3BTLA 1Z0XA 4U9LA 3IH4A 2RASA 2NP5A 3G7RA 5J1RA 3B6CA 3AQTA 2R7VA 4KWAA 4M3FA 2IU5A 5FKKA 1U9OA 2RAEA 2XPWA 3MVPA 4AC0A 2ID6A 2GFNA 2OI8A 5EFYA 4JNNA 2QTQA 2HQ5A 3ANPA 3BTJA 3G56A 3LSPA 3BR0A 5FMPA 3DU6A 3NPIA 3V78A 3CWRA 2W53A 1T56A 3LSJA 3BTIA 5H9TA 2PZ9A 2UXIA 2ZY9A 4D5FA 3P9TA 5K7ZA 4W1UA 3K8PC 3O60A 3VP5A 2ZOZA 5F04A 4C2MA 2RHAA 2XGEA 3O8HA 3VVXA 5K58A 1JUPA 3ZQGA 2G3BA 1A6IA 2IBDA 2UXHA 2R7TA 3PM1A 5F08A 2TRTA 5EZGA 5FKLA 1SGMA 2R7XA 5K7FA 2B3WA 2WV1A 3NNRA 3IH2A 3HGYA 1ORKA 4ME9A 5F1JA 2X6OA 2Y31A 2A2FX 3VIBA 2V57A 5IPAA 3ANGA 1QVUA 2GENA 2G0EA 3VVZA 4D5CA 4YZEA 4HKUA 2O7TA 3QBMA 3V6GA 3COLA 4PXIA 4GFLA 4XK4A 3VTIA 5AQCA 5EYRA 5IOYA 2EH3A 3BTCA 3KKCA 4D7MA 4V2FA 3IUVA 3FK6A 1UI5A 2HXOA
chains in the Genus database with same CATH topology
2FD5A 3BNIA 3O8GA 3HTIA 2OERA 5J1YA 4M3EA 3FIWA 5IOZA 3E7QA 1JTYA 5CXIA 3KNWA 3BQZA 5F0FA 4G12A 2NS7A 5D18A 3QPLA 3ZQLA 2HYTA 2Y2ZA 3F1BA 5FHPA 4I76A 3ON2A 5DAJA 3CDLA 3HTAA 1JTXA 4GCLA 4B3AA 2UXPA 2JK3A 5FKOA 3HTJA 2NS8A 3ZQFA 2FX0A 3LHQA 3VW2A 3BHQA 3JSJA 2NX4A 3NXCA 2NP3A 2VKEA 1RKTA 5GPCA 3NI7A 2REKA 3RH2A 4I6ZA 3KZ9A 2YVEA 4AUXA 4NELA 2UXUA 2ZCNA 1JT6A 3CJDA 2O7OA 3GEUA 4X1EA 3DCFA 3LOCA 5D1RA 1JUMA 4M3DA 2XDNA 3BR5A 3LJLA 4MO7A 5F0HA 4DW6A 4UDSA 3QKXA 2VPRA 2DG8A 2FQ4A 3KKDA 2TCTA 2G7GA 3BQYA 4GCKA 2IEKA 3FRQA 2QIBA 2QCOA 2XPVA 5F27A 2XPUA 2F07A 3HIMA 3BJBA 2HKUA 3MNLA 4AC6A 2WGBA 1QVTA 3WHCA 4AF5A 3Q0WA 3T6NA 3S5RA 3BR2A 3HE0A 3DPJA 3VPRA 2WUIA 3LSRA 2QOPA 5GP9A 3HTHA 3BRUA 3AQSA 1ZKGA 3PASA 3ZQHA 3CRJA 1ZK8A 2UXOA 3G1MA 2ZB9A 3B81A 3ON4A 3QQAA 3G1OA 3EGQA 1JUSA 5FKMA 4JL3A 2PBXA 2G7SA 4L62A 2X9DA 4GFKA 2I10A 4ACIA 3EUPA 3Q0VA 2ZCXA 4JYKA 3TP0A 4W97A 2ZOYA 5F0CA 1Z77A 5HSZA 2YVHA 4MXMA 5D19A 2ID3A 5FKNA 2QKOA 5HBUA 2Y30A 2Q24A 1UI6A 1BJZA 2ZCMA 4V2GA 5FGLA 2VKVA 3GZIA 4M3BA 3VW0A 4ABZA 5GPAA 3QPSA 2XGDA 1T33A 5CW8A 1JT0A 3WHBA 2HYJA 3VOXA 3BT9A 3FK7A 5CXGA 