2RB5A

X-ray crystallographic structures show conservation of a trigonal-bipyramidal intermediate in a phosphoryl-transfer superfamily.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
261
structure length
261
Chain Sequence
MTKALFFDIDGTLVSFETHRIPSSTIEALEAAHAKGLKIFIATGRPKAIINNLSELQDRNLIDGYITMNGAYCFVGEEVIYKSAIPQEEVKAMAAFCEKKGVPCIFVEEHNISVCQPNEMVKKIFYDFLHVNVIPTVSFEEASNKEVIQMTPFITEEEEKEVLPSIPTCEIGRWYPAFADVTAKGDTKQKGIDEIIRHFGIKLEETMSFGDGGNDISMLRHAAIGVAMGQAKEDVKAAADYVTAPIDEDGISKAMKHFGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The catalytic scaffold of the haloalkanoic acid dehalogenase enzyme superfamily acts as a mold for the trigonal bipyramidal transition state.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
total genus 91
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 2rb5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2rb5A01
2MSNA 3AR6A 3I28A 5IS2A 1U7PA 3DDHA 4E88A 3W5DA 2HSZA 4Y2UA 5AW8A 3SD7A 4XQ0A 2I54A 3HLTA 1YV9A 2I33A 2YN4A 3FVVA 5JJBA 5AK4A 1L7OA 2FUCA 4JB3A 4Y2RA 4YIKA 5AKHA 2G80A 3A1EA 3I6BA 4UATA 2AUTA 5ALPA 2HOQA 4Y2PA 1K1EA 4OD0A 1CQZA 1NNLA 5AM5A 3AR2A 3ZVMA 3IRUA 1X42A 5AI8A 4BX3A 2YMMA 3DAOA 3ZVLA 2ZBEA 4DCCA 5AM1A 3ONNA 1ZJJA 3OTQA 3EWIA 3CNHA 5AM0A 5AW1A 3F9RA 5AM2A 1RDFA 3MPOA 4Y2QA 4HGRA 3P96A 3OPXA 2FPRA 3WKEA 4J03A 5AKEA 2C8LA 5ALJA 1Z4IA 5AVUA 4NFLA 2B8JA 2R8YA 4YCLA 3UMCA 4OCZA 3N5KA 5AKXA 3WKCA 1TA0A 1U02A 3ED5A 5AW5A 5AVWA 3KOOA 2OBBA 5ALXA 4IG4A 3ZI4A 1O03A 2P9JA 2R8XA 5AK3A 2NO4A 2WF9A 4KX3A 3N8GA 4FE3A 2OA0A 4EX7A 5AVTA 3QU4A 4NAVA 1U2SA 3E81A 4BEVA 2YJ6A 3OCYA 2MU1A 5AI9A 2HCFA 3DNPA 4Y3UA 1YJ5A 1ZD3A 1QH9A 1VJ5A 3OCWA 1Z4MA 3KC2A 3NANA 1XVIA 1SWWA 4AS2A 3ZX5A 3K1ZA 3VAYA 1TE2A 3EF0A 4NABA 5AKZA 3QUBA 4PNHA 5ALMA 3OCUA 1Z4JA 4EX6A 3WK9A 2IOFK 1WVIA 3WKDA 2PQ0A 4L6AA 5AW0A 1JUDA 2ZBFA 5AM4A 1RLOA 3OCXA 1RMTA 3U26A 1LVHA 3E84A 1NF2A 2P27A 2HI0A 4HGOA 3S6JA 3WKBA 3A1DA 4UM5A 4CF3A 2B8EA 4YH1A 4UAUA 1L7MA 4XOUA 3U7FB 3I1YA 2BDEA 2OM6A 3NUQA 4AS3A 2BDUA 1YNSA 5AIAA 2FUEA 1Q91A 1Y8AA 3KDPA 5AW7A 3EPRA 1RC8A 2RBKA 1Z4KA 2G09A 2EARA 4IFTA 4UU1A 5ALRA 3HYCA 2QYHA 2HDOA 2FPUA 4QQFA 3AR4A 4B6JA 3L8FA 2AGVA 2D2VA 2DQSA 2R8ZA 3TLMA 5ALHA 2I6XA 3W5AA 2CFRA 2ZBDA 1T9ZA 2C8KA 2AH5A 5AI6A 4FYPA 4UM7A 4CF4A 4ZEXA 2YJ5A 4Y2TA 3ZU6A 2AMYA 2WF7A 3R9KA 2GFHA 3UMBA 4DW8A 4L57A 4UU0A 2YMLA 3CZ4A 2G0AA 5AKIA 3R4CA 1FEZA 3EF1A 2P69A 2I7DA 5ALOA 3QXGA 2CFSA 4AP9A 5ALIA 4BBJA 3U7HB 3PGVA 1SU4A 1WZCA 2HF7A 3ZWDA 5ALWA 3PGLA 4G63A 2JAOA 2P11A 2B82A 3FGOA 3KZXA 3GYGA 2ZBGA 5ALZA 3I76A 1MH9A 5ALKA 3ZW7A 3NAMA 4Y2YA 4Y2XA 4EENA 3ET5A 4OHFA 2G08A 5AVQA 1RPZA 4RETA 2YY6A 4KN8A 5E0OA 2O2XA 2I55A 3E8MA 2G06A 5ALTA 4UMDA 2FEAA 1RRCA 5AICA 2YJ3A 3SMVA 4I9GA 1L8OA 3AR7A 5ALVA 2W4MA 3AR8A 2EAUA 4HGPA 1Z4PX 3W5BA 2YMQA 3QNMA 3U7GA 2W43A 3N07A 2HX1A 2G1AA 1SWVA 2HF2A 2WHEA 2HEGA 5AW4A 2JGAA 1EK1A 3M1YA 5AHXA 4BX2A 4UAVA 4UMVA 2Q4TA 4DWOA 1Z5UA 1YMQA 1ZRNA 3FPBA 5ALFA 2CFTA 3L0BA 4JDPA 3WK6A 2WF8A 1O08A 2QLTA 4BYGA 2EATA 4GXTA 4UASA 2GMWA 5AKGA 2X4DA 4J2TA 4GIBA 4YCMA 2R8EA 4BX0A 4UMEA 3L8GA 4EEKA 1QQ5A 2YMPA 4H1WA 5AVXA 2JARA 2OYCA 3AR3A 4HAIA 1AQ6A 2HHLA 2ZXEA 1J8DA 3B8EA 3L7YA 3ET4A 3U19A 4FFDA 2WF5A 3SKYA 3NALA 1KYTA 4CNQA 4BEWA 2Q4RA 2PKEA 3NIWA 1RMYA 1Z88A 4C4TA 1RKQA 3IJ5A 1T5TA 4KNWA 5A3SA 4CE6A 3OCVA 5AK6A 1RLTA 2BY4A 3R09A 4KNVA 5ALGA 4KYTA 3QU5A 3WK5A 4EZEA 1Q92A 4BNDB 2JAWA 1RQLA 3MC1A 5AVYA 5A3QA 1QQ7A 2GO7A 2YFYA 4NWIA 2I34A 5AK5A 1YDFA 1ZOLA 3BA6A 3SLRA 2ZOSA 4L6CA 2GHQA 4BNDA 3KBBA 2IOFA 5ALEA 4HYTA 4C4RA 3M9LA 4MUMA 5AW9A 1RKVA 4O8CA 3AR5A 4YGYA 1IWOA 1WR8A 3SKXA 4Y2JA 5AIBA 4Y2SA 5AVVA 1T5SA 3QU2A 1L7PA 1S8OA 1U2TA 3SHQA 3ZWKA 1VJRA 1RQNA 2B1QA 3RFUA 3SF0A 3MMZA 3QU9A 4XE5A 4YCNA 2NO5A 3OCZA 3QUCA 5ALYA 3L0YA 3WK8A 3FPSA 3L8EA 2PR7A 2WM8A 3RF6A 5IT4A 2IA5A 3ESQA 1CR6A 2C4NA 1Z4QA 3W5CA 2JAUA 3QUTA 1YS9A 3DV9A 5ALLA 2RAVA 1QYIA 3FM9A 5ALNA 4KX5A 5ALSA 4C4SA 3IB6A 5ALQA 1RKUA 1XPJA 2ODAA 4UMFA 2YJ4A 3WGVA 3PCTA 2WFAA 3WGUA 4ZEWA 5AW2A 3UMGA 3WK4A 1XP5A 3A3YA 1Z4OA 1ZD5A 1L8LA 3J7TA 3L5KA 3ZVNA 3QGMA 4UARA 3WKAA 5A3RA 3QX7A 3N28A 1LTQA 3L1UA 3L8HA 1L7NA 2WF6A 5AESA 2C88A 1RLMA 4CF5A 1VFPA 1WPGA 2W11A 5AI5A 1U7OA 2B1RA 3NASA 5IT0A 5AVZA 1NRWA 2O9JA 4F71A 1F5SA 2GHTA 5T41A 2FI1A 3BWVA 1L6RA 5FP0A 5ALDA 1ZD4A 1TJ4A 1TJ3A 2IOHA 4OFZA 2B30A 1J97A 4QJBA 4G9BA 2Q5EA 3E58A 5AM3A 5AW6A 3QUQA 2NYVA 4HGNA 5AW3A 1ZS9A 4NV0A 1N8NA 1ZRMA 3FZQA 2VKQA 4ZEVA 1S2OA 3ESRA 3QU7A 3L0CA 3ZTWA 1N9KA 2FPXA 3QLEA 1PW5A 3L1VA 2RARA 5AKYA 4Y2VA 4EELA 2C9MA 3QYPA 4I9FA 3N1UA 3KD3A 3ZTYA 4UW9A 2FPWA 1Z4LA 3D6JA 3UM9A 3NRJA 5AVRA 2FPSA 4HGQA 1QQ6A 4RESA 5AI0A 2G07A 1RMQA 2IYEA 2FDRA 2YBDA 5AI4A 3WK7A 2HO4A 3ZX4A 3B9BA 4MWOA 3ZUPA 4BKMA 2RB5A 5AVSA 4DFDA 4YIHA 5AKLA 2ZG6A 3U13A 3U7EB 1EK2A 1Z5GA 1ZD2P 2B0CA 2CN1A 4F72A 4XPZA 1Z4NA 5AKKA 3A1CA 3B9RA 3AR9A 1TJ5A 5AKJA 3PDWA 3MN1A 5ALUA
chains in the Genus database with same CATH superfamily
