2RASA

Crystal structure of a putative tetr/acrr family transcriptional regulator (saro_0558) from novosphingobium aromaticivorans dsm at 1.80 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
b'GTEHDAMRARLVDVAQAIVEERGGAGLTLSELAARAGISQANLSRYFETREDLMEAIADYWFHPMVEIMEDVLASDLPPRRKMYEFFARRFVVMRRKWEADPVKLQTYIEVGNDYFEQVRSYIDLADHYLGEIIGEAMSDGAFSGLEVDETISLVNQMCAPYCALNTMTTFMERLSEDKLARIVDAVFDGLSAQDRGARS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of predicted transcriptional regulator of TetR/AcrR family (YP_495839.1) from Novosphingobium aromaticivorans DSM 12444 at 1.80 A resolution
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Transcription
total genus 64
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17935 TetR_C_27 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2rasA01
5FKMA 2XB5A 4JKZA 5EZHA 3LWJA 5D19A 1A6IA 3KNWA 2UXIA 3NNRA 3O8GA 5C4YA 3ZQFA 3T6NA 3ANPA 4MK6A 2Y2ZA 2Y31A 3NXCA 3MNLA 3LOCA 2NS7A 3CRJA 2IAIA 3NI7A 3DCFA 3BTJA 3HE0A 4W97A 3CWRA 5HSZA 2QWTA 5DAJA 3FIWA 3E7QA 3G1LA 2IEKA 2NP3A 3G1OA 2ZB9A 1RKWA 3KKDA 3PASA 3MVPA 1QPIA 3ZQLA 4D7MA 2EH3A 3JSJA 3BQYA 5K58A 2OF7A 3BQZA 5FKNA 2PZ9A 4ICHA 2FD5A 1U9OA 2QOPA 2HYJA 5J1RA 2WV1A 3VW2A 3KKCA 4AC6A 1RPWA 2HQ5A 5F0HA 2UXOA 2QCOA 3SFIA 3AQSA 1ORKA 2WGBA 5J1YA 3RD3A 2YVHA 4JYKA 2XPWA 5F04A 2G0EA 3HTHA 2QTQA 2HYTA 4AUXA 5K7ZA 3G7RA 2ZOZA 4ACIA 3CJDA 4M3FA 5F27A 5FKLA 2HXOA 3VPRA 2ID3A 3GZIA 4M3GA 1ZK8A 3PM1A 5K7FA 3VOXA 1Z0XA 3SDGA 3F0CA 3B81A 4XK4A 2YVEA 3CDLA 3Q0UA 3ON4A 3QPLA 3LSRA 2O7TA 1SGMA 2RAEA 2PBXA 3ON2A 5CXIA 3VVZA 3LSPA 2G7GA 3BR6A 5EYRA 4NELA 3C2BA 4NN1A 2WUIA 2QIBA 2RHAA 1JTXA 5AQCA 3VUQA 2UXPA 2X6OA 3AQTA 3LJLA 2QKOA 5F08A 2XDNA 4AF5A 4M3DA 3Q3SA 5FGLA 3VVYA 5EZGA 5FKKA 3G1MA 4GCTA 2JK3A 3V78A 5D18A 3VW1A 4D5FA 2OPTA 2NS8A 1VI0A 2I10A 3IH2A 3DEWA 2F07A 2UXUA 3F1BA 3HGYA 4ABZA 5FKOA 3FK6A 3EGQA 4B3AA 2G7SA 3VW0A 2XGDA 5F0CA 3WHBA 1RKTA 3HTJA 2FJ1A 3QPSA 3VVXA 2G7LA 4ME9A 2O7OA 2OERA 2XPVA 3HIMA 1JUPA 2IBDA 4M3BA 5IOZA 2GFNA 3C07A 3BR2A 2ZCMA 3G56A 1JTYA 1QVTA 3COLA 2NP5A 3FRQA 3Q0VA 5J1UA 3VP5A 2JJ7A 2GBYA 3IH4A 3BR0A 3QQAA 1U9NA 5K7HA 5CW8A 5HBUA 3B6CA 3GEUA 4PXIA 1ZKGA 5H9TA 3RH2A 4CGRA 3HGGA 4MXMA 4GCKA 2Y30A 2ID6A 5IOYA 1T33A 3BR3A 3BTIA 2ZCXA 2XRLA 