4B1RA 3RD3A 3VVYA 2IAIA 2OPTA 3PPBA 3SFIA 3VOKA 1RPWA 3BR3A 5J1UA 3B6AA 2G7LA 3BR1A 2FJ1A 3SDGA 1VI0A 3TP3A 2DG7A 3IH3A 3CCYA 3BCGA 3C07A 4GCTA 3VUQA 4M3GA 4MK6A 2XB5A 5EZHA 3BR6A 3NRGA 3Q3SA 1RKWA 5J3LA 3DEWA 4CGRA 4NN1A 2GBYA 2XRLA 2QWTA 3HGGA 5IP6A 5C4YA 3F0CA 3C2BA 1U9NA 3G1LA 2OF7A 3ZQIA 5K7HA 4D7NA 3LWJA 2DTZA 2XGCA 3VW1A 2GUHA 5HAWA 2D6YA 4ICHA 4JKZA 2HXIA 1QPIA 2FBQA 2JJ7A 3Q0UA 3BTLA 1Z0XA 3IH4A 2RASA 2NP5A 3G7RA 5J1RA 3B6CA 3AQTA 4KWAA 4M3FA 2IU5A 5FKKA 1U9OA 2RAEA 2XPWA 3MVPA 4AC0A 2ID6A 2GFNA 2OI8A 5EFYA 4JNNA 2QTQA 2HQ5A 3ANPA 3BTJA 3G56A 3LSPA 3BR0A 5FMPA 3NPIA 3V78A 3CWRA 2W53A 1T56A 3LSJA 3BTIA 5H9TA 2PZ9A 2UXIA 4D5FA 3P9TA 5K7ZA 4W1UA 3O60A 3VP5A 2ZOZA 5F04A 2RHAA 2XGEA 3O8HA 3VVXA 5K58A 1JUPA 3ZQGA 2G3BA 1A6IA 2IBDA 2UXHA 3PM1A 5F08A 2TRTA 5EZGA 5FKLA 1SGMA 5K7FA 2WV1A 3NNRA 3IH2A 3HGYA 1ORKA 4ME9A 5F1JA 2X6OA 2Y31A 3VIBA 2V57A 5IPAA 3ANGA 1QVUA 2GENA 2G0EA 3VVZA 4D5CA 4YZEA 4HKUA 2O7TA 3QBMA 3V6GA 3COLA 4PXIA 4GFLA 4XK4A 5AQCA 5EYRA 5IOYA 2EH3A 3BTCA 3KKCA 4D7MA 4V2FA 3IUVA 3FK6A 1UI5A 2HXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD5 A;  3BNI A;  3O8G A;  3HTI A;  2OER A;  5J1Y A;  4M3E A;  3FIW A;  5IOZ A;  3E7Q A;  1JTY A;  5CXI A;  3KNW A;  3BQZ A;  5F0F A;  4G12 A;  2NS7 A;  5D18 A;  3QPL A;  3ZQL A;  2HYT A;  2Y2Z A;  3F1B A;  5FHP A;  4I76 A;  3ON2 A;  5DAJ A;  3CDL A;  3HTA A;  1JTX A;  4GCL A;  4B3A A;  2UXP A;  2JK3 A;  5FKO A;  3HTJ A;  2NS8 A;  3ZQF A;  2FX0 A;  3LHQ A;  3VW2 A;  3BHQ A;  3JSJ A;  2NX4 A;  3NXC A;  2NP3 A;  2VKE A;  1RKT A;  5GPC A;  3NI7 A;  2REK A;  3RH2 A;  4I6Z A;  3KZ9 A;  2YVE A;  4AUX A;  4NEL A;  2UXU A;  2ZCN A;  1JT6 A;  3CJD A;  2O7O A;  3GEU A;  4X1E A;  3DCF A;  3LOC A;  5D1R A;  1JUM A;  4M3D A;  2XDN A;  3BR5 A;  3LJL A;  4MO7 A;  5F0H A;  4DW6 A;  4UDS A;  3QKX A;  2VPR A;  2DG8 A;  2FQ4 A;  3KKD A;  2TCT A;  2G7G A;  3BQY A;  4GCK