3IO5A 1TCAA 3AR6A 4P1ZA 3K1JA 3OA0A 3OZFA 1Z74A 1KPGA 3I28A 4HLUC 4I4TF 4MPJA 1PQYA 2ANBA 3T7JA 4U2KA 4MUFA 2IXTA 1QVVA 4Y2UA 1ABFA 4D4IA 4DSUA 2I54A 3W7VA 2PANA 1UK9A 2D0OB 3VGPA 3TRFA 1WHSB 3M5DA 1NYQA 1UADA 3RPEA 2WRZA 4F4IA 4DR1B 1L7OA 4XJXA 2JFUA 1F2UA 3GJ3A 3QKIA 2JGNA 4U0KA 5I5EA 5ADUS 1E0AA 4KDFA 3BAZA 2ADMA 3HRIA 3ADCA 4MQ5A 1QYDA 1TQHA 1G5RA 3Q9LA 4XRGA 1Z82A 4NCXA 1EVEA 1V8PA 5DVZA 4ACBA 3RAEC 1JPUA 4XH9B 4DNQA 4CGYA 3MMSA 1TTHA 5BOSB 3F3KA 4O1IA 2H51A 4JWTA 4KDCA 4IDGA 5TT1A 4ER0A 3OY2A 4ASUD 1MXHA 4LNUB 1TF7A 3AW8A 1KA9H 3W4JA 1U6KA 1N9GA 5AM1A 4XARA 4X24A 1VTKA 1OY1A 1ZJJA 9GPBA 1GUBA 1OI3A 3CNHA 4EJMA 2NP6A 3GGOA 3ODGA 1KPIA 3P32A 1I2MA 1O58A 2DPHA 3G23A 5DW0A 4E3WA 3WGYA 3JD2A 5JSKA 2NGRA 4IICA 3V4FA 4MWEA 8ABPA 3SBEA 4D6YA 2EQBA 2VR1A 3H11B 3WYBA 1EWTA 1I3OA 4HB4A 1PGNA 3ECCA 3ZE0B 1I0LA 1TK9A 5JZVA 4OREX 5EIWA 4LAFA 1XGKA 2P9CA 4CL8A 4HD8A 3G9QA 2XWPA 4IEEA 2O2HA 1ULBA 1DG1G 5CDYA 3IVMA 5H8WA 2QU7A 1X3SA 2VF5X 3P4UA 4Q1CA 5EWMB 4KR0A 4LYAA 1XKTA 5TPZA 3GRCA 1W36D 1UMCB 3CUVA 3Q6MA 1U0LA 4F3YA 5CFQA 5KX5A 4QDJA 5ALXA 4BZPA 1NSFA 4TMTA 6REQA 1OJ7A 4RMIA 2VBCA 1O03A 2B34A 4AUMA 2VG8A 2VNHA 1ZN2A 3KPJA 4W7SA 4B7AA 1K5PA 5KKCA 5MF6A 1UXHA 2XAUA 1C2TA 3I83A 4L4ZA 4NAVA 3HUEA 3DF9A 1L5KA 2GEKA 4D8VA 3OIVA 5JQWA 1J0EA 5C3MA 4PCUA 2B4QA 2NIPA 1K4YA 5LYJF 4KO1S 5GPBA 4WV3A 3SYTA 2G4LA 4WZZA 4X90A 5A5GA 3LLUA 1QH9A 1ZMTA 4IXWA 4ND6A 4URYR 4UDYX 5KU1A 2ZJ8A 2XJ9A 1O6ZA 1XIVA 4OX9Y 1VRWA 3BKWA 2NAPA 4GRDA 3L1KA 3I2HA 5C4GB 1G20E 3OQ6A 3EMBA 4WXYB 1W2HA 5WRFA 2HJWA 2VXCA 3O0TA 2YH2A 3B3AA 3ETEA 3DB1A 4QT4A 1BKSB 2UYOA 1LKZA 4IOLA 4D5GA 3SNHA 1VG8A 3BS4A 4MA0A 1T2FA 4HV4A 2UXBB 3KSMA 3MOSA 4REOA 3H65A 3ZCPA 2QA5A 1DDIA 3CVOA 2FE1A 3BIOA 4IUBS 2ORED 2CDAA 3ZDQA 4DDUA 4TKUA 4BV8A 3V8NA 1CY1A 2NTJA 2QUJA 1SB8A 4YPFA 1SQ5A 5SY4A 1SPXA 3WK9A 4YXFA 3P9SA 1XHLA 5ENVA 4LXTA 4R8KA 1E9CA 2H1HA 5A4AA 4KMRA 4YRNA 1E7MA 5JRZA 1PBNA 1QE5A 1A9OA 1TUIA 4XD7D 5F7JA 3NHZA 4EF4A 3E84A 2D2EA 2FMHA 3TLGB 3KLNA 5LZ2A 3HO1A 3FWZA 3TAHA 2NUTB 1MPTA 1KP2A 2ABWA 1RD4A 3P9NA 4OBWA 4TMWA 2HLHA 1GTG1 3REOA 4UAUA 1ZL2A 2TMDA 1OLXB 3SSAA 1IJFA 1WL8A 3PUHA 3I1YA 3N0TA 1NI3A 2BDEA 2BV3A 4LQCA 4CMEA 3CZPA 3WNVA 4DREA 4RPGA 2ASEA 1AUVA 2HMUA 3DH0A 2JANA 3FHTA 1UJ6A 3TNJA 4E1BA 3FWYA 2P68A 4H7DA 3ZZTA 1AZLA 2AX3A 4PHCA 1J24A 2P6UA 1UCFA 1T3GA 4NU0A 4YJ2A 3THYB 1SUPA 4P86A 1RAEA 2BP7B 4FGUA 4IIFA 1ABBA 4BJ3A 1ICIA 3Q7QA 2OG2A 4O2BA 1SFRA 4X64B 4Y8VA 2OECA 1X8KA 1ULSA 3LCJA 2A94A 3C87A 4BECA 2AEJA 2AEFA 3PS9A 3GB9A 5IKOA 2ZJ5A 1Q3KA 5DI3A 5DNDA 1GCUA 4RA6A 1HNXB 1GGJA 3C5WP 4GL4A 2CXPA 1P1FA 4MS1B 3H5LA 1GSAA 1Y3HA 2F3QA 3ECSA 1H4QA 1N5JA 3T38A 4HADA 3HK2A 1F4PA 2PXXA 2KW5A 4HYYA 3MT7A 4RIIA 2JD0A 3VNRA 4BLWA 3U17A 4OXKA 1AH2A 1GZSA 1VSTA 4FYPA 1UXKA 3NKLA 5DGTA 3N5CA 3NHAA 4ZEXA 2YJ5A 1D6SA 1BX3A 3BJMA 1YQDA 3W4IA 2P2DA 5FYQA 4FEYA 2D74A 3HYTA 5A4IS 4GX0A 4JEIA 1Y9JA 2YRXA 2BGKA 2YXEA 1X14A 2AYYA 4UPEA 1OIXA 1Y89A 4FHDA 4Q1BA 4RKFA 3UWMA 3IKVA 2O1EA 4IMPA 4FU0A 2VC2B 3F7NA 2ZRMA 3RYIB 3AHJA 1OI2A 4A2CA 3UUFA 1IG3A 1UBMS 3FOZA 3QPVA 1GZ6A 3A27A 3K6RA 4R0NA 1V4NA 2F17A 5GZ3A 5IM4F 3ICEA 1KRWA 5FF9A 3BBPA 3AT1A 1GCIA 2O7NA 1H6DA 4FJ1A 3WSWA 5DHTA 1LPSA 1E2IA 2GXSA 1PSWA 5EP1A 1NP6A 5MDHA 2D1RA 1Y5MA 2BDTA 1RBMA 1Y1KE 4NNPA 4RKYA 5JQGF 1OFHA 1QGUA 2WJ6A 3QX9A 4L9SA 3PNVA 4W9NA 3B1VA 5KQLA 1WMFA 3OFND 3HEBA 4WASA 4OYHA 3AUXA 4P4TA 4QUDA 4A36A 1RPZA 1E92A 1VI2A 2B4TO 1UK6A 1BDHA 2VYFA 2GCOB 5ENZA 2JHFA 5CX1A 1NXTA 4KL8S 2A8YA 2YV1A 4AJHA 3PPWA 1RZ3A 4IMJB 4N54A 1FP4B 3AP3A 3HNPA 1POWA 4C22A 2PX2A 1CY6A 1RRCA 3O8QA 3CLUC 4FYKA 4Q6WA 3D54D 1TUGA 1WAMA 2IYLD 3GJ0A 2W48A 1D04A 4I9GA 1WTAA 4JVSB 3S40A 3WQQA 2MSLA 4WL0A 3EULA 1JKMA 3BORA 4V0RA 4LZOA 2QGNA 2B2CA 4X3OA 1S3IA 1K0UA 1VJTA 2ZTSA 1SBYA 3CB4A 4K9DA 1CERA 1VE7A 1SU8A 2EBWA 5DCWA 2Q6KA 1EWQA 1VGVA 3NX4A 3QYFA 4RY0A 5AW4A 2HIAA 3TUJC 4MWDA 2QR5A 3MD9A 2AR0A 4WXHA 4DQUA 3OM8A 1W36B 1G20B 4R2HA 3V7NA 1EK6A 1GZUA 4YAJA 4YMSA 4DXHA 2XYHA 2YYSA 2WWGA 1YJQA 4AUNA 2QLTA 2FR0A 3FD8A 2OT3B 1DCFA 4I2VA 4S24A 1YZ3A 3G5LA 4B4OA 1DEOA 4BRWA 4B3JA 2QSJA 3OPYB 2A9QA 3ESBA 4ZJPA 2QVBA 5MN5A 2J5KA 2JH3A 1EQ2A 2VP4A 4B83A 3IGFA 4B82A 1K5HA 3N39C 4CPDA 3SYRA 3FMOB 2QK4A 1Y0BA 2XD4A 4DM3A 3CVWA 1H4TA 4RXMA 1OZHA 5C0OE 3WNCA 4WY8A 4BQOA 1DWPA 1UBSB 1E60A 3BWMA 2FN4A 3MAJA 3AC0A 3RVLA 4ZQEA 1EWYA 1EM6A 3F97A 1J8DA 2V3WA 2IPAB 2ZSDA 2EX4A 4Q19A 4RGQA 3T0IA 7ADHA 3ET4A 5KSWB 2CBZA 3H1AA 4ZALA 5CYOA 1ZRSA 2C4KA 3ZHTA 1TIKA 2GO1A 2WI8A 1UQUA 2W2XA 3JQBA 4CKCA 4B4WA 4LTNA 3IAUA 3HLYA 2O8FB 2YIMA 3A2MA 3IJ5A 4ZANA 1ZL0A 2W83A 4P5PA 2BM0A 3TLAA 2ST1A 2WSIA 4N65A 3NV7A 2GPNA 1T5BA 1R8JA 4CV0A 1DCTA 3G2QA 3OX4A 5CVUA 3I8SA 5JJLA 4YAFA 3UJ9A 4BVGA 4FS3A 4Y18A 4FHCA 4YPVA 4QBGB 2OENG 3ZHZA 1YI0A 5LZ8A 2F8MA 3PX7A 3URMA 2J6IA 4YRCA 3PD7A 1GL3A 2QMYA 3LGAA 4REMA 3ZBTA 2C4HA 4K6HA 1JQJC 2Q07A 1DC7A 1GNRA 3UFBA 1I7DA 2HO5A 3AL0C 4QJ5A 4P53A 5HCNA 4K05A 3CJTA 2JFFA 4KPGA 1QG4A 1EPUA 1GQ2A 4ALIA 4OXQA 1FJGB 3BB3A 2F43B 4ENQA 1JHZA 4XUDA 3GLHA 2DG2A 4EY8A 5A5FA 1SUDA 1C1YA 1A0OA 4HQRA 4REQB 2ZRBA 3AHEA 2UZ4A 4U7TB 2LWIA 2HSJA 4IOMA 1RAGA 4YRTA 5CFNA 5JBIA 1DRVA 2MYTA 2J3JA 4Y9RA 1B00A 1Q2XA 3DTVA 1AF4A 2WPDA 3E0XA 4WBSA 