3BTLA 3S5RA 2XPUA 5EFYA 3NPIA 2X9DA 3TP0A 2GUHA 4W1UA 4JL3A 2G3BA 3FK7A 2XGEA 5GP9A 3BRUA 1BJZA 3ZQIA 2RASA 4D5CA 3P9TA 2REKA 5GPCA 3B6AA 4G12A 4KWAA 3KZ9A 4JNNA 4GFKA 2V57A 2FQ4A 4L62A 2XGCA 2ZOYA 3BNIA 2Q24A 3O8HA 3ZQGA 2TCTA 2DG7A 4V2FA 2GENA 3IH3A 2IU5A 1UI6A 2VPRA 3O60A 2TRTA 2UXHA 3EUPA 3TP3A 1Z77A 3VOKA 3BTCA 2FX0A 4X1EA 1JT0A 4MO7A 3ZQHA 1T56A 3HTAA 5FHPA 3ANGA 3LSJA 3BR5A 4AC0A 4I76A 4I6ZA 1QVUA 3BR1A 3CCYA 3BHQA 3QKXA 3BJBA 4DW6A 4UDSA 1UI5A 2OI8A 2ZCNA 5FMPA 5IP6A 3QBMA 4M3EA 3WHCA 2DG8A 2NX4A 4YZEA 5D1RA 2W53A 2HKUA 3BT9A 2VKEA 3VIBA 3HTIA 4D7NA 1JUSA 2DTZA 2HXIA 5CXGA 5F0FA 3Q0WA 2D6YA 4GCLA 3NRGA 2VKVA 3BCGA 5GPAA 1JT6A 5HAWA 3DPJA 3V6GA 5IPAA 3LHQA 5J3LA 3IUVA 4B1RA 5F1JA 3PPBA 4GFLA 4V2GA 4HKUA 1JUMA 2FBQA
chains in the Genus database with same CATH superfamily
2R7TA 5FKMA 2XB5A 4JKZA 5EZHA 3LWJA 5D19A 1A6IA 3KNWA 2UXIA 3NNRA 4OD5A 3O8GA 5C4YA 3ZQFA 3T6NA 3ANPA 4MK6A 2Y2ZA 2Y31A 3NXCA 3MNLA 3LOCA 2NS7A 3CRJA 2IAIA 3NI7A 3DCFA 3BTJA 3HE0A 4W97A 3CWRA 4IRVA 5HSZA 3VTIA 2QWTA 5DAJA 4U9LA 3FIWA 3E7QA 3G1LA 2IEKA 2NP3A 3G1OA 2ZB9A 1RKWA 3KKDA 3PASA 3MVPA 1QPIA 3ZQLA 4D7MA 2EH3A 3JSJA 2R7XA 3KYLA 3BQYA 4DVYP 5K58A 2OF7A 3BQZA 5FKNA 3FHNA 2PZ9A 4ICHA 2FD5A 1U9OA 2QOPA 2HYJA 5J1RA 2WV1A 3VW2A 3KKCA 4AC6A 1RPWA 2HQ5A 5F0HA 2UXOA 2QCOA 3SFIA 3AQSA 1ORKA 2WGBA 2YVXA 5J1YA 3RD3A 2YVHA 4JYKA 2XPWA 5F04A 2G0EA 3HTHA 2QTQA 2HYTA 4AUXA 5K7ZA 3G7RA 2ZOZA 4ACIA 2R7UA 3CJDA 4M3FA 5F27A 5FKLA 2HXOA 3VPRA 2ID3A 3GZIA 4M3GA 1ZK8A 3PM1A 5K7FA 3VOXA 1Z0XA 3SDGA 2R7OA 3F0CA 3B81A 4XK4A 2YVEA 3CDLA 3Q0UA 3ON4A 3DU6A 3QPLA 3LSRA 2O7TA 1SGMA 2RAEA 2PBXA 3ON2A 5CXIA 4OD4A 3NS4A 3VVZA 3LSPA 2G7GA 3BR6A 2PFVA 5EYRA 4NELA 3C2BA 4NN1A 2WUIA 2QIBA 2RHAA 1JTXA 5AQCA 3VUQA 2UXPA 2X6OA 3AQTA 3LJLA 2QKOA 5F08A 2XDNA 4AF5A 4M3DA 3Q3SA 5FGLA 3VVYA 5EZGA 5FKKA 3G1MA 4GCTA 2JK3A 3V78A 5D18A 3VW1A 2FJI1 4D5FA 2OPTA 2NS8A 1VI0A 3SWHA 2I10A 3IH2A 3DEWA 5CQGA 2F07A 2UXUA 3F1BA 3HGYA 4ABZA 5FKOA 3FK6A 3EGQA 4B3AA 2G7SA 3VW0A 2XGDA 5F0CA 3WHBA 1RKTA 3HTJA 2FJ1A 3QPSA 3VVXA 2G7LA 4ME9A 2O7OA 2B3WA 2OERA 2XPVA 3HIMA 1JUPA 2IBDA 4M3BA 5IOZA 2GFNA 3C07A 3BR2A 2ZCMA 3G56A 1JTYA 1QVTA 3COLA 2NP5A 3FRQA 3Q0VA 5J1UA 3VP5A 2JJ7A 2GBYA 3IH4A 3BR0A 3QQAA 1U9NA 5K7HA 5CW8A 5HBUA 