2RBGA

Crystal structure of hypothetical protein(st0493) from sulfolobus tokodaii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
YKNILTLISVNNDNFENYFRKIFLDVRSSGSKKTTINVFTEIQYQELVTLIREALLENIDIGYELFLWKKNEVDIFLKNLEKSEVDGLLVYCDDENKVFMSKIVDNLPTAIKRNLIKDFCRKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein(ST0493) from sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein ST0493
total genus 40
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rbgA00
2RBGA
chains in the Genus database with same CATH superfamily
1JJ7A 3B3FA 2ZAYA 2VYFA 4XTCS 5DNEA 1T2UA 4TKMA 1BE1A 1I4EB 1Q91A 4PRLA 5B12A 2ZSUA 4MP6A 3OPVA 4DNPA 4X3OA 1XNHA 5AXDA 3WTBA 5KTRA 1OW3B 3DL0A 4O3MA 4PAGA 4NR0A 3QWAA 1S4QA 3DXZA 2Z6UA 2QAJA 3ZU6A 1VP9A 2B2NA 1XSEA 3OPYI 1DWQA 5LBIA 4XUGB 5DHPA 1QX3A 3ZXYA 1YC2A 4BVFA 4GM4A 1I2ZA 3ET4A 5SYAA 4N0EA 4P83A 2VPQA 3NOVA 2B1IA 5LXTA 4OJQA 4M9CA 5DLDA 1E1QA 5HM6A 1EE2A 1RQGA 2GK3A 5JXGA 4PQRA 5KDDA 3QBTA 1RWXA 1AOXA 1NW4A 2GBLA 4MA0A 5E2AA 3DVQX 2A5DA 3X1DA 4CMHA 1MEOA 1FSGA 2Q3BA 2RBEA 2YXPX 5CCEA 2B69A 1T5SA 2ZTUA 4JODA 3C1AA 3TAXA 4UXIA 5EZQA 1W5SA 2R1TA 4KTTE 2XRFA 4NIMA 3U16A 2UYOA 1T24A 4B34A 1F4VA 4DIMA 3QGMA 5KIAA 2OV4A 5DRYA 5DWDA 3PD7A 5CJ2A 4O1HA 1HTWA 3MCAA 1VDMA 3KOOA 5IRCD 3ZJTA 3TW6A 1C7ZA 1VJCA 4YI5A 3GLIB 1U2EA 2VTDA 2BFCA 2WTEA 1T3GA 1GT91 2AD1A 2FP3A 4CN9A 3HKBA 5JS2A 3DBHB 1I3CA 2C92A 2O0HA 2OKCA 4WGFA 3ZK8A 4B46A 5CT4A 1KYQA 2OZVA 4HDKB 3ESDA 5JDCA 1X13A 4DV6B 3NC4A 4U3JA 2W2LD 4QNMA 1XTUA 3W8NA 5F98A 2EZUA 3N2EA 4LMRA 1IQUA 1RLJA 3M4YA 4LRUA 3EEIA 4GR4A 1UFVA 1A82A 3BHJA 5JR3A 4JQCA 5EXEA 1ORDA 1OU0A 1SJ9A 3H42B 4IXMA 4MUAA 2UZ1B 5F51A 3STWA 2X9NA 5D5QA 3NXSA 5BY2A 1TM5E 2PIDA 3SKXA 1KBOA 2R7NA 1TYCA 2ATIA 2WJ3A 2SBTA 1ISHA 5F2EA 1XQXA 4DY6A 4P08A 1TB4A 4F38A 2PZJA 2ZYVX 1WLSA 1H9BA 1KO1A 1DX4A 4R3UC 1L8QA 3L7IA 3E2MA 3MWEB 4OAQA 1IZYA 3S28A