1EG7A 1HE3A 1YS6A 5LB4A 4D9MA 5JCXA 2EC5A 1QCDA 1VMAA 1XE3A 1XLTA 2VCEA 3AOEC 3C97A 3GA0A 1U65A 4XA8A 3LCVB 2CW5A 4FP9A 5AQEA 3QJGA 4CM1A 4ER5A 4G1FA 4P98A 4XTCS 4P4UA 1ZK2A 3JAWA 4BJ5A 1FE8A 5JIBA 4A6EA 5KJCA 5ED0A 1ZCFA 2INGX 5AOAA 1BDIA 3BSFA 2ZB8A 4OAQA 4YONB 5SYMA 1NJ6A 2QN7A 4M8IA 2PS0A 3NBZC 2DTDA 3IDAA 1PFQA 1CF9A 5F1PA 4IXDA 1FLAA 4LOIA 4A8HA 5TC4A 2DPLA 3BFJA 1P80A 5G4KB 2CDNA 1UBLS 3PICA 1XRSB 3L0PA 1OH8A 1CW2B 4N7MA 1YT5A 2WM8A 2YBEA 1YI1A 1E2NA 3A2NA 4CF6A 4UC0A 1YJ8A 5JFOA 5AUOB 3DV0A 1KKUA 3L7BA 3QUTA 4AAYA 1PJAA 4XX0B 5A7HA 3HY6A 3V6LA 1PT5A 3AERA 1QZUA 1U0JA 2G1KA 4JK3A 4BASA 1N2CA 1Y1RA 2H9YA 2P2ZA 2XQJA 1IM2A 2ZT6A 3MXTA 1IB0A 3ENQA 3IB6A 1RKUA 5IULC 1NKVA 1EDBA 5C81A 3INNA 1ADCA 2FN3A 4F04A 2H7VA 1GL7A 2VZEA 5KNDH 2BUBA 3H5IA 4QJ3A 1PL0A 4Q4DA 3WZMA 3EXIB 4JY7A 1GG8A 4QSMA 5JCJD 4I6JA 3MLEA 3CX4A 521PA 1N6LA 2GXQA 2R8PA 3BZUA 3C15C 3GEIA 4JP2A 1A7UA 4LV8B 1OU0A 2BM8A 2FMUA 1U90A 2X1MA 4TLDA 4Q9IA 4ZEOA 1ECLA 2IBTA 4AWBA 3NWPA 3EFHA 1SXGA 2AFVA 2II6A 2OKCA 3EDRA 4FXOA 1AO3A 4QDTA 5E2BA 2HNKA 1JALA 3K8OE 1OLSA 1N8TA 2BZ1A 1EP9A 3E82A 3M6LA 1NVBA 3ILVA 2PSDA 2VDWA 3CBQA 1NRWA 1TOAA 4LISA 1OWMA 4ALJA 3PK0A 4IKOA 1PGPA 2O6HA 2IBSA 4BN5A 1UH5A 3ICQB 2QQ5A 4PQEA 1CQJB 4BQEA 1U0HC 2UZ0A 4OFWA 3COVA 1FVXA 1PJ4A 5K3FA 1ZA2A 4F8YA 3CX6A 1FC0A 1KHHA 1KOGA 2JLXA 2REXB 1DX4A 2QLNA 4S04A 3CCBA 3MTBA 3PXGA 2QX7A 4YR9A 4ZTZB 2OKGA 2C84A 2NU9A 2VQ6A 1L3CA 4TUYA 5DHRA 4EPWA 3L4BA 2E49A 4B6GA 5J2TB 3S2UA 2PBLA 4UU7A 4TS3A 1CZKA 4PX3A 3HGQA 3ZQ4A 1UEJA 2XUHA 3DQPA 2GR9A 4I8DA 3BRCA 1RC0A 1J2TA 1T2CA 4IJQA 2J5BA 4IIYA 5BR7A 5EJEA 3L04A 4BNJA 1PWEA 1XJ5A 4NFSA 2Y0BA 3EXEA 4D6PA 2GM9A 2XCTB 5EWJB 2F1HA 4HWPA 1X1AA 5THXA 1F1JA 1XMOB 3OVMA 1Z28A 3D2CA 4MZXA 2YYAA 5JTTA 4L51A 4BGDA 1YR2A 1CJSA 3A4NA 4RMHA 4UW9A 5JBQA 2I7XA 3OWHA 1QIDA 4QYIA 3MINA 4X1OA 1T8TA 5TJHA 1O95A 1OXKB 1PRYA 2RGXA 2WABA 2G25A 5I01A 2GKOA 3RAGA 4CM6A 4W5JA 4MXDA 1KK1A 3LCUA 3GHYA 4Q3EA 2J85A 3PV0A 5L45A 1KWGA 1BH2A 2QBYA 1WVMA 3P7MA 1VG9B 5KYXB 1ZAYA 1TQ6A 4HDKA 4F7WA 1Z35A 1A69A 2R7KA 3HP7A 4H60A 4JJIA 4OK3A 1Y3AA 4OUKX 4TSFD 3ZCUA 4EW2A 1YS4A 3C6QA 2Q5HA 4MV9A 5IJ9B 4J75A 4RPIA 3VKVA 3T52A 5H3LA 3OLQA 3EQ6A 4B7XA 4I14A 1K5DA 2VAXA 1T5HX 3PT5A 4YRMA 3CLUD 4KOAA 3K5HA 2Z58A 3HXKA 5DHAA 1RCFA 4LXQA 3ZGNA 2PJDA 4N1AA 1O0SA 1ZI9A 1HL7A 4B35A 4ESEA 2H6EA 2UXCB 1DOAA 2WG0A 2Y1FA 4BTLA 3PHIA 1FSSA 3JVIA 2CB9A 3VHLB 2AN4A 2JFVA 5FHQA 3STVA 3TPZA 2R1UA 1N8KA 4M9XA 1Y1QA 3AHHA 1T1JA 2Y6VA 2WM3A 3GRFA 4Q9JA 3PHJA 1PYGA 3K6JA 1GRNA 4TRRA 4PZPA 5IS2A 1CV2A 1D4OA 2V03A 3UTDA 4DQDA 5B64A 1N6NA 1YRYE 2NMVA 4U02A 5C5IA 5HUHA 4N76A 1CBUA 2WSSA 3F90A 4JBNA 2PGAA 3E2IA 3WLLA 1UMDA 3LK6A 5E3IA 3CTPA 3T9FA 4C4ZA 4JT9A 5GJBA 3W90A 5ITVA 5K09A 5KNBA 1MB4A 4KH0A 1G16A 3A2KA 5JNUA 3TG2A 3C1UA 1ZM2A 1YVPA 1SKAA 1MKYA 3IMGA 1A1VA 4KE8A 5IVKA 3SZMA 1WHSA 3R3VA 1V8OA 2IZ0A 2HOQA 3P45A 4UCFA 2HGZA 3A1FA 4EFNA 1P8AA 2FSVC 4HZUB 3ZU3A 4ZCLA 2WWWA 1G8MA 2XCRB 4W1QA 1T8SA 3OSUA 4OPMA 3ORYA 2JA2A 2ZATA 4YUYA 2HKIA 3QUSA 2CYBA 5B7NA 3HBNA 3OTQA 3WFIA 4EKYA 3M4NA 4MB2A 1F8FA 1XK6A 3UMMA 3AJEA 2AOTA 3F9RA 3G2IA 1MJFA 3OH8A 4C76A 2P0EA 3BCHA 2VSOA 3DG9A 3MRSA 1U8AA 3O2QB 1PZHA 4Y2QA 3T7EA 4X3CA 1TAHA 3T5DA 5KWEA 4LNUA 5CA1B 4YY3B 1HLDA 3TCNA 1ZA1A 5B57C 4QOEA 1M73E 2PUAA 1G66A 1FJHA 1HT0A 1VSQA 4HAUA 2ZTLA 4IG9A 5AVUA 1TEVA 1PR5A 3X43A 2B99A 1JB1A 3HUFA 4L4XA 1RTKA 3FPKA 3L7JA 1RXSA 1GKIA 2I3GA 2PO5A 1MB9A 1DLJA 1XVVA 1Z2OX 3H11A 2WQ6A 3SQXA 3G2MA 1TGYA 4PLTA 4IRXA 2GVDC 1HLGA 1PR4A 1Z6AA 2WHXA 3FETA 3A3NA 4MEBA 3FKJA 4MVJD 3PGXA 2HQBA 5EWMA 3ZWAA 3G0CA 3WZLA 3VR0A 3T7TA 4JI0B 2W0MA 4OHMA 4HQKA 3UT5B 1F5NA 3CLTC 3PZRA 3OJWA 2G9QA 3GRRA 3OJEA 4G25A 5E3JA 3II6X 3IHTA 2Z9DA 1G9SA 1UMCA 1II8B 3OLZA 1G5FA 3PUWA 1GRRA 1PP4A 5AVOA 1VHDA 4E12A 1LWOA 2YQZA 2YWJA 3KOXA 5IM5A 1FTQA 3W8FA 5KOYA 1R50A 4NBTA 1J0CA 1I2BA 1Q1GA 1EGQA 4RVGA 1REQB 4OB6A 4R7ZA 5IVDA 4E4YA 2OORC 4EI9A 3ZLBA 4N3GA 4H3KB 4AS2A 1UKCA 4TWAA 4O4JB 1YWGO 4K26A 3WB1A 3ZWPA 5ADHA 1IQRA 2ZDHA 4Y9TA 1Z8FA 4QFMA 3TR6A 4C0BA 2V1UA 5TJ9A 4AY4A 1PUXA 1L5GB 4BV9A 1Z4JA 2PLRA 3D8NA 2W2NA 3KE8A 2VDVE 3IEKA 1T1GA 3NVMB 2RDMA 4R4JA 1G21A 5F2KA 3ZQKA 3R8XA 3WKDA 2PQ0A 4PFQA 1JLRA 1RRKA 4TV9B 4DV7B 3G0IA 3CFYA 1A98A 2AR7A 1X2BA 5AM4A 4RS3A 4GPTA 1U3TA 2QENA 4MAAA 3GLQA 3M83A 4XSGA 2OUKA 3U26A 4R2XA 5FRDA 1NJGA 1UP6A 3SZOA 4UZEA 1ZN7A 2QD1A 1UJ5A 1VBNA 5KI6A 5EJIA 1ORIA 1P62B 2OXCA 2J7PA 2EJTA 2JF0A 2NSDA 5DYTA 2ZYWX 5GVSA 3OZGA 3UYLA 1I14A 1DJQA 4WT7A 1GLNA 1O4VA 4WOJA 4X00A 3Q10A 4N41A 1WMAA 3KALA 4RELA 1P7ZA 3U5ZB 2Q8QA 4A16A 4J29A 4MB6A 4DXAA 3A6PC 5JSYA 5DSZA 1XF1A 1CFJA 2IQ5A 2IH5A 1Q7BA 2GUWA 1YK0A 2NAFA 4QOSA 3TLGA 2CVOA 5CYGA 2NUTA 1YNSA 3L7IA 5AIAA 4K1LA 3GLVA 4IHAA 2IIVA 3OESA 4H7PA 5TNXA 2XLBA 3KDPA 1OLXA 1Q1EA 2DP4E 3FSJX 5E6SB 2HC9A 3BK7A 4B33A 3M9WA 3WDKA 2VPXA 1Z6GA 1B14A 2O2GA 3DZDA 3KXLA 3QKRA 1LU9A 2YV2A 4P2GA 2P2SA 4KR7A 1B43A 2LXNA 1M33A 3KL2A 2DM6A 4HEA6 1NPTO 3F8TA 4LJ9A 1O96B 2NVOA 4OI4A 1HY3A 5BO5A 1PU2A 1QAMA 1CDZA 1SRRA 2EKPA 5KOHB 2J3DA 2VYNA 4R6WA 4LVOA 1KVTA 1KP9A 