3B6CA 3GEUA 4PXIA 1ZKGA 5H9TA 3RH2A 4CGRA 2B1EA 3HGGA 4MXMA 4GCKA 2Y30A 2ID6A 5IOYA 1T33A 3BR3A 3BTIA 2ZCXA 2XRLA 3BTLA 3S5RA 2XPUA 5EFYA 3NPIA 2X9DA 3TP0A 2R7RA 2GUHA 4W1UA 4JL3A 2G3BA 3FK7A 2XGEA 5GP9A 3BRUA 1BJZA 3ZQIA 2RASA 4D5CA 3P9TA 2REKA 5GPCA 3B6AA 4G12A 4KWAA 3KZ9A 4JNNA 4GFKA 2V57A 2FQ4A 4L62A 2XGCA 2ZOYA 3BNIA 2Q24A 3O8HA 3ZQGA 2TCTA 2DG7A 4V2FA 2GENA 3IH3A 2IU5A 1UI6A 2VPRA 3O60A 2TRTA 2UXHA 3EUPA 3TP3A 1Z77A 3K8PC 3VOKA 2R7QA 3BTCA 2FX0A 4X1EA 1JT0A 4MO7A 3ZQHA 1T56A 3HTAA 5FHPA 3ANGA 3LSJA 3BR5A 4AC0A 4I76A 4I6ZA 2A2FX 1QVUA 3BR1A 3CCYA 3BHQA 3QKXA 3BJBA 4DW6A 4UDSA 1UI5A 2OI8A 2ZCNA 5FMPA 5IP6A 3QBMA 4M3EA 3DU5A 3WHCA 2DG8A 2NX4A 4YZEA 2R7VA 5D1RA 2W53A 4WIBA 2HKUA 3BT9A 2VKEA 3VIBA 3HTIA 4D7NA 1JUSA 2DTZA 2HXIA 5CXGA 5F0FA 2R7SA 3Q0WA 2D6YA 4GCLA 3NRGA 2VKVA 2ZY9A 2R7WA 3BCGA 5GPAA 1JT6A 5HAWA 3DPJA 3V6GA 5IPAA 3LHQA 5J3LA 3IUVA 4B1RA 5F1JA 3PPBA 4GFLA 4C2MA 4V2GA 4HKUA 1JUMA 4U9NA 2FBQA
chains in the Genus database with same CATH topology
5FKMA 2XB5A 4JKZA 5EZHA 3LWJA 5D19A 1A6IA 3KNWA 2UXIA 3NNRA 3O8GA 5C4YA 3ZQFA 3T6NA 3ANPA 4MK6A 2Y2ZA 2Y31A 3NXCA 3MNLA 3LOCA 2NS7A 3CRJA 2IAIA 3NI7A 3DCFA 3BTJA 3HE0A 4W97A 3CWRA 5HSZA 2QWTA 5DAJA 3FIWA 3E7QA 3G1LA 2IEKA 2NP3A 3G1OA 2ZB9A 1RKWA 3KKDA 3PASA 3MVPA 1QPIA 3ZQLA 4D7MA 2EH3A 3JSJA 3BQYA 5K58A 2OF7A 3BQZA 5FKNA 2PZ9A 4ICHA 2FD5A 1U9OA 2QOPA 2HYJA 5J1RA 2WV1A 3VW2A 3KKCA 4AC6A 1RPWA 2HQ5A 5F0HA 2UXOA 2QCOA 3SFIA 3AQSA 1ORKA 2WGBA 5J1YA 3RD3A 2YVHA 4JYKA 2XPWA 5F04A 2G0EA 3HTHA 2QTQA 2HYTA 4AUXA 5K7ZA 3G7RA 2ZOZA 4ACIA 3CJDA 4M3FA 5F27A 5FKLA 2HXOA 3VPRA 2ID3A 3GZIA 4M3GA 1ZK8A 3PM1A 5K7FA 3VOXA 1Z0XA 3SDGA 3F0CA 3B81A 4XK4A 2YVEA 3CDLA 3Q0UA 3ON4A 3QPLA 3LSRA 2O7TA 1SGMA 2RAEA 2PBXA 3ON2A 5CXIA 3VVZA 3LSPA 2G7GA 3BR6A 5EYRA 4NELA 3C2BA 4NN1A 2WUIA 2QIBA 2RHAA 1JTXA 5AQCA 3VUQA 2UXPA 2X6OA 3AQTA 3LJLA 2QKOA 5F08A 2XDNA 4AF5A 4M3DA 3Q3SA 5FGLA 3VVYA 5EZGA 5FKKA 3G1MA 4GCTA 2JK3A 3V78A 5D18A 3VW1A 4D5FA 2OPTA 2NS8A 1VI0A 2I10A 3IH2A 3DEWA 2F07A 2UXUA 3F1BA 3HGYA 4ABZA 5FKOA 3FK6A 3EGQA 4B3AA 2G7SA 3VW0A 2XGDA 5F0CA 3WHBA 1RKTA 3HTJA 2FJ1A 3QPSA 3VVXA 2G7LA 4ME9A 2O7OA 2OERA 2XPVA 3HIMA 1JUPA 2IBDA 4M3BA 5IOZA 2GFNA 3C07A 3BR2A 2ZCMA 3G56A 1JTYA 1QVTA 3COLA 2NP5A 3FRQA 3Q0VA 5J1UA 