A;  2IEK A;  3FRQ A;  2QIB A;  2QCO A;  2XPV A;  5F27 A;  2XPU A;  2F07 A;  3HIM A;  3BJB A;  2HKU A;  3MNL A;  4AC6 A;  2WGB A;  1QVT A;  3WHC A;  4AF5 A;  3Q0W A;  3T6N A;  3S5R A;  3BR2 A;  3HE0 A;  3DPJ A;  3VPR A;  2WUI A;  3LSR A;  2QOP A;  5GP9 A;  3HTH A;  3BRU A;  3AQS A;  1ZKG A;  3PAS A;  3ZQH A;  3CRJ A;  1ZK8 A;  2UXO A;  3G1M A;  2ZB9 A;  3B81 A;  3ON4 A;  3QQA A;  3G1O A;  3EGQ A;  1JUS A;  5FKM A;  4JL3 A;  2PBX A;  2G7S A;  4L62 A;  2X9D A;  4GFK A;  2I10 A;  4ACI A;  3EUP A;  3Q0V A;  2ZCX A;  4JYK A;  3TP0 A;  4W97 A;  2ZOY A;  5F0C A;  1Z77 A;  5HSZ A;  2YVH A;  4MXM A;  5D19 A;  2ID3 A;  5FKN A;  2QKO A;  5HBU A;  2Y30 A;  2Q24 A;  1UI6 A;  1BJZ A;  2ZCM A;  4V2G A;  5FGL A;  2VKV A;  3GZI A;  4M3B A;  3VW0 A;  4ABZ A;  5GPA A;  3QPS A;  2XGD A;  1T33 A;  5CW8 A;  1JT0 A;  3WHB A;  2HYJ A;  3VOX A;  3BT9 A;  3FK7 A;  5CXG A;  4B1R A;  3RD3 A;  3VVY A;  2IAI A;  2OPT A;  3PPB A;  3SFI A;  3VOK A;  1RPW A;  3BR3 A;  5J1U A;  3B6A A;  2G7L A;  3BR1 A;  2FJ1 A;  3SDG A;  1VI0 A;  3TP3 A;  2DG7 A;  3IH3 A;  3CCY A;  3BCG A;  3C07 A;  4GCT A;  3VUQ A;  4M3G A;  4MK6 A;  2XB5 A;  5EZH A;  3BR6 A;  3NRG A;  3Q3S A;  1RKW A;  5J3L A;  3DEW A;  4CGR A;  4NN1 A;  2GBY A;  2XRL A;  2QWT A;  3HGG A;  5IP6 A;  5C4Y A;  3F0C A;  3C2B A;  1U9N A;  3G1L A;  2OF7 A;  3ZQI A;  5K7H A;  4D7N A;  3LWJ A;  2DTZ A;  2XGC A;  3VW1 A;  2GUH A;  5HAW A;  2D6Y A;  4ICH A;  4JKZ A;  2HXI A;  1QPI A;  2FBQ A;  2JJ7 A;  3Q0U A;  3BTL A;  1Z0X A;  3IH4 A;  2RAS A;  2NP5 A;  3G7R A;  5J1R A;  3B6C A;  3AQT A;  4KWA A;  4M3F A;  2IU5 A;  5FKK A;  1U9O A;  2RAE A;  2XPW A;  3MVP A;  4AC0 A;  2ID6 A;  2GFN A;  2OI8 A;  5EFY A;  4JNN A;  2QTQ A;  2HQ5 A;  3ANP A;  3BTJ A;  3G56 A;  3LSP A;  3BR0 A;  5FMP A;  3NPI A;  3V78 A;  3CWR A;  2W53 A;  1T56 A;  3LSJ A;  3BTI A;  5H9T A;  2PZ9 A;  2UXI A;  4D5F A;  3P9T A;  5K7Z