2BP7A 3W5AA 3EWNA 1W0JD 4YS6A 4B74A 4QUHA 4G84A 1O77A 3W3AD 4Q3LA 4RL4A 1L4UA 2FPKA 3MJCA 5BUZA 5F77A 5FV4A 4MS1A 2X2PA 5K7SA 4H7IA 1S8FA 4U6QA 2J0QA 1II0A 1P4HA 2GQ0A 2O7RA 2PPVA 2O0HA 4C06A 3A4YA 2X76A 4ABYA 2VA9A 2OVFA 3PI6A 4GI2A 4X8OA 3OKFA 1H9CA 3MS2A 2NU8B 1RQPA 2HJ9A 1E77A 2DZDA 3U7HB 3WGJA 1G8SA 2G1JA 2Q41A 2QX8A 1YZLA 2ZYRA 2ZDGA 4HMOA 1U0EA 2FWIA 2QLFA 3CWQA 4PC7A 5JZMA 5KIAA 4INPA 3PGLA 1CYEA 3H42B 4N03A 1FB5A 5F76A 5DGXA 4LF4B 2M32A 5FUBA 2AQHA 4M7RA 4OA8A 3EXG2 2LNDA 1GNPA 2QGFA 4N0PA 4PIPA 5CM8B 3RYIA 1I51A 4EGCB 2ZM5A 4LN1A 1XPRA 1MH9A 2JATA 2PWPA 3DA8A 4UNNA 4A0GA 4MR9B 5KU7A 1P0IA 4Q02A 2ZKIA 4N5HX 3OP1A 4FC6A 4OATA 3ND5A 3WTCA 1EXVA 3R3XA 1EYZA 1G18A 2QX6A 4KP7A 4RDIA 4F8EA 3BZBA 2IODA 2RGGA 2XY4A 4GGOA 4UHFA 2UKDA 3ZDAA 2QTFA 1CJVC 3ZY6A 1I1OA 2I55A 1DIOB 1T9AA 2V0CA 4MIEA 4LS3A 2I4LA 3IEXA 4A2PA 4ASUA 2JLUA 1P0FA 1M0WA 2YJ3A 3HSSA 3RRNA 4DYVA 3KETA 1JHXA 3O8OB 4R84A 1VJCA 1XWIA 1KYVA 4ML3A 4R7GA 1H2ZA 5HFJA 1QV6A 2OYSA 1G55A 3QNWA 4ZO7A 3TJRA 2C4MA 2GCOA 1Z4PX 2XQGA 4S1PA 3EQ8A 1O87A 5B2EA 2QLMA 3M2TA 5IAAA 5B6PA 4M60A 1VKRA 3NNDA 1N0UA 5TQVA 3K6KA 1FP4A 1QVWA 2HX1A 2WLSA 2YIDA 3N07A 2QSZA 4PU0A 4XGIA 3TTWA 1UPTA 3GCZA 2ZUTA 3THSA 3V1KA 1F0NA 3L06A 1HDXA 1XTBA 2VYVD 4HAZA 1UBFA 4BAGA 1A4UA 3N6VA 4TL8A 1O89A 3D3KA 1Z5UA 4YB8A 1I9CA 1VL1A 1P19A 3HDJA 3K0AB 1ZVKA 2OHHA 4HPWA 5EXTA 4ZCIA 1BXZA 5CEFA 4ISBA 5DCUA 2CFTA 3RBXA 5JYDA 3B36A 3BMXA 3Q5DA 3ZDDA 1XMQB 1U2DA 1WZ2A 3DHWC 4HFJA 4M7OA 1SXHA 2PUJA 3PF8A 1J33A 4MWCA 3FWPA 3CYFA 5C2JB 5KWJA 4RD3A 4ID3A 2AG5A 1KJ8A 2FSIA 1G20A 4IUDS 2OHJA 3EGDB 1J0BA 2UUAB 3RVKA 1W5SA 3P0RA 3WHIA 3T1YB 1NN3A 2E4UA 4PFJA 4DG9A 4Y6SA 4KQIA 5DTMA 2X13A 3DDZX 3FFWA 4L78A 3OPYA 3V1TC 3IQFA 3N2ZB 1L2TA 1BQ4A 3HP4A 5LQJA 5D51S 2WUVA 2IYUA 2JLAA 5CRIA 4X66B 3BEDA 1Q74A 1UPAA 1YVEI 3ZCXA 4MGEA 1TMKA 3TD2A 3HC7A 2VVTA 3MRVA 4UHCA 5CBPB 4BNKA 4EW3A 2WU3A 1NLUA 5KDDA 3KEFA 2I2CA 3C6ZA 2OV3A 3RYFB 1U7ZA 1G8GA 4LJ7A 2G6TA 3L7OA 1TQ8A 1TLTA 3OZ7A 4R1SA 4X8HA 4LQLA 4YJ3B 5I9TA 4NFHA 5T8KC 5EE0A 6Q21A 2AXPA 2PZAA 3AL3A 2H29A 4U2EA 2XGGA 3D4NA 5HF8A 2CLKB 2FFHA 5LLSA 3WQHA 4AYXA 3V97A 5DGHA 3CUWA 3KPUA 3DYIA 4CTKA 3D2AA 1CR4A 2YTZA 3FGZA 1U4SA 1OUMA 2MR5A 2Q1XA 3GT4A 4OBXA 5EZYF 1N2SA 1MRNA 4BQRA 4ZMBA 5A1JA 1CR0A 4V0NA 5HKAA 2O8FA 1NJ5A 1SOUA 3TN7A 2XNSA 5EP3A 3SWWA 4QNMA 1KI4A 1XBTA 4XJSA 1CE8B 2AK3A 1BRTA 3CUUA 2D13A 3H7IA 1RE1A 3MSXA 1CR2A 4M0CA 4I5EA 4R8LA 5KKAA 2NVUB 2LVBA 4L4UA 4IHJB 3CLTD 3K2QA 2MYNA 4LRUA 2V6GA 4XD7A 3L18A 3BMNB 4L6CA 3N0RA 2AOVA 1JTVA 3B1KA 3LAWA 2FH5B 1IOVA 5FAXA 5ALEA 2NUAB 2Z56A 2WDZA 2C4UA 1UWLA 3QKTA 4QG7A 3WMFA 1R37A 3WA6A 3MJVA 1DZIA 1QKKA 2P9FA 3HCWA 3AX6A 4J1SA 3PVSA 4NHEA 2QHXA 3AR5A 1YIDA 1XDUA 2F43A 2X2EA 2W6NA 1AS2A 5L51A 4REQA 2Y99A 4BO3A 3R3SA 4BKPA 3KOUA 4PC3A 5FUQA 4GI7A 4I3GA 1HRDA 1MBZA 2H7YA 3OF5A 4N3NA 1JJFA 2OCDA 3SOPA 1MF7A 3OQMA 4KE9A 4OTZA 1M8FA 1PT6A 2QW0X 3M6WA 4FVTA 1P2BA 2LGJA 1WJGA 1I5EA 2CXXA 3ZBUA 4S05A 4YCNA 1QFMA 4LDAA 1A8IA 1W2WB 4Z9AA 3R7SA 4LX0A 4L3VA 2C7GA 3RTCA 4BTEA 1SCQA 4YUAA 5IT4A 1EMDA 3ESQA 1CR6A 4PRLA 1P1CA 3ZY2A 4JQYA 2JAUA 1GRCA 1BA2A 4FBGA 3MHPA 1Y9ZA 5CH3A 1QGDA 4ZHSA 4S3MA 1KOFA 3PQCA 4FFPA 4UHJA 5G4KA 4B31A 3TZEA 3DMTC 4P54A 4ZZ2A 2LR0A 1QM5A 2YIJA 3V2GA 1XA3A 1BOFA 4ZEWA 1VI5A 5BUQA 2E2WA 3KQQA 4ZJUA 3AUYA 2VOEA 2F7SA 5AO9A 1E1CB 2FJ0A 1UM8A 1C1DB 3L5KA 2ZJAA 4XX0A 2OWEA 5CVVA 3ZHOA 4CCAA 2PMEA 5L3QB 1TX4B 1AHPA 3QX7A 1BSVA 1KI2A 2OILA 3ON5A 4B2LA 1U8UA 5TMEA 3FAZA 1WBJB 1QJCA 5DT9A 7GPBA 4HF7A 2PVCA 2JI7A 4DSOA 1ONOA 1Y1SA 4A1OA 3GVHA 3GUYA 3LTEA 1P81A 4G8DA 3EZXA 4AXBA 1RU3A 5FWXB 4R1LA 1GV0A 3VPXA 3EXIA 1M54A 5A03A 2FETA 1AUPA 1NI5A 2C1EA 2OPBA 3K9CA 1T5IA 3BWBA 3QLUA 4NU8X 3RS4A 4CBVA 2XMRA 2Q46A 4EDHA 3CCCA 3EGOA 3ZW9A 1M6VB 4CKXA 2A5GA 4TLCA 1GUYA 5JAMA 2ZCJA 2QZPA 2W4QA 3F9IA 5E8JA 1BROA 2WUWE 3PA6A 1QONA 2WKSA 4LC1A 5KHOC 2N0SA 2VA8A 5EGNA 5T3YA 1FSFA 3KZKA 5JNWA 5ESXA 3RK4A 1AV6A 3ODPA 4K8OA 4QPPA 1LRJA 4AN4A 2AD1A 5GQSA 1T35A 1U0RA 2LZ0A 3WRWA 2QRQA 4DY4A 2A1IA 3GGCA 4GYJA 2A4MA 1VMKA 2VDLB 3WLTA 2X40A 2ZBPA 221PA 3WO0A 4WNAB 1CQJA 2IEDA 2IP2A 2WJHA 1EESA 1M83A 1WP4A 3JWPA 3VZCA 4ZCRA 2IF2A 1Z39A 2OSVA 4HNHA 4WERA 5L4SA 4G56A 3TE6A 4ETWA 1ZINA 4IEFB 1THGA 1D5WA 4LBVA 2R84A 3HMQA 5TMDA 1YCFA 3E23A 1W94A 1EWKA 1LSSA 2GCGA 3QPBA 5J2TA 5AD1A 3AKEA 4H35A 4LECA 1ZESA 4OGKA 2LW7A 4HLUA 1L4HA 1XKQA 2AKEA 1VCMA 1DT5A 2FEPA 2J9YB 1U9IC 2ZI3A 3BOSA 3C7KA 3FCUB 3HB0A 4AG5A 4B8ZA 3QEKA 4YUXA 4TWIA 3BHJA 1U9CA 2OAQ1 5HQ3B 4ICIA 2VFAA 5KYXA 2ONZA 2FN9A 4WNCA 3CMCO 4ZRDA 5EWJA 1F6DA 1YF3A 1G291 2OL4A 3DMFA 2H52A 2Y1WA 5HX7A 4C7XA 1NI4A 2QTZA 1JEYB 3QITA 4J0QA 5EJ6A 5KMGB 2FDRA 3AVXA 4NATA 3OE5A 2VF7A 4YLGA 1I3NA 3EGEA 1E0DA 2O3QA 4GQBA 1BXKA 3NHSA 2G9NA 1XMXA 1OOEA 3F4LA 4B44A 2IV7A 3RVOA 1EFDN 1VQ1A 5ESRA 1CEEA 2WOJA 1QVRA 4O1MA 2MYUA 2D62A 2JEZA 2P1DA 1QRAA 2ET6A 3TKLA 3W34A 3YASA 1GSIA 2FJPA 3E9MA 4KIGA 2AWOA 1N92A 5GJCA 4D79A 1KAQA 3IR5A 1L4BA 5HKOA 5IJ9A 4QNRA 3KQKA 5KBYA 5BV7A 3G0OA 1SCAA 3GNTA 2I1VB 4QPDA 2R85A 1IOLA 5KO2A 3C16C 1ZYUA 1YR1A 4GMHA 3U3OA 2JLRA 