3VP5A 2JJ7A 2GBYA 3IH4A 3BR0A 3QQAA 1U9NA 5K7HA 5CW8A 5HBUA 3B6CA 3GEUA 4PXIA 1ZKGA 5H9TA 3RH2A 4CGRA 3HGGA 4MXMA 4GCKA 2Y30A 2ID6A 5IOYA 1T33A 3BR3A 3BTIA 2ZCXA 2XRLA 3BTLA 3S5RA 2XPUA 5EFYA 3NPIA 2X9DA 3TP0A 2GUHA 4W1UA 4JL3A 2G3BA 3FK7A 2XGEA 5GP9A 3BRUA 1BJZA 3ZQIA 2RASA 4D5CA 3P9TA 2REKA 5GPCA 3B6AA 4G12A 4KWAA 3KZ9A 4JNNA 4GFKA 2V57A 2FQ4A 4L62A 2XGCA 2ZOYA 3BNIA 2Q24A 3O8HA 3ZQGA 2TCTA 2DG7A 4V2FA 2GENA 3IH3A 2IU5A 1UI6A 2VPRA 3O60A 2TRTA 2UXHA 3EUPA 3TP3A 1Z77A 3VOKA 3BTCA 2FX0A 4X1EA 1JT0A 4MO7A 3ZQHA 1T56A 3HTAA 5FHPA 3ANGA 3LSJA 3BR5A 4AC0A 4I76A 4I6ZA 1QVUA 3BR1A 3CCYA 3BHQA 3QKXA 3BJBA 4DW6A 4UDSA 1UI5A 2OI8A 2ZCNA 5FMPA 5IP6A 3QBMA 4M3EA 3WHCA 2DG8A 2NX4A 4YZEA 5D1RA 2W53A 2HKUA 3BT9A 2VKEA 3VIBA 3HTIA 4D7NA 1JUSA 2DTZA 2HXIA 5CXGA 5F0FA 3Q0WA 2D6YA 4GCLA 3NRGA 2VKVA 3BCGA 5GPAA 1JT6A 5HAWA 3DPJA 3V6GA 5IPAA 3LHQA 5J3LA 3IUVA 4B1RA 5F1JA 3PPBA 4GFLA 4V2GA 4HKUA 1JUMA 2FBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKM A;  2XB5 A;  4JKZ A;  5EZH A;  3LWJ A;  5D19 A;  1A6I A;  3KNW A;  2UXI A;  3NNR A;  3O8G A;  5C4Y A;  3ZQF A;  3T6N A;  3ANP A;  4MK6 A;  2Y2Z A;  2Y31 A;  3NXC A;  3MNL A;  3LOC A;  2NS7 A;  3CRJ A;  2IAI A;  3NI7 A;  3DCF A;  3BTJ A;  3HE0 A;  4W97 A;  3CWR A;  5HSZ A;  2QWT A;  5DAJ A;  3FIW A;  3E7Q A;  3G1L A;  2IEK A;  2NP3 A;  3G1O A;  2ZB9 A;  1RKW A;  3KKD A;  3PAS A;  3MVP A;  1QPI A;  3ZQL A;  4D7M A;  2EH3 A;  3JSJ A;  3BQY A;  5K58 A;  2OF7 A;  3BQZ A;  5FKN A;  2PZ9 A;  4ICH A;  2FD5 A;  1U9O A;  2QOP A;  2HYJ A;  5J1R A;  2WV1 A;  3VW2 A;  3KKC A;  4AC6 A;  1RPW A;  2HQ5 A;  5F0H A;  2UXO A;  2QCO A;  3SFI A;  3AQS A;  1ORK A;  2WGB A;  5J1Y A;  3RD3 A;  2YVH A;  4JYK A;  2XPW A;  5F04 A;  2G0E A;  3HTH A;  2QTQ A;  2HYT A;  4AUX A;  5K7Z A;  3G7R A;  2ZOZ A;  4ACI A;  3CJD A;  4M3F A;  5F27 A;  5FKL A;  2HXO A;  3VPR A;  2ID3 A;  3GZI A;  4M3G A;  1ZK8 A;  3PM1 A;  5K7F A;  3VOX A;  1Z0X A;  3SDG A;  3F0C A;  3B81 A;  4XK4 A;  2YVE A;  3CDL A;  3Q0U A;  3ON4 A;  3QPL A;  3LSR A;  2O7T A;  1SGM A;  2RAE A;  2PBX A;  3ON2 A;  5CXI A;  3VVZ A;  3LSP A;  2G7G A;  3BR6 A;  5EYR A;  4NEL A;  3C2B A;  4NN1 A;  2WUI A;  2QIB A;  2RHA A;  1JTX A;  5AQC A;  3VUQ A;  2UXP A;  2X6O A;  3AQT A;  3LJL