A;  4W1U A;  3O60 A;  3VP5 A;  2ZOZ A;  5F04 A;  2RHA A;  2XGE A;  3O8H A;  3VVX A;  5K58 A;  1JUP A;  3ZQG A;  2G3B A;  1A6I A;  2IBD A;  2UXH A;  3PM1 A;  5F08 A;  2TRT A;  5EZG A;  5FKL A;  1SGM A;  5K7F A;  2WV1 A;  3NNR A;  3IH2 A;  3HGY A;  1ORK A;  4ME9 A;  5F1J A;  2X6O A;  2Y31 A;  3VIB A;  2V57 A;  5IPA A;  3ANG A;  1QVU A;  2GEN A;  2G0E A;  3VVZ A;  4D5C A;  4YZE A;  4HKU A;  2O7T A;  3QBM A;  3V6G A;  3COL A;  4PXI A;  4GFL A;  4XK4 A;  5AQC A;  5EYR A;  5IOY A;  2EH3 A;  3BTC A;  3KKC A;  4D7M A;  4V2F A;  3IUV A;  3FK6 A;  1UI5 A;  2HXO A; 
#chains in the Genus database with same CATH topology
 2FD5 A;  3BNI A;  3O8G A;  3HTI A;  2OER A;  5J1Y A;  4M3E A;  3FIW A;  5IOZ A;  3E7Q A;  1JTY A;  5CXI A;  3KNW A;  3BQZ A;  5F0F A;  4G12 A;  2NS7 A;  5D18 A;  3QPL A;  3ZQL A;  2HYT A;  2Y2Z A;  3F1B A;  5FHP A;  4I76 A;  3ON2 A;  5DAJ A;  3CDL A;  3HTA A;  1JTX A;  4GCL A;  4B3A A;  2UXP A;  3KYL A;  2JK3 A;  5FKO A;  3HTJ A;  2NS8 A;  3ZQF A;  2FX0 A;  3LHQ A;  3VW2 A;  3SWH A;  3BHQ A;  3JSJ A;  2NX4 A;  3NXC A;  2NP3 A;  2VKE A;  1RKT A;  5GPC A;  3NI7 A;  2REK A;  3RH2 A;  4I6Z A;  3KZ9 A;  2YVE A;  4AUX A;  4NEL A;  2YVX A;  2UXU A;  2ZCN A;  1JT6 A;  3CJD A;  2O7O A;  3GEU A;  4X1E A;  3DCF A;  3LOC A;  5D1R A;  1JUM A;  4M3D A;  2XDN A;  3BR5 A;  3LJL A;  4MO7 A;  5F0H A;  4DW6 A;  4UDS A;  3QKX A;  2VPR A;  2DG8 A;  2FQ4 A;  3KKD A;  2TCT A;  2G7G A;  3BQY A;  4GCK A;  3DU5 A;  2IEK A;  3FRQ A;  2QIB A;  2QCO A;  2XPV A;  5F27 A;  2XPU A;  2R7S A;  2F07 A;  3HIM A;  3BJB A;  2FJI 1;  2HKU A;  3MNL A;  4AC6 A;  2WGB A;  1QVT A;  3WHC A;  4AF5 A;  3Q0W A;  3T6N A;  3S5R A;  3BR2 A;  3HE0 A;  3DPJ A;  3VPR A;  2WUI A;  3LSR A;  2QOP A;  5GP9 A;  3HTH A;  3BRU A;  3AQS A;  1ZKG A;  3PAS A;  3ZQH A;  3CRJ A;  1ZK8 A;  2UXO A;  3G1M A;  2ZB9 A;  3B81 A;  3ON4 A;  3QQA A;  3G1O A;  3EGQ A;  