1M2NA 2CVPA 3HRKA 4WCVA 2O8NA 4Z9BA 1LH0A 2G82A 3H2SA 5ES3A 3FYSA 1ZGBA 1W4LA 4QECA 1U7PA 3JQRA 3GMSA 1KQFA 3GRAA 2G5GX 5CLFA 3V1YA 5K8IA 1VGRA 4O2LA 3AVQA 1KNQA 3HZRA 4MWZA 4FE7A 1ZJ6A 4RABA 2A78A 4NSNA 3C3DA 2WT9A 3CIFA 1BE8A 4MQMA 5EXDA 5TB5A 1A76A 3IT2A 3BJRA 1BJTA 2Z0MA 4O4HF 4JB3A 2ZPAA 4Y2RA 4OJNA 5IU6A 3NWBA 5AKHA 2G4CA 5D6OA 4AJEA 1ND5A 2FP3A 4AF6A 1OFVA 1BGVA 4KK3A 1WCIB 3L9XA 3TW0A 5A0FA 5IASA 1UC5B 1EQUA 1DC6A 2EWVA 4W1PA 5I4KA 2VUUA 2Y9MB 3Q3CA 2E0IA 1JDJA 1KJZA 2XPCA 3CX8A 4H0NA 3K2IA 4HXFB 3IP7A 3LPLA 3LY9A 4LY0A 4LC0A 4MARA 3OMLA 3FCEA 3R76A 4F21A 4WJLA 5BW8A 4QOGA 4L22A 4XIJA 3PTZA 3WL6A 3WHPA 4WLUA 4GP9A 1ZMOA 3T5TA 1U2PA 2X86A 1MX1A 5CH8A 5AW1A 4GLLA 3JQ9C 5KYUB 1ZQ1A 2CHEA 3FFTA 4ZGGA 3EXHB 4Z2YA 2Q1YA 4MITA 3AEYA 4B85A 4HZUA 3VSBA 1KOJA 3LF1A 1HDZA 1OTXA 2ZSUA 3UUGA 2OV8A 4AP5A 4QX6A 3F4BA 2Q9CA 2X6QA 3H9UA 1OXTA 1KKMA 2YASA 1SBNE 3BM5A 4GSYA 4EG8A 2ALJA 3I53A 2QNRA 1HBJA 1VYVA 2RH4A 4CDGA 5JDCC 4EK9A 1B2RA 1Y7HA 1F48A 4IIEA 4BN4A 2ADFA 5TMPA 2B8JA 2ZYDA 4NBWA 3AB8A 1A4RA 1ISSA 3QHPA 4CU5A 3D7MA 1AKMA 2GARA 5CA1A 5FUMA 2AIRA 2JFHA 2IOQA 3EZNA 4HTFB 4CKYA 1XU9A 4R1TA 4AKHA 2YS7A 3HABA 4ZDWA 4N8EA 4ZDKA 2BFNA 3AQIA 2CXSA 2VF2A 3DBRB 3NTVA 5I7HA 2ZI6A 4KQFA 4OA5A 1NMYA 4IFEA 5JT1A 5T6BA 1T6NA 1T4DA 1GPNA 5CDTA 1Z6ZA 3T54A 1X87A 1SUFA 5AVTA 1G8KA 4K03A 2AMLA 3WV4A 3D43A 2X8AA 5D3MB 3VSDA 3W3ZB 4US2R 5DT2A 3TUIC 5K2OA 1ONSA 3MMPA 3NG1A 3E8SA 2HCFA 3NI2A 2I3ZA 3ISJA 3ZWQA 4F4CA 4JIGA 3FCSB 5I4IA 4F86A 4MGHA 3OCWA 5GONB 1YR8A 2QPAA 2ZB7A 4OHRA 1WDTA 1TJPB 2W58A 5DGIA 5JCJA 3NBFA 1LPPA 3C74A 2F1RA 1T3HA 1KKLA 3ZQ6A 2IYYA 2JD2A 4JGGA 4LHSA 2I2DA 4P5DA 3UT5A 1DIRA 4BQSA 3Q8MA 2FG5A 1NG1A 4BKOA 2I4OA 3U1VA 3U7QB 2DERA 1LJUA 1CZLA 1II8A 3L0SA 1GNVA 2UYQA 2ZUVA 3L8MA 4I4IA 3UK6A 2AJ8A 3CWCA 2HCTA 5AKZA 1UXJA 3RHZA 5BMVB 1BN7A 2DCUA 2AD5A 1DBIA 1Z33A 1XL1A 4YACA 1IAVA 1MOZA 3LVQE 1OWPA 3UJNA 1E4OA 1FDRA 1REQA 2WTXA 4MYCA 5BT8A 4CLDA 2J5QA 4WUVA 1H2WA 5L3ZA 4AP6A 1IM5A 1EUCB 1XWWA 4O4JA 1NBMD 4NBNA 3GBPA 3S5JA 1NW9B 3VUEA 4ARAA 4C0WA 2NN3C 1KQGA 3QNUA 2DXIA 3HBJA 1RLOA 3T15A 3PLAE 3AWDA 2WQZA 2AFHB 2PZBA 5T4HA 4CODB 1NF2A 1MZVA 2EYUA 5KEIA 1SK8A 3B6MA 4D4JA 4OKNA 3DAHA 4U5QA 4CF3A 4BV2A 2PXCA 3ONFA 4LFBB 2FFJA 4G26A 4TV9A 3CSSA 5JEEA 2D2FA 2OGWA 4MKRA 4WZBE 5HS6A 3PQ5A 3QKUA 1EZZA 2AG0A 2ZXFA 3UTCA 4GYKA 3EGCA 4E0BA 2BMEA 1KSHA 4Q9KA 1HT3A 2I7TA 4BNFA 4BYMA 4CLOB 3RGGA 3U61B 5DE3A 1NBME 3VKWA 2H57A 3IC5A 1VECA 5H02A 2AC2A 1Y8AA 1ZH2A 4R5MA 4Z0HO 2BSQA 2IS4A 3BD8A 4H3HB 4UQOA 4LE0A 2ZJOA 4XDHA 1ESMA 5A0VA 2GJ8A 3EIUA 5HDQA 2AB0A 1UJNA 3RARA 3TNYA 2COKA 4B6PA 1CEYA 1DCMA 2X9NA 4QREA 3COWA 5HUJA 2VBIA 2MINB 1VJ0A 4E21A 2SBTA 4NEQA 1UDXA 3PWSA 4RNCA 1QXSA 3UPDA 2ZWIA 4EPVA 7REQB 5JW6A 1T25A 4LI3X 1FRFS 4OP2A 2XUPA 3THRA 4JMLA 3WGNA 2AKYA 3FRHA 4Q48A 4BGUA 2NXCA 2BGUA 5E6SA 4TSFA 4ZV7A 2ZJBA 5K0LA 1NVWQ 1ZVMA 1R9GA 1AKQA 1FTWA 2ZBDA 4AX8A 2BTEA 4GPIB 1L7BA 4FHFA 3B52X 3R3UA 2VRCD 4MKHA 2K7FA 3M2PA 1MC5A 2CXUA 4TKMA 5TQ0B 2HPZA 1N2OA 1O96A 4PIMA 1WWKA 4A23A 1DKRA 3CEHA 2GFHA 2IUFA 4QBTA 3SHOA 1GZVA 3PUJA 5KOHA 4OIMA 2IEBA 1BQEA 4GBGA 4HB2A 2PUFA 1LW7A 1LGYA 5BOVA 1M2FA 2HMYB 2PEYA 3MT0A 3QOFA 3RS9A 2SICE 2X9GA 2HV9A 3QVXA 4GKBA 4YT8A 5EQJB 1NUHA 2BBSA 3PRJA 4RNDB 3ZD6A 1V39A 5CXUA 1JSRA 2AN9A 3MWLA 4I46A 4DLNA 4CMBA 4BBJA 1CDOA 3UNXA 3DWIA 4DWVA 1UKAA 3KWFA 5EWLB 3RU3A 4JB0A 3WAJA 4OJTA 2GD2A 4HQLA 1CULC 3N7UA 1KMMA 4I4LA 4QPJC 1JXOA 1X7DA 4URWR 2RHLA 1JQBA 4O5OA 2NU8A 3LL4A 4DSAA 4MIKA 2Z83A 1ENPA 5I3CA 2QMEA 1UAAA 1U9ZA 3I0ZA 1N1GA 3DMPA 5ALKA 1O4WA 4QWMA 3MMNA 1N6IA 2XYPA 5A04A 4UBJA 5HJ2A 3IQEA 1E9DA 4OHFA 5EP2A 1Z8DA 2PD6A 3R8CA 5EC8A 5AVQA 5F3WB 4FJ0A 2EGUA 1BYUA 3W05A 2AF3C 2XMSA 5E0OA 3N2KB 1YSCA 4BUJA 4ARSA 1MW9X 4MR9A 1Y33E 3A6KA 4RGVA 4EOGA 3R7WA 4LGMA 1QLWA 1R0LA 3Q98A 3K0HA 4MLZA 2LRHA 5K8LA 4ZAWA 2PX0A 3PEUA 1U1IA 5FI1B 2GM3A 5LUAA 4CEJB 3FNRA 1FSGA 2DBRA 1N7GA 2E6KA 3S2GA 1J70A 2JLWA 3FW1A 4KCGA 2B21A 2Q6IA 2V6IA 3LD9A 1ARZA 4MCHA 5DGDA 2JFWA 3EC2A 4Q7MB 4EVIA 4DTCA 5IDWA 2GAOA 4F0JA 4RVHA 3W5SA 4ARCA 1KTVA 1UC9A 1V48A 1CHDA 4R7TA 1KS2A 1GNLA 2X8JB 3CQ9A 3FCCA 2CT8A 4KR2A 4DR7B 3C24A 3SC4A 4UTNA 2XZLA 2REOA 3ZXXA 4E51A 1GAXA 3K0BA 4TWRA 3L0BA 3RC3A 3B60A 2ZJ1A 1JQ5A 3MJSA 5F1KA 1P91A 3IIEA 4JQZA 1ZW1A 5GIOE 3GAZA 2XDAA 3BWEA 2FW9A 3ZCQA 2G28A 2AI1A 2PTGA 1CQPA 2PU5A 4MVJA 3VYSB 2J09A 2FSSA 3BCRA 4IVRA 4AICA 1E5QA 1C1XB 4ENPA 4WEQA 4HAIA 3CNBA 5FJJA 1T6ZA 3VU0A 4E1VA 2BF7A 5H5JA 1EX7A 2HHLA 4JLJA 1C0KA 2DKNA 4IIDA 1VIAA 1JIQA 4D1YA 1JI3A 2O20A 3EGDA 2HZBA 2IYQA 2G9RA 4FN4A 1V16B 1KYTA 1EFHA 3I1FA 1XQ6A 2IU0A 1HNNA 3WHLA 1ULUA 2WOOA 8AT1A 5TT0A 1Z2NX 1WY7A 3JQ6A 4ZI2A 1GTL1 3I9FA 1KVUA 5EA2A 3IB3A 4F56A 1H85A 1YQTA 3DBLB 3QUAA 5TRTA 3ADOA 4PHFA 3LV8A 3VPHA 3ZY5A 2O3UA 1OF1A 1W4BA 3OQIB 3GEPA 3ZJTA 5CBPA 2FLKA 2QOEA 3RYFA 3JWJA 2VSFA 1OC2A 2IZ6A 2VOJA 3PXBA 4YJ3A 5KQMA 4A7PA 2JLQA 3QW4B 3EHEA 3FF1A 3SQNA 2HQRA 2WAOA 3HJRA 4CQLB 1OH6A 1M6WA 2EW8A 2WJIA 4L5CA 3SXUB 4K6GA 4QDUA 2R1ZA 3QWBA 3O91A 3WLSA 5HOEA 1ZX1A 2P5YA 3IQIX 2ETXA 5H16A 5K3OA 1U8ZA 5LKRA 