A;  2QKO A;  5F08 A;  2XDN A;  4AF5 A;  4M3D A;  3Q3S A;  5FGL A;  3VVY A;  5EZG A;  5FKK A;  3G1M A;  4GCT A;  2JK3 A;  3V78 A;  5D18 A;  3VW1 A;  4D5F A;  2OPT A;  2NS8 A;  1VI0 A;  2I10 A;  3IH2 A;  3DEW A;  2F07 A;  2UXU A;  3F1B A;  3HGY A;  4ABZ A;  5FKO A;  3FK6 A;  3EGQ A;  4B3A A;  2G7S A;  3VW0 A;  2XGD A;  5F0C A;  3WHB A;  1RKT A;  3HTJ A;  2FJ1 A;  3QPS A;  3VVX A;  2G7L A;  4ME9 A;  2O7O A;  2OER A;  2XPV A;  3HIM A;  1JUP A;  2IBD A;  4M3B A;  5IOZ A;  2GFN A;  3C07 A;  3BR2 A;  2ZCM A;  3G56 A;  1JTY A;  1QVT A;  3COL A;  2NP5 A;  3FRQ A;  3Q0V A;  5J1U A;  3VP5 A;  2JJ7 A;  2GBY A;  3IH4 A;  3BR0 A;  3QQA A;  1U9N A;  5K7H A;  5CW8 A;  5HBU A;  3B6C A;  3GEU A;  4PXI A;  1ZKG A;  5H9T A;  3RH2 A;  4CGR A;  3HGG A;  4MXM A;  4GCK A;  2Y30 A;  2ID6 A;  5IOY A;  1T33 A;  3BR3 A;  3BTI A;  2ZCX A;  2XRL A;  3BTL A;  3S5R A;  2XPU A;  5EFY A;  3NPI A;  2X9D A;  3TP0 A;  2GUH A;  4W1U A;  4JL3 A;  2G3B A;  3FK7 A;  2XGE A;  5GP9 A;  3BRU A;  1BJZ A;  3ZQI A;  2RAS A;  4D5C A;  3P9T A;  2REK A;  5GPC A;  3B6A A;  4G12 A;  4KWA A;  3KZ9 A;  4JNN A;  4GFK A;  2V57 A;  2FQ4 A;  4L62 A;  2XGC A;  2ZOY A;  3BNI A;  2Q24 A;  3O8H A;  3ZQG A;  2TCT A;  2DG7 A;  4V2F A;  2GEN A;  3IH3 A;  2IU5 A;  1UI6 A;  2VPR A;  3O60 A;  2TRT A;  2UXH A;  3EUP A;  3TP3 A;  1Z77 A;  3VOK A;  3BTC A;  2FX0 A;  4X1E A;  1JT0 A;  4MO7 A;  3ZQH A;  1T56 A;  3HTA A;  5FHP A;  3ANG A;  3LSJ A;  3BR5 A;  4AC0 A;  4I76 A;  4I6Z A;  1QVU A;  3BR1 A;  3CCY A;  3BHQ A;  3QKX A;  3BJB A;  4DW6 A;  4UDS A;  1UI5 A;  2OI8 A;  2ZCN A;  5FMP A;  5IP6 A;  3QBM A;  4M3E A;  3WHC A;  2DG8 A;  2NX4 A;  4YZE A;  5D1R A;  2W53 A;  2HKU A;  3BT9 A;  2VKE A;  3VIB A;  3HTI A;  4D7N A;  1JUS A;  2DTZ A;  2HXI A;  5CXG A;  5F0F A;  3Q0W A;  2D6Y A;  4GCL A;  3NRG A;  2VKV A;  3BCG A;  5GPA A;  1JT6 A;  5HAW A;  3DPJ A;  3V6G A;  5IPA A;  3LHQ A;  5J3L A;  3IUV A;  4B1R A;  5F1J A;  3PPB A;  4GFL A;  4V2G A;  4HKU A;  1JUM A;  2FBQ A; 
#chains in the Genus database with same CATH topology