1JUS A;  5FKM A;  4JL3 A;  2PBX A;  2G7S A;  4L62 A;  2X9D A;  4GFK A;  2I10 A;  4ACI A;  3EUP A;  3Q0V A;  2ZCX A;  4JYK A;  4IRV A;  3TP0 A;  4W97 A;  2ZOY A;  5F0C A;  1Z77 A;  5HSZ A;  2YVH A;  4DVY P;  4MXM A;  5D19 A;  2ID3 A;  5FKN A;  2QKO A;  5HBU A;  2Y30 A;  2Q24 A;  1UI6 A;  1BJZ A;  2ZCM A;  2R7R A;  4V2G A;  5FGL A;  3FHN A;  2R7U A;  2B1E A;  2VKV A;  3GZI A;  4M3B A;  3VW0 A;  4ABZ A;  5GPA A;  3QPS A;  4U9N A;  2XGD A;  1T33 A;  5CW8 A;  1JT0 A;  3WHB A;  2HYJ A;  3VOX A;  3BT9 A;  3FK7 A;  5CXG A;  4B1R A;  2R7O A;  3RD3 A;  3VVY A;  2IAI A;  2OPT A;  3PPB A;  3SFI A;  3VOK A;  1RPW A;  4OD5 A;  3BR3 A;  5J1U A;  3B6A A;  2G7L A;  3BR1 A;  2FJ1 A;  3SDG A;  1VI0 A;  3TP3 A;  2DG7 A;  3IH3 A;  2R7Q A;  3CCY A;  3BCG A;  3C07 A;  4GCT A;  3VUQ A;  4M3G A;  4MK6 A;  2XB5 A;  5EZH A;  3BR6 A;  3NRG A;  3Q3S A;  2R7W A;  1RKW A;  5J3L A;  3DEW A;  4CGR A;  4NN1 A;  2GBY A;  2XRL A;  2QWT A;  3HGG A;  5IP6 A;  5C4Y A;  3F0C A;  3C2B A;  1U9N A;  3G1L A;  2PFV A;  2OF7 A;  4OD4 A;  3ZQI A;  5K7H A;  4D7N A;  3LWJ A;  2DTZ A;  5CQG A;  2XGC A;  3VW1 A;  2GUH A;  5HAW A;  2D6Y A;  3NS4 A;  4ICH A;  4JKZ A;  2HXI A;  1QPI A;  2FBQ A;  2JJ7 A;  4WIB A;  3Q0U A;  3BTL A;  1Z0X A;  4U9L A;  3IH4 A;  2RAS A;  2NP5 A;  3G7R A;  5J1R A;  3B6C A;  3AQT A;  2R7V A;  4KWA A;  4M3F A;  2IU5 A;  5FKK A;  1U9O A;  2RAE A;  2XPW A;  3MVP A;  4AC0 A;  2ID6 A;  2GFN A;  2OI8 A;  5EFY A;  4JNN A;  2QTQ A;  2HQ5 A;  3ANP A;  3BTJ A;  3G56 A;  3LSP A;  3BR0 A;  5FMP A;  3DU6 A;  3NPI A;  3V78 A;  3CWR A;  2W53 A;  1T56 A;  3LSJ A;  3BTI A;  5H9T A;  2PZ9 A;  2UXI A;  2ZY9 A;  4D5F A;  3P9T A;  5K7Z A;  4W1U A;  3K8P C;  3O60 A;  3VP5 A;  2ZOZ A;  5F04 A;  4C2M A;  2RHA A;  2XGE A;  3O8H A;  3VVX A;  5K58 A;  1JUP A;  3ZQG A;  2G3B A;  1A6I A;  2IBD A;  2UXH A;  2R7T A;  3PM1 A;  5F08 A;  2TRT A;  5EZG A;  5FKL A;  