5IF9A 4FYMA 5EERA 1MHTA 4F1WA 2NZYA 4NX2A 1XZKA 4U7PB 2TMGA 4B3DA 4AKSA 1DC4A 1CE8A 4JEMA 3TLEA 1JV2B 2ODNA 2NVUA 1TZJA 4F5DA 4QZVA 4IHJA 1WD5A 2RMKA 4PQRA 5AUNB 1C3LA 2JGFA 2Z30A 4ZQFA 5B58C 2Z6UA 3BMNA 5FNVF 4BWVA 1T5SA 2NUAA 2ZQ5A 3FJOA 2XUQA 3NAGA 4IF4A 3SMQA 2DUUA 3SQWA 1YU9A 4XFJA 4BUZA 3D6FA 4MICA 5HQTA 3PEFA 4POAA 4D4KA 2CLFB 1KF0A 4TSRA 3OT1B 4NOMA 2ACEA 4HN2A 4B6EA 3DZHA 4YQEA 3JATB 2OZLB 3RF7A 1LK5A 3VR3D 1JR4A 1JT9A 2QXYA 2ROQA 1Q20A 2V6MA 2DYKA 3HVJA 2IPLA 4UNIA 4U7WA 2YVKA 5DXJA 4HEQA 1YRAA 4B75A 3Q3IA 5JS2A 4G1EB 2BEJA 3URKA 4TTAA 1HL3A 4MV1A 2I3AA 1MAAA 4RS4A 3ROPA 1JNYA 4NOJA 3LQQA 2M6LA 1YVRA 2EFJA 2C2YA 3E8XA 3H5RA 1W0JA 3MCZA 4L4RA 4UMFA 3UMJA 3W3AA 1DAFA 4RF5A 2BFPA 2QNBA 1QCYA 5ARDA 3Q0TA 1C1HA 4TX1A 4EFMA 1AGYA 2VJLA 3K9QO 1UDBA 4MGZR 1VA4A 3KXDA 4OO3A 4JOCA 1EUZA 3C6KA 3IPYA 5CIWA 2Q5CA 3U80A 1ES9A 2QW1A 3C3AA 1A97A 4YHBA 3L8HA 5E38A 2FPGB 5T6MA 3SI7A 3E9YA 2WF6A 4G1CA 4EUKA 4ITRC 1PDVA 4N0MA 2QE7D 2W93A 4BS9A 5BVGB 1X8LA 1Z73A 1VFPA 1E1CA 1RPNA 3F47A 1BDBA 3F6CA 1C1DA 1I6MA 3H9CA 4JI6B 4E4RA 5AVZA 3ZXYA 1SM4A 5CB0A 3LPNA 5BT9A 1IYZA 3DD5A 3VR6D 2PH5A 2IHUA 3W1WA 2ZUFA 3WL7A 4LJKA 2GGSA 1Q0TA 2GK6A 2NQ2C 1EM8B 3I05A 2QM3A 4XGNA 3ZHYA 3OECA 1ZW6A 4X94A 5FWXA 4GBJA 3QA3E 4ENUA 2RBGA 2NZWA 3OCJA 2I66A 2W4IA 4TTIA 1E69A 2IOHA 4OL9A 3CUSA 3VO9A 3LWNA 1M6VA 5HCIA 4NF2A 1SKYE 1DC8A 2B5OA 1UDAA 4NS1A 3VU9B 5LSAA 2R4UA 1MC8A 3LDFA 3CCFA 4I9UA 5JAHA 3U16A 1QZXA 2BGIA 2NZ2A 3DQQA 3EWSA 5B3AA 5K3EA 3UWOA 5BYJA 1EFRD 2Z57A 3CZ5A 4HVCA 2Q5LA 3ETDA 1B6TA 2FOIA 3LECA 2W22A 3B85A 4WNAA 5BWBA 4W1SA 1UK8A 3R0VA 4WBNF 4NMXB 4ZOEA 2RAFA 3AF0A 2QRJA 3P2OA 1ZQ9A 4WOKA 4MP6A 1HTBA 2DBZA 3HB4X 1MV8A 1QTRA 2DOKA 4FMCB 1YKSA 4NK5A 3ADDA 9LDTA 4LKOA 2VYVA 5ADWA 1U7XA 4R54A 1T8RA 4HGQA 1IB6A 5JH7B 1FBTA 2BGNA 3ABRB 1Y3IA 2EXXA 2KMLA 2XNCA 2EKLA 4NKRA 2I9KA 3ESDA 2F4VB 4KO3S 3O8NA 2V55B 3AGPA 4OKSA 3AJ8A 4IWXA 1O8BA 4N8SA 5COAA 5SICE 2NWQA 4ZOLF 2HO4A 3WA7A 3DE1X 5HQ3A 3JQEA 5K0NA 1R10A 3VTAA 5L3VA 4XB2A 1L5WA 1XZIA 2FSVA 1OWLA 2ZDQA 1G6KA 4E11A 4BB0A 4UHDA 4DR3B 4Q3AA 2YDYA 1JEYA 1GEGA 3QKWA 5KMGA 1UMBB 1Y8CA 3PGKA 5IDVA 3VBCA 2FUNB 2NUPB 3OMXA 2IXAA 2H0RA 2OCIA 4XDZA 1E2QA 3STYA 4ZK6A 5L7YA 1JVBA 3JYNA 4HFMA 4ECAA 4TN1A 1YGPA 5AJHA 4NPAA 2FWPA 3B2QA 3OU7A 1XJQA 2FW8A 1KPHA 3LT4A 5CXSA 4LF5B 4DT1B 4KXLA 1Q77A 3LUAA 2QX4A 4A0SA 3G1WA 5DNWA 3C98A 4OG2A 1ENZA 1I0IA 4D3FA 2HA2A 3FVVA 1IZYA 3LPAA 3QVSA 5JJBA 1CNEA 2VNAA 5FR2A 5JI2E 3TGWA 1X8JA 3GGJA 3UJHA 5HSGA 1N2BA 5SY9A 1JBEA 2F1JA 1RXVA 1K5GA 2PSHA 3Q8KA 3WOHA 2XB4A 4X45A 3SZGA 3E9ZA 4GI5A 1LLDA 4UATA 1H2EA 4J3FA 2DT5A 4ZVOA 4ZHQF 4JH0A 4ZAXA 4CHTA 1Q83A 4FNAA 3C0KA 2PDAA 5EE1A 4IDCA 3L1IA 1V8DA 1KK0A 1JXQA 4WN9B 2ECQA 10MHA 3WYFA 2PU7A 5AI8A 2HSDA 4MA4A 3DMDA 1H94A 2G77B 1EGAA 1NXXA 1ZUHA 2BH9A 2FWMX 3GG9A 3K15A 3MJFA 3LQ2A 4NV1A 2FEKA 1ID8A 3CBGA 5CNMA 3NLLA 1TUBB 2ZAIA 3PR3A 5CITA 1WCIA 1D2NA 5DNYB 4RLSA 4TTQA 2EJUA 1XA4A 3ILYA 1HE1C 6CHYA 4PZAA 1FS4A 4XEHA 4GR4A 3IOEA 4RACA 4WZ6A 5DHFA 1E3DA 4DSZA 3KK0A 4FDTA 4YX9A 1AKTA 2VK1A 2XUDA 3E2PA 1R6AA 4LF8B 1P1BA 5LA6B 3TJZA 3A2LA 1XZPA 2Y0EA 3BILA 3EBPA 3BGDA 2C77A 2MT9A 2HJGA 1IHDA 5KYUA 3B7GA 1MAHA 3Q7PA 3EXHA 1GARA 3VH1A 1KFKB 1XFAA 2HRCA 4PNEA 1EVJA 3QMMA 5LDDC 1KJ9A 1Y9EA 2HSGA 3F6YA 1NOIA 2V97A 4QQNA 1JMVA 4ME6A 2HJSA 2HIHA 4PQGA 4L8FA 3L6RA 3VPFA 5TGZA 1RVDA 2HIGA 1Z7BA 2XTJA 4TTTS 2C3OA 1JKXA 4DCOA 2YWBA 1JPVA 5CFMA 4U63A 1I4DD 2HQ1A 4QBHA 3WNDA 2OBYA 3TXAA 2XJ4A 1Z7WA 3F6EX 3FI0A 4RJKA 3F6PA 5I47A 4HTFA 4LGYA 3LPCA 4DCJA 5L3SB 1SKYB 3VVBA 2Q2WA 4X1YB 3DBRA 1BGWA 2R8BA 1B3BA 3E3OA 5D87A 5BNIA 3AP1A 3NYIA 2CMKA 1E3TA 4YASA 1V6CA 1IY8A 3QFHA 4QQKA 5BV1A 1Z9BA 3RGWS 4Q6BA 3PIIA 1E3LA 2PEZA 4D3YA 5D3MA 2W6QA 1TPZA 4ZYXA 3TKYA 1LF5A 1F9AA 1CHNA 3BSYA 4PQFA 3T3GA 2B94A 1LDYA 4EB0A 3VR2D 3ZX5A 1KC1A 3IV7A 1PBTA 2ECKA 1X6VA 1GQFA 1IHUA 2QT0A 2V7PA 3AL2A 4DA6A 3BD6A 5GONA 2D1QA 1HOXA 3OIDA 3ANSA 4I5FA 3M4ZA 4FZRA 4YFYA 5EJ2A 1U5AA 3TTYA 3OCUA 3KKOA 2XCIA 1B73A 3I4CA 5ADVA 1YR7A 2WW8A 3QHAA 3G1TA 1JYSA 4QQ8A 4DWWA 1H3FA 3HR8A 1IOWA 3EDYA 3EXAA 4RYLA 3U7QA 5JXGA 4CM4B 1JSZA 3GJ4A 1LBTA 4NEHB 5BMVA 3GLFE 1RXEA 2C9OA 4M9QA 2JK1A 1P9LA 4KAXA 4RY2A 3UAZA 1JECA 3G2HA 2ZI4A 1LVHA 1BFKA 1Z6QA 2NU7B 2GPYA 2JLSA 2WE7A 3BH6A 2G0TA 2NTVA 1U8EA 1XELA 2X0IA 5DSTA 5FXMA 5E9AA 1T1EA 1H6BA 4K28A 4Z1OA 5C34B 1ADYA 2C5GA 5JJCA 5K0TA 4RAOA 2BI7A 3I6IA 1L5HB 1OBCA 1EUCA 4MW1A 4NDZA 2CZGA 3DZBA 2FW7A 4IFBA 4ZYUA 2HIMA 3G02A 3NC0C 2OGZA 4BEBA 5BV0A 1W87A 1NNEA 1M5TA 2BE9A 4E70A 2Y2UA 1A71A 2EJCA 3G2PA 2PH1A 2YFQA 3SHTA 4BFVA 2QS9A 3QJ5A 3WYGA 1QRSA 1IXYA 5COQA 1PD1A 1GPKA 5CNKA 1DEAA 1M7HA 5K6AC 1NT2A 2X6TA 1XVTA 2UYGA 3KLMX 1WDKA 2RBKA 3HDVA 4MUYA 4QGAA 3U40A 2CCKA 1VZ2A 2WWTA 1RABA 4R2LA 3UKOA 2GNOA 4LWOA 4AY6A 3QBTA 4CLOA 3EUFA 1VE9A 4Z4EA 3SS9X 3VDXA 1I4TD 1QLHA 1A96A 2XUFA 2GAIA 4L3WA 3ZJVA 5I45A 3NTUA 3ZCSA 4RTPA 3CRZA 2C1ZA 3Q5GA 1YRQA 5EXPA 3OZBA 3BMQB 2FFAA 1V26A 3OIWA 3KDSE 3TSAA 2MINA 1DX6A 2VHTA 3GAMA 5JCZA 3DLBA 1MVOA 1DS6A 2CMFA 3EIEA 2A5YB 2NYAA 2VF4X 2X42A 4KQJA 2CNOA 7REQA 4I50F 5JRJA 