 2R7T A;  5FKM A;  2XB5 A;  4JKZ A;  5EZH A;  3LWJ A;  5D19 A;  1A6I A;  3KNW A;  2UXI A;  3NNR A;  4OD5 A;  3O8G A;  5C4Y A;  3ZQF A;  3T6N A;  3ANP A;  4MK6 A;  2Y2Z A;  2Y31 A;  3NXC A;  3MNL A;  3LOC A;  2NS7 A;  3CRJ A;  2IAI A;  3NI7 A;  3DCF A;  3BTJ A;  3HE0 A;  4W97 A;  3CWR A;  4IRV A;  5HSZ A;  3VTI A;  2QWT A;  5DAJ A;  4U9L A;  3FIW A;  3E7Q A;  3G1L A;  2IEK A;  2NP3 A;  3G1O A;  2ZB9 A;  1RKW A;  3KKD A;  3PAS A;  3MVP A;  1QPI A;  3ZQL A;  4D7M A;  2EH3 A;  3JSJ A;  2R7X A;  3KYL A;  3BQY A;  4DVY P;  5K58 A;  2OF7 A;  3BQZ A;  5FKN A;  3FHN A;  2PZ9 A;  4ICH A;  2FD5 A;  1U9O A;  2QOP A;  2HYJ A;  5J1R A;  2WV1 A;  3VW2 A;  3KKC A;  4AC6 A;  1RPW A;  2HQ5 A;  5F0H A;  2UXO A;  2QCO A;  3SFI A;  3AQS A;  1ORK A;  2WGB A;  2YVX A;  5J1Y A;  3RD3 A;  2YVH A;  4JYK A;  2XPW A;  5F04 A;  2G0E A;  3HTH A;  2QTQ A;  2HYT A;  4AUX A;  5K7Z A;  3G7R A;  2ZOZ A;  4ACI A;  2R7U A;  3CJD A;  4M3F A;  5F27 A;  5FKL A;  2HXO A;  3VPR A;  2ID3 A;  3GZI A;  4M3G A;  1ZK8 A;  3PM1 A;  5K7F A;  3VOX A;  1Z0X A;  3SDG A;  2R7O A;  3F0C A;  3B81 A;  4XK4 A;  2YVE A;  3CDL A;  3Q0U A;  3ON4 A;  3DU6 A;  3QPL A;  3LSR A;  2O7T A;  1SGM A;  2RAE A;  2PBX A;  3ON2 A;  5CXI A;  4OD4 A;  3NS4 A;  3VVZ A;  3LSP A;  2G7G A;  3BR6 A;  2PFV A;  5EYR A;  4NEL A;  3C2B A;  4NN1 A;  2WUI A;  2QIB A;  2RHA A;  1JTX A;  5AQC A;  3VUQ A;  2UXP A;  2X6O A;  3AQT A;  3LJL A;  2QKO A;  5F08 A;  2XDN A;  4AF5 A;  4M3D A;  3Q3S A;  5FGL A;  3VVY A;  5EZG A;  5FKK A;  3G1M A;  4GCT A;  2JK3 A;  3V78 A;  5D18 A;  3VW1 A;  2FJI 1;  4D5F A;  2OPT A;  2NS8 A;  1VI0 A;  3SWH A;  2I10 A;  3IH2 A;  3DEW A;  5CQG A;  2F07 A;  2UXU A;  3F1B A;  3HGY A;  4ABZ A;  5FKO A;  3FK6 A;  3EGQ A;  4B3A A;  2G7S A;  3VW0 A;  2XGD A;  5F0C A;  3WHB A;  1RKT A;  3HTJ A;  2FJ1 A;  3QPS A;  3VVX A;  2G7L A;  4ME9 A;  2O7O A;  2B3W A;  2OER A;  2XPV A;  3HIM A;  1JUP A;  2IBD A;  4M3B A;  5IOZ A;  2GFN A;  3C07 A;  3BR2 A;  2ZCM A;  3G56 A;  1JTY A;  1QVT A;  3COL A;  2NP5 A;  3FRQ A;  3Q0V A;  5J1U A;  3VP5 A;  2JJ7 A;  2GBY A;  3IH4 A;  3BR0 A;  3QQA A;  1U9N A;  5K7H A;  5CW8 A;  5HBU A;  3B6C A;  3GEU A;  4PXI A;  1ZKG A;  5H9T A;  3RH2 A;  4CGR A;  2B1E A;  3HGG A;  4MXM A;  4GCK A;  2Y30 A;  2ID6 A;  5IOY A;  1T33 A;  3BR3 A;  3BTI A;  2ZCX A;  2XRL A;  3BTL A;  3S5R A;  2XPU A;  5EFY A;  3NPI A;  2X9D A;  3TP0 A;  2R7R A;  2GUH A;  4W1U A;  4JL3 A;  2G3B A;  3FK7 A;  