1SGM A;  2R7X A;  5K7F A;  2B3W A;  2WV1 A;  3NNR A;  3IH2 A;  3HGY A;  1ORK A;  4ME9 A;  5F1J A;  2X6O A;  2Y31 A;  2A2F X;  3VIB A;  2V57 A;  5IPA A;  3ANG A;  1QVU A;  2GEN A;  2G0E A;  3VVZ A;  4D5C A;  4YZE A;  4HKU A;  2O7T A;  3QBM A;  3V6G A;  3COL A;  4PXI A;  4GFL A;  4XK4 A;  3VTI A;  5AQC A;  5EYR A;  5IOY A;  2EH3 A;  3BTC A;  3KKC A;  4D7M A;  4V2F A;  3IUV A;  3FK6 A;  1UI5 A;  2HXO A; 
#chains in the Genus database with same CATH homology
 2FD5 A;  3BNI A;  3O8G A;  3HTI A;  2OER A;  5J1Y A;  4M3E A;  3FIW A;  5IOZ A;  3E7Q A;  1JTY A;  5CXI A;  3KNW A;  3BQZ A;  5F0F A;  4G12 A;  2NS7 A;  5D18 A;  3QPL A;  3ZQL A;  2HYT A;  2Y2Z A;  3F1B A;  5FHP A;  4I76 A;  3ON2 A;  5DAJ A;  3CDL A;  3HTA A;  1JTX A;  4GCL A;  4B3A A;  2UXP A;  2JK3 A;  5FKO A;  3HTJ A;  2NS8 A;  3ZQF A;  2FX0 A;  3LHQ A;  3VW2 A;  3BHQ A;  3JSJ A;  2NX4 A;  3NXC A;  2NP3 A;  2VKE A;  1RKT A;  5GPC A;  3NI7 A;  2REK A;  3RH2 A;  4I6Z A;  3KZ9 A;  2YVE A;  4AUX A;  4NEL A;  2UXU A;  2ZCN A;  1JT6 A;  3CJD A;  2O7O A;  3GEU A;  4X1E A;  3DCF A;  3LOC A;  5D1R A;  1JUM A;  4M3D A;  2XDN A;  3BR5 A;  3LJL A;  4MO7 A;  5F0H A;  4DW6 A;  4UDS A;  3QKX A;  2VPR A;  2DG8 A;  2FQ4 A;  3KKD A;  2TCT A;  2G7G A;  3BQY A;  4GCK A;  2IEK A;  3FRQ A;  2QIB A;  2QCO A;  2XPV A;  5F27 A;  2XPU A;  2F07 A;  3HIM A;  3BJB A;  2HKU A;  3MNL A;  4AC6 A;  2WGB A;  1QVT A;  3WHC A;  4AF5 A;  3Q0W A;  3T6N A;  3S5R A;  3BR2 A;  3HE0 A;  3DPJ A;  3VPR A;  2WUI A;  3LSR A;  2QOP A;  5GP9 A;  3HTH A;  3BRU A;  3AQS A;  1ZKG A;  3PAS A;  3ZQH A;  3CRJ A;  1ZK8 A;  2UXO A;  3G1M A;  2ZB9 A;  3B81 A;  3ON4 A;  3QQA A;  3G1O A;  3EGQ A;  1JUS A;  5FKM A;  4JL3 A;  2PBX A;  2G7S A;  4L62 A;  2X9D A;  4GFK A;  2I10 A;  4ACI A;  3EUP A;  3Q0V A;  2ZCX A;  4JYK A;  3TP0 A;  4W97 A;  2ZOY A;  5F0C A;  1Z77 A;  5HSZ A;  2YVH A;  4MXM A;  5D19 A;  2ID3 