3ER9A 1RTTA 3K1TA 3WGHA 1KOLA 5DMXA 1OKKD 2QXTA 3CZ4A 3LZCA 5JJKA 3NHPA 4N7RA 2JVIA 3G49A 4QUGA 4NCHA 3HCBA 2R3SA 5LLTA 4I2NA 3USCS 3PQEA 3PJGA 1LBIA 2XLCA 2XYRA 4JX8A 1EX9A 5BRNA 3RS0A 1PX2A 4AECA 5TQ0A 3CZ9A 1G5HA 3MTDA 2QJWA 1UXOA 1DV1A 4AROA 2R25B 4YP7A 4WNYA 4YV7A 3MZ0A 1E5DA 1OCEA 3FDFA 4YFVA 5GOTA 3NEPX 2R1TB 4OXYA 2B1GA 4F11A 3IIIA 2WUDA 3X1JA 1KIMA 1D1QA 3B53X 1JG3A 1M8PA 1VIDA 2JEOA 2X3FA 2A59A 3VKUA 1WPXA 3KKKA 4DSNA 1FFYA 2BUAA 4DC1A 4Z4IA 1EVYA 4A2WA 1EDZA 4Q9DA 3RSLA 5EWLA 3EC7A 1Z2AA 4DB2A 4Y2YA 1X1SA 3EEIA 4WFIA 3RFVA 3ET5A 5FFNA 3NPAA 4BNZA 5LD2C 2ZETA 5F3RA 2WKWA 5KNCH 4LDPA 1G64A 4BNMA 4HX5A 1YGYA 1GZHB 5JAIA 1KFJB 1AXEA 1SUSA 1T2AA 5I5GA 2J46A 3NAQA 3QSGA 1DKMA 1U3UA 1CY8A 1Z18A 3M6FA 1GU7A 1SN7A 2P4EA 1SHTX 1PCXA 2RKBA 1L8OA 2HEIA 2WUGA 3MB5A 1P33A 3RS3A 5IVPA 1QQAA 4FFMA 3B1FA 1RFGE 4MWSA 1SCNE 3M70A 4UCXA 3ZDRA 3DZGA 4TZ0A 2ZWOA 3GVPA 1KBZA 3QTLA 3QHQA 3N2KA 3QNMA 4Y9SA 4EY3A 5KTNA 4EARA 2P7IA 1Z0AA 4ZI7B 1NMSA 1QZ3A 4PSKA 1RFLA 3WAKA 4JB8A 4NBKA 5KYTA 3MCVA 1SKBA 1TTPB 4ZQBA 1XZNA 3M1YA 1VZ3A 4MDHA 4OHKA 1NAHA 4TN5A 4YYZA 1OE0A 3C1AA 3D8RA 4CEJA 1K89A 3EOBI 3GRZA 4KUHA 3HVKA 1NHWA 3TAXA 4D0GA 1ZSVA 5DLEA 4JI1B 3MM4A 1I80A 3DFZA 1XDBA 4LBWA 1S5PA 1MGOA 4Z0PA 2QP3A 2X8JA 3TLJA 4A73A 1AA9A 1FXSA 3ENNA 3VOTA 1Y1TA 3UJ8A 3QFCA 2CJFA 2OQIA 3AR3A 1Z12A 2IEAA 7ABPA 4TUYF 1J09A 1G5TA 2V6FA 3KKMA 2WFZA 1R4NA 3R6DA 3ZTTA 3ESYA 4UEQA 1R8SA 3O26A 4IDNA 3DMNA 3L6OO 3WJ1A 1YB2A 1D2EA 1V11B 2AEMA 1U94A 3QOYA 1JQKA 5DBGA 1XXHB 2EDAA 3VI4B 3WBFA 4DLSA 4EQ6B 2FQQA 3PWZA 5FWNA 1DV2A 2IXFA 2XECA 2EBFX 2GZ1A 1C1XA 2QZJA 3DLIA 3W6NA 4BTVA 4IXNA 2HK8A 1C41A 4M83A 4HPXB 3U5TA 1ZI8A 5EJFA 3NM4A 1N2IA 2JCYA 1QFJA 2NV0A 3O9ZA 1B8OA 2XT9A 2O5VA 3AEQB 2KQUA 2VT7A 1C2YA 1O6CA 1V4BA 1V16A 5B12A 3QOWA 4HZGA 1I10A 3EMVA 1MMFB 3EDMA 1W52X 4C30A 3WIBA 2XR1A 2SKDA 2AG6A 3I30X 1NVTA 8ADHA 3T35A 1HEIA 1NXOA 3VDQA 3N2YA 1X7HA 4IBOA 1NBMA 4LVUA 4UXHA 2IHVA 2A0WA 3PKIA 1JFLA 4V02A 1W35A 5I7FA 2WICA 1KJYA 3BA6A 3DMTA 3GR6A 3OQIA 1A5SB 4OQZA 5DXFA 4ENRA 4M1MA 2CLEB 3BXFA 4ZJYA 4CTOA 1PLLA 3NGMA 2DUMA 2B92A 1RLJA 2HWUA 2NZUG 4OLFA 2EP8A 3RODA 4WW0A 1Y98A 2DC1A 3FNFA 3D7RA 4CQLA 1C8BA 5LKAA 2JI4A 1M34E 1WR8A 3SXUA 4K6CA 2ESRA 4ITUA 6ADHA 2HHHB 2P65A 1XCLA 1N2XA 2V7XA 3OIGA 3KR0A 3B3QA 3HXOA 3GH1A 4Q1VA 4DS3A 3IT0A 1T0BA 2CLIB 2L42A 1RC1A 3HDHA 2I7VA 5I9LA 5JISA 5FWYB 3RJ9A 4LK3A 4C4YA 1NF3A 3JQPA 1N7JA 5CHEA 4DUPA 3IUYA 1NVVQ 2Q1SA 4MUBA 4NYIQ 4DLRA 1N5LA 5CJPA 1F06A 3LYLA 3QUCA 2HA0A 4RKWA 3FPSA 5ESDA 4RTMA 1WZUA 4B6RA 2WVAA 4K6OA 5G41A 3EVCA 1G60A 1SOWA 4NG5A 3V4LA 2JIZD 4GKVA 4QAQA 1XRPA 2VJPA 5AOBA 3V4RA 4GL2A 3VSAA 1QYIA 2OZLA 4FOLA 5M3BA 1PFYA 4I5IA 1XMJA 2B61A 2D4HA 4QT0A 1XPJA 1E89A 4F38A 3GARA 3LXXA 5KNLA 2PLFA 4G0UA 3PCTA 2EFGA 1BWPA 3V8RA 4RMJA 3ROXA 3S99A 2POQX 3VH3A 1NPYA 1GFIA 4QJ4A 4WSOA 1ZCAA 2F8TA 2WMDA 1UBRS 5FX2A 3LI2A 3QGMA 1IXRC 2PD4A 2D3WA 2L19A 4TXMA 4OGFA 2F9FA 1DQZA 3NUZA 3H87A 3LUDA 1P4RA 5FWDA 5FI3A 4PV7A 1NQOA 4NIMA 1KVQA 2QYTA 1QAQA 1QSGA 1E2FA 3DO5A 3G2KA 4L6IA 3UGJA 4HJRA 1JA9A 1XZFA 4W7IA 3AUJB 4FGKA 4BJ1A 5ULLA 2QG9A 4NRDA 4A6PA 1ULAA 4N4AA 4EFKA 1F0YA 1B42A 4HS4A 1F8UA 3P9ZA 1OIVA 1K27A 4ZC8A 1F5SA 1I5OA 4OK5A 4CR8A 4FYVA 1L5MA 3N8NA 2FPGA 3H2JA 2CSXA 2PS9A 4H0CA 5BVGA 3IR7A 2C2OA 3D6TB 3EXG1 1US8B 3HJAA 1TJ3A 1U7TA 4KV9A 1WCV1 1PS0A 1XN4A 5ERYA 3I37X 2PO7A 3C41J 1R8YA 1M2JA 3H13A 3SK0A 2Q50A 3E58A 2WMNB 4QAJA 5TXGA 1EM8A 2C2XA 2BBOA 3SCZA 3D6VA 4GLFA 1ZJYA 5MGNA 3FA2A 1S9HA 2FDXA 3OE7D 1T9CA 4PO3X 3K35A 3HXMA 5G40A 1D2AA 1GWNA 3CXUA 1F0PA 1WQ1R 3G0GA 5EMHA 4N12A 3T12A 5K20A 3AYZB 1LTHR 3LX5A 1X2EA 2J31A 3QLEA 1M5UA 3MGGA 2NNWB 2V7UA 3AG5A 1DLIA 3FHLA 5T4BA 3VU9A 5BW4A 3UAXA 2W0SA 1AKVA 1EA7A 3UB2A 4EELA 1NBWB 3KD3A 1P17A 3HL4A 1KEEB 3QBJA 2F3TA 4GEKA 4NAUA 3VZSA 3OWXA 1AU9A 4NE9A 2QN6A 2QD3A 5A02A 3BDVA 1G59A 5DBEX 3VR4H 5E6RB 2APJA 4R8RA 4QTZA 2X58A 4EFDA 3A6FA 3F71A 3KUCA 2IYEA 2M2IA 3GPIA 5F35A 4F9TA 1R0KA 3ETCA 3S7TA 2QVXX 3NAZA 3WK7A 2PGNA 1YDMA 1SU6A 3IUBA 3PPVA 1MORA 1PK7A 5IK2D 4K6KA 3D0RA 2J45A 3RRZA 2LDXA 5E4YA 5TQ2B 2P6PA 5JH7A 3B6ZA 3EPJA 2R7NA 1WMEA 3MTGA 1KAOA 1SA0B 4BO7A 1LJ8A 4MWBA 3ZD9A 3KUKA 1BWQA 1VHQA 2PSSA 2CN1A 2G5PA 3JQ9A 4YVFA 2IH2A 3F98A 3GWZA 2XCOA 4RXUA 3K31A 4ND1A 3NYRA 3FUXA 5EMKA 4C7OB 2JKVA 1W59A 2Q62A 1TO2E 5HPYB 2XBMA 2MSNA 3RQIA 4CHGA 1AQUA 4RH3A 1PEKE 1UMBA 5I4BA 3FHOA 1TT5B 1XTTA 2NUPA 4ZA2A 2O52A 2PGXA 4KZPA 5JDCA 4DMFA 5LFAA 2ENWA 2I6GA 3MNFA 2CXNA 4EVSA 3T3EA 4MUGA 3MJEA 3SOZA 5LM3A 3RHTA 3H6HA 4BO0A 3KJIA 1MUUA 2PFSA 1GTMA 4NQZA 5BW6B 3ZV6A 1JFRA 3DQZA 4TTRA 1AX9A 2JA1A 2RHTA 4JLBA 4JLSA 3I6BA 4KIWA 4MLDA 2H1CA 1NN1A 2VP0A 3MYRA 1KYZA 4DT1A 1U8FO 1UBUS 4LYHA 3U7RA 2BCGY 4ZT7A 5ALPA 3M3PA 1JKJA 4OXNA 4EGSA 2K5UA 4P3XA 1A2OA 2QDKA 3FOAA 3LDAA 5E2AA 3TQHA 3U4HA 3UANA 3TRIA 2I76A 1HZZC 3IQXA 5G0VA 1N5OX 5K6RA 2OD9A 2BKLA 4DIDA 1DCKA 1XNHA 4RSGA 4C0QC 1O2DA 2UAGA 2W2VA 3KOZA 4RIEA 1G38A 3BMOB 1NQUA 1ZXLA 2DHRA 1KEPA 2FZGA 2NX2A 2ZSIA 2ZYTX 3EIQA 3ONNA 1T4BA 1ZUD1 1OI4A 1OJLA 5AM0A 5SZKB 3G68A 1KYYA 4BNNA 2AJLI 4M22A 