2XGE A;  5GP9 A;  3BRU A;  1BJZ A;  3ZQI A;  2RAS A;  4D5C A;  3P9T A;  2REK A;  5GPC A;  3B6A A;  4G12 A;  4KWA A;  3KZ9 A;  4JNN A;  4GFK A;  2V57 A;  2FQ4 A;  4L62 A;  2XGC A;  2ZOY A;  3BNI A;  2Q24 A;  3O8H A;  3ZQG A;  2TCT A;  2DG7 A;  4V2F A;  2GEN A;  3IH3 A;  2IU5 A;  1UI6 A;  2VPR A;  3O60 A;  2TRT A;  2UXH A;  3EUP A;  3TP3 A;  1Z77 A;  3K8P C;  3VOK A;  2R7Q A;  3BTC A;  2FX0 A;  4X1E A;  1JT0 A;  4MO7 A;  3ZQH A;  1T56 A;  3HTA A;  5FHP A;  3ANG A;  3LSJ A;  3BR5 A;  4AC0 A;  4I76 A;  4I6Z A;  2A2F X;  1QVU A;  3BR1 A;  3CCY A;  3BHQ A;  3QKX A;  3BJB A;  4DW6 A;  4UDS A;  1UI5 A;  2OI8 A;  2ZCN A;  5FMP A;  5IP6 A;  3QBM A;  4M3E A;  3DU5 A;  3WHC A;  2DG8 A;  2NX4 A;  4YZE A;  2R7V A;  5D1R A;  2W53 A;  4WIB A;  2HKU A;  3BT9 A;  2VKE A;  3VIB A;  3HTI A;  4D7N A;  1JUS A;  2DTZ A;  2HXI A;  5CXG A;  5F0F A;  2R7S A;  3Q0W A;  2D6Y A;  4GCL A;  3NRG A;  2VKV A;  2ZY9 A;  2R7W A;  3BCG A;  5GPA A;  1JT6 A;  5HAW A;  3DPJ A;  3V6G A;  5IPA A;  3LHQ A;  5J3L A;  3IUV A;  4B1R A;  5F1J A;  3PPB A;  4GFL A;  4C2M A;  4V2G A;  4HKU A;  1JUM A;  4U9N A;  2FBQ A; 
#chains in the Genus database with same CATH homology
 5FKM A;  2XB5 A;  4JKZ A;  5EZH A;  3LWJ A;  5D19 A;  1A6I A;  3KNW A;  2UXI A;  3NNR A;  3O8G A;  5C4Y A;  3ZQF A;  3T6N A;  3ANP A;  4MK6 A;  2Y2Z A;  2Y31 A;  3NXC A;  3MNL A;  3LOC A;  2NS7 A;  3CRJ A;  2IAI A;  3NI7 A;  3DCF A;  3BTJ A;  3HE0 A;  4W97 A;  3CWR A;  5HSZ A;  2QWT A;  5DAJ A;  3FIW A;  3E7Q A;  3G1L A;  2IEK A;  2NP3 A;  3G1O A;  2ZB9 A;  1RKW A;  3KKD A;  3PAS A;  3MVP A;  1QPI A;  3ZQL A;  4D7M A;  2EH3 A;  3JSJ A;  3BQY A;  5K58 A;  2OF7 A;  3BQZ A;  5FKN A;  2PZ9 A;  4ICH A;  2FD5 A;  1U9O A;  2QOP A;  2HYJ A;  5J1R A;  2WV1 A;  3VW2 A;  3KKC A;  4AC6 A;  1RPW A;  2HQ5 A;  5F0H A;  2UXO A;  2QCO A;  3SFI A;  3AQS A;  1ORK A;  2WGB A;  5J1Y A;  3RD3 A;  2YVH A;  4JYK A;  2XPW A;  5F04 A;  2G0E A;  3HTH A;  2QTQ A;  2HYT A;  4AUX A;  5K7Z A;  3G7R A;  2ZOZ A;  4ACI A;  3CJD A;  4M3F A;  5F27 A;  5FKL A;  2HXO A;  3VPR A;  2ID3 A;  3GZI A;  4M3G A;  1ZK8 A;  3PM1 A;  5K7F A;  3VOX A;  1Z0X A;  3SDG A;  3F0C A;  3B81 A;  4XK4 A;  2YVE A;  3CDL A;  3Q0U A;  3ON4 A;  3QPL A;  3LSR A;  2O7T A;  1SGM