A;  5FKN A;  2QKO A;  5HBU A;  2Y30 A;  2Q24 A;  1UI6 A;  1BJZ A;  2ZCM A;  4V2G A;  5FGL A;  2VKV A;  3GZI A;  4M3B A;  3VW0 A;  4ABZ A;  5GPA A;  3QPS A;  2XGD A;  1T33 A;  5CW8 A;  1JT0 A;  3WHB A;  2HYJ A;  3VOX A;  3BT9 A;  3FK7 A;  5CXG A;  4B1R A;  3RD3 A;  3VVY A;  2IAI A;  2OPT A;  3PPB A;  3SFI A;  3VOK A;  1RPW A;  3BR3 A;  5J1U A;  3B6A A;  2G7L A;  3BR1 A;  2FJ1 A;  3SDG A;  1VI0 A;  3TP3 A;  2DG7 A;  3IH3 A;  3CCY A;  3BCG A;  3C07 A;  4GCT A;  3VUQ A;  4M3G A;  4MK6 A;  2XB5 A;  5EZH A;  3BR6 A;  3NRG A;  3Q3S A;  1RKW A;  5J3L A;  3DEW A;  4CGR A;  4NN1 A;  2GBY A;  2XRL A;  2QWT A;  3HGG A;  5IP6 A;  5C4Y A;  3F0C A;  3C2B A;  1U9N A;  3G1L A;  2OF7 A;  3ZQI A;  5K7H A;  4D7N A;  3LWJ A;  2DTZ A;  2XGC A;  3VW1 A;  2GUH A;  5HAW A;  2D6Y A;  4ICH A;  4JKZ A;  2HXI A;  1QPI A;  2FBQ A;  2JJ7 A;  3Q0U A;  3BTL A;  1Z0X A;  3IH4 A;  2RAS A;  2NP5 A;  3G7R A;  5J1R A;  3B6C A;  3AQT A;  4KWA A;  4M3F A;  2IU5 A;  5FKK A;  1U9O A;  2RAE A;  2XPW A;  3MVP A;  4AC0 A;  2ID6 A;  2GFN A;  2OI8 A;  5EFY A;  4JNN A;  2QTQ A;  2HQ5 A;  3ANP A;  3BTJ A;  3G56 A;  3LSP A;  3BR0 A;  5FMP A;  3NPI A;  3V78 A;  3CWR A;  2W53 A;  1T56 A;  3LSJ A;  3BTI A;  5H9T A;  2PZ9 A;  2UXI A;  4D5F A;  3P9T A;  5K7Z A;  4W1U A;  3O60 A;  3VP5 A;  2ZOZ A;  5F04 A;  2RHA A;  2XGE A;  3O8H A;  3VVX A;  5K58 A;  1JUP A;  3ZQG A;  2G3B A;  1A6I A;  2IBD A;  2UXH A;  3PM1 A;  5F08 A;  2TRT A;  5EZG A;  5FKL A;  1SGM A;  5K7F A;  2WV1 A;  3NNR A;  3IH2 A;  3HGY A;  1ORK A;  4ME9 A;  5F1J A;  2X6O A;  2Y31 A;  3VIB A;  2V57 A;  5IPA A;  3ANG A;  1QVU A;  2GEN A;  2G0E A;  3VVZ A;  4D5C A;  4YZE A;  4HKU A;  2O7T A;  3QBM A;  3V6G A;  3COL A;  4PXI A;  4GFL A;  4XK4 A;  5AQC A;  5EYR A;  5IOY A;  2EH3 A;  3BTC A;  3KKC A;  4D7M A;  4V2F A;  3IUV A;  3FK6 A;  1UI5 A;  2HXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...