4Q1EA 5IKPA 2KHZA 2M9MA 4UM9D 2DFNA 1W75A 4G67A 2AWNA 3NDRA 1E1RD 1T5OA 3A32A 4JLWA 1C3VA 2KPOA 5IAJA 4B1FA 5L8VA 1DU4A 4B2YA 1TUBA 1JLHA 1COZA 3FPGA 4UZSA 2PWBA 5J23A 4TTJA 4KN6A 1RRPA 3T7SA 2CNBA 5LOVB 3RE1A 1KDRA 4UHBA 4DR4B 2XDYA 1KDTA 3UG6A 3UH0A 2FZ5A 1N3IA 2PQ6A 4BO6A 1PKEA 3VR3A 1WEKA 3L93A 2W42A 4PLVA 3RFTA 4HDMB 2ZB3A 4OB7A 5LA6A 2XH8A 2C94A 3DDOA 3G88A 1ORRA 4AL4A 4Z7JA 3R6GA 1LLCA 4C05A 1G5IA 2ZB4A 1WX1A 2PLAA 3EG9B 5ICGA 4F85A 2GEVA 3FTFA 4ETMA 5HGXA 4EPTA 3NBXX 1TM4E 2PKRA 3P52A 1X9GA 4Q37A 3U4DA 2HJVA 3OO1A 2JZOA 4EGAA 1NMQA 2GZAA 2XVZA 3E7WA 2J9FB 3WBKA 4B4UA 4UTPA 2XZOA 2MU1A 3OFSA 1XNQB 1IU9A 3ZEIA 2ILVA 3HZHA 4F45A 4GO1A 3DNPA 5AXCA 1ZNWA 2OE2A 2EHJA 3O82A 3N86A 4O1HA 1IY1A 2AV6A 4RJJA 2XMDA 5GWXA 1PGOA 2IUUA 5EHZA 4J9VA 4C89A 4JEHA 5A71A 3DZKA 2FK7A 4ZZ3A 4IP0A 1C4KA 4P4SB 4M86A 3RRYA 5L3SA 3TZKA 3RRXA 1KRHA 3MAAC 2HPHA 2QE7A 4ZD6A 3Q4GA 3H8SA 4HLCA 4LYYA 3BJIC 4UXJA 4KR3A 2Q7DA 3KU4A 2NLOA 4P3YA 4DRXB 2DECA 1Q7CA 1EJBA 3PXCX 4XDYA 2B7CA 3UGKA 3VR6A 2GK3A 1GPUA 1WMDA 2EL9A 3OPMA 1F3LA 1NQAO 1Z07A 2IYVA 3R3YA 3VDRA 1ZD9A 1YBVA 1IVSA 1B4DA 5FLXA 2Z04A 2X5OA 3HV2A 5FULA 2PGOA 2OQ2A 2G6BA 4JELA 4DYHA 1Z6PA 2FFQA 3DE5X 2J67A 4R3WA 1T0PA 2I1QA 2D0PB 3K1AA 3ZCVA 1XROA 1D2GA 2ZE5A 1Y4AE 4FOOA 4Q4CA 3H9EO 1MJ5A 1QNFA 1V7CA 2EFHB 2IEYA 2B8EA 4LFCB 4BY9E 1RI5A 4CM4A 1L5QA 1ZK4A 3EAFA 1QS0A 4MKXA 4AI6A 1YQXA 3QFSA 3WGIA 4UNPA 1QF9A 5J2UF 1EFRA 1BMFD 1JIUA 2ZUCA 5JVDF 3K2EA 1ISIA 3ROEA 2QYSA 3L43A 3OIFA 4JCCA 5JNTA 2ZM6B 1RIFA 3KXKA 4ZO9A 3NBMA 1L5HA 3PDJA 1X1CA 4KR9A 3S70A 1EHYA 1NSYA 2HU8A 3TD9A 1GKLA 3KD2A 3FNIA 2OV1A 3QWAA 1OV4A 4HVAA 3V1NA 4H16A 5IBCA 2IS2A 1RYYA 4IFTA 5LD2B 2VNSA 3RYTC 1ZIOA 2YWGA 2Q5JA 3GVIA 4UU1A 1YJBA 4YRIA 3KP1A 5KWIA 1VLJA 2A5LA 4K8RB 3JZIA 3GCWA 3MPUA 3OOYA 4QU0A 4PTLA 4AB1A 1RQRA 3QY9A 4OQFA 5F52A 3VPAA 1HETA 1O9HA 3MS4A 3LBIA 3A37A 4PZCA 2LUOA 5EJGA 4MQEB 5BYBA 4DQKA 4ETNA 3K0CC 4ZEMA 1D1SA 1USVA 4ND3A 5C35A 5EE5B 1I2ZA 1CPYA 2B5WA 1GZ3A 3MOIA 3EYWA 1N57A 1NXQA 3EW7A 3PENA 4RY9A 1F6BA 4EL0A 3M81A 2Y0DA 4GOXA 4XM1A 4G1UC 5CMLA 3SEZA 4UU0A 1BVRA 2FLWA 3BMQA 5DX1A 3U37A 3OMWA 1TB4A 1TRHA 2R60A 2BOVA 4ESVA 3EF1A 4W6QA 2Y6UA 3U09A 1CUFA 1XJ0A 2C7BA 2X5XA 4PSVA 2P69A 4BZQA 2YHIB 4Q16A 1NTOA 4HAXA 3CUTA 2NT4A 5G02A 1NU8A 1O7JA 3E7XA 3LQYA 3OC0A 4JKOA 5ALIA 4HRXA 4D80A 4DQXA 2Y92A 1DDOA 1GOTA 1BX1A 2M1XA 4N3AA 2C5FA 3SLKA 3TOZA 2XT0A 2XYVA 3WWZA 1MO4A 1C7RA 2Q49A 5F12A 1CLUA 4FEAA 4LHEA 5SZIA 3UHFA 3FGOA 2DPXA 4L85A 2FYTA 1L5RA 2DRIA 1HK7A 4QA9A 2IIBA 3RLFA 3ZKWB 2BEUB 5LZ9A 1WW2A 3NAMA 3D3EA 2EGGA 1YQWA 5K01A 3NDBB 1QH1B 3DT9A 1MIHA 2R1TA 1YBMA 1GPBA 3C3BA 3LUFA 4RCYA 1T0IA 2VEOA 5FTKA 1IXSB 3PJEA 2HCRA 4OYRA 3IQZA 5DN6D 1KNXA 1P3Y1 2CFIA 2GCPA 3I9NA 3UW3A 1TKRA 1Z15A 5EE9A 4Q47A 4GQIA 2ZJ0A 4UM9B 4C4XA 1J90A 4D5EA 2YFKA 3L7CA 1AQIA 2XAAA 3O92A 3R24A 3D3QA 5AICA 2EHDA 2IBMA 5P8WA 3TAUA 2NYRA 4NS4A 4WK0B 2JGEA 1ND6A 2P6OA 3BFVA 3OLVA 2VWGA 3QFRA 3SM9A 2GF0A 1DKUA 2H1RA 3EVZA 1TZBA 1M2HA 1FTSA 4BNYA 1DTEA 4E31A 4GZ3A 5JE8A 1KI8A 2V5AA 4W5WA 4II3A 4DVJA 4KEAA 1C0PA 2H11A 4RPJA 1E1MA 2G1AA 2GDZA 4KQHA 3H8VA 1SWVA 2WHEA 3WDMA 1VXOA 1Y9AA 1WSDA 2ZYAA 4JUDX 4U6SA 3A04A 4FLEA 4BX2A 1S9DA 3VYVA 2YXNA 4LRXA 1DMRA 2V8OA 3I0NA 2GRAA 3TW4A 1OX4B 3DOCA 5ERGB 1JDNA 1ZSNA 4YJKA 3M4XA 4FUTA 3B48A 2R5NA 1E6UA 4F5ZA 1W6RA 1LVGA 4UCWA 4HT3B 4ZI7A 3N8IA 2IV2X 3RD5A 4LJRA 3LUHA 5DV9A 3U4GA 1UPUA 2DFVA 1IJKA 4JQSA 2FZKA 3DVRX 1BJKA 3NNSA 1I4EB 4NCJA 3S55A 3G85A 4F4FA 1HRKA 1H93A 4P32A 1QQ5A 4ZVTA 4EQZA 4M4SA 2PD3A 5BNWA 4MRAA 2CE2X 3MRTA 1NW7A 2Q6LA 1JDSA 5CB4B 4E2YA 1YI8A 5AJWA 5EL0A 5IMSA 4FHGA 1QO9A 1GYPA 1ZZEA 4MKFA 4EATA 3VU1A 2AC4A 2ZXEA 2XVMA 2VTEA 3JYOA 4NNJA 3F2IA 4O5AA 3BL8A 2WVHA 1EVKA 5B6JA 4RVSA 2HRRA 4MTCA 4LYJA 4BEWA 4EZIA 1ZGHA 2CJXA 2XA2A 4X97A 4C6HA 2XOKD 2EZ4A 3KJZA 1NW6A 2QROA 4PPQA 1FYFA 3F8WA 1E5LA 1FY2A 1Q0ZA 2AHRA 3DMRA 4RJ2A 5G3YA 4KI7A 2QUHA 3VR2A 3FE2A 5DRYA 1V11A 3VISA 4C7MA 4DCUA 2WTNA 1Q0RA 1XXHA 4EQ6A 3IE2A 1OWOA 2VT2A 3ZGOA 1TYDE 3EUAA 1GRVA 2C0PA 3MWGA 4IQ8A 3ZZUA 1Y7PA 2GHIA 2GO7A 1KC3A 3TX2A 3G59A 3QENA 4XR9A 1UL1X 2DLDA 1WXWA 5BV2P 1R5NA 1ZUIA 5JV5A 2XEXA 4D9IA 1XZBA 2WYVA 3VZPA 1O3YA 1YDFA 3AILA 2JIRA 4LYEA 1P6QA 4CLRB 3KM0A 5B7QA 2QDXA 2UVQA 3AEQA 5F4ZA 4E09A 4HQFA 2P79A 3PKJA 4LJ8A 3QLTA 3ZU4A 1TZKA 2C07A 2DUJA 3A0RB 2ZOSA 4RH1A 5HS4A 2UYCA 1H0SA 3IX7A 4C2TA 1JIVA 3H75A 3KBBA 3S68A 2ZE8A 1NASA 1HTTA 1VMIA 2RK4A 2WIJA 3H18A 3HWRA 4U7FA 4C4RA 4DADA 5J4VA 4L8YA 1D9ZA 2KE5A 3IE1A 1NY6A 5DASA 1N77A 2Q3CA 1YASA 5L4LA 3RU7A 4M55A 2OZPA 3AWIA 3DSRA 4F7DA 3E18A 2I1LA 1JRLA 4MQFB 1Z63A 1DRJA 1DXOA 3DPUA 4YRFA 3UG7A 3WJ7A 4CV1A 1PX0A 1T4MA 2HMTA 4YP6A 5JNRA 1E6CA 2ZIUB 4HFNA 5EESA 1WQ3A 2VKTA 3RV4A 1AY0A 1AM4D 3R40A 3D4PA 4BMNA 1LBHA 5BN1A 1P9OA 1U4OA 3VHXB 2Y4OA 2LBPA 3SF0A 3I23A 4CM8B 2Q3JA 2ZBQA 3IELA 1P1IA 1PUIA 1WXEA 3SIXA 3EIHA 1GQOA 4GRIA 2H17A 3P2IA 3IQDB 5JMTA 3DFMA 5AVKA 4HAWA 1XTKA 4CF7A 1JSCA 5EJ7A 1VYUA 1K97A 1SXJC 2PTHA 1RI2A 5FTWA 4M1SA 3MA0A 4PW0A 5FWYA 2WTUA 2IJGX 2DFPA 2TMKA 1N0IA 4M76B 1XZEA 5HZMA 5AP9A 4S0ZA 4URVR