A;  2RAE A;  2PBX A;  3ON2 A;  5CXI A;  3VVZ A;  3LSP A;  2G7G A;  3BR6 A;  5EYR A;  4NEL A;  3C2B A;  4NN1 A;  2WUI A;  2QIB A;  2RHA A;  1JTX A;  5AQC A;  3VUQ A;  2UXP A;  2X6O A;  3AQT A;  3LJL A;  2QKO A;  5F08 A;  2XDN A;  4AF5 A;  4M3D A;  3Q3S A;  5FGL A;  3VVY A;  5EZG A;  5FKK A;  3G1M A;  4GCT A;  2JK3 A;  3V78 A;  5D18 A;  3VW1 A;  4D5F A;  2OPT A;  2NS8 A;  1VI0 A;  2I10 A;  3IH2 A;  3DEW A;  2F07 A;  2UXU A;  3F1B A;  3HGY A;  4ABZ A;  5FKO A;  3FK6 A;  3EGQ A;  4B3A A;  2G7S A;  3VW0 A;  2XGD A;  5F0C A;  3WHB A;  1RKT A;  3HTJ A;  2FJ1 A;  3QPS A;  3VVX A;  2G7L A;  4ME9 A;  2O7O A;  2OER A;  2XPV A;  3HIM A;  1JUP A;  2IBD A;  4M3B A;  5IOZ A;  2GFN A;  3C07 A;  3BR2 A;  2ZCM A;  3G56 A;  1JTY A;  1QVT A;  3COL A;  2NP5 A;  3FRQ A;  3Q0V A;  5J1U A;  3VP5 A;  2JJ7 A;  2GBY A;  3IH4 A;  3BR0 A;  3QQA A;  1U9N A;  5K7H A;  5CW8 A;  5HBU A;  3B6C A;  3GEU A;  4PXI A;  1ZKG A;  5H9T A;  3RH2 A;  4CGR A;  3HGG A;  4MXM A;  4GCK A;  2Y30 A;  2ID6 A;  5IOY A;  1T33 A;  3BR3 A;  3BTI A;  2ZCX A;  2XRL A;  3BTL A;  3S5R A;  2XPU A;  5EFY A;  3NPI A;  2X9D A;  3TP0 A;  2GUH A;  4W1U A;  4JL3 A;  2G3B A;  3FK7 A;  2XGE A;  5GP9 A;  3BRU A;  1BJZ A;  3ZQI A;  2RAS A;  4D5C A;  3P9T A;  2REK A;  5GPC A;  3B6A A;  4G12 A;  4KWA A;  3KZ9 A;  4JNN A;  4GFK A;  2V57 A;  2FQ4 A;  4L62 A;  2XGC A;  2ZOY A;  3BNI A;  2Q24 A;  3O8H A;  3ZQG A;  2TCT A;  2DG7 A;  4V2F A;  2GEN A;  3IH3 A;  2IU5 A;  1UI6 A;  2VPR A;  3O60 A;  2TRT A;  2UXH A;  3EUP A;  3TP3 A;  1Z77 A;  3VOK A;  3BTC A;  2FX0 A;  4X1E A;  1JT0 A;  4MO7 A;  3ZQH A;  1T56 A;  3HTA A;  5FHP A;  3ANG A;  3LSJ A;  3BR5 A;  4AC0 A;  4I76 A;  4I6Z A;  1QVU A;  3BR1 A;  3CCY A;  3BHQ A;  3QKX A;  3BJB A;  4DW6 A;  4UDS A;  1UI5 A;  2OI8 A;  2ZCN A;  5FMP A;  5IP6 A;  3QBM A;  4M3E A;  3WHC A;  2DG8 A;  2NX4 A;  4YZE A;  5D1R A;  2W53 A;  2HKU A;  3BT9 A;  2VKE A;  3VIB A;  3HTI A;  4D7N A;  1JUS A;  2DTZ A;  2HXI A;  5CXG A;  5F0F A;  3Q0W A;  2D6Y A;  4GCL A;  3NRG A;  2VKV A;  3BCG A;  5GPA A;  1JT6 A;  5HAW A;  3DPJ A;  3V6G A;  5IPA A;  3LHQ A;  5J3L A;  3IUV A;  4B1R A;  5F1J A;  3PPB A;  4GFL A;  4V2G A;  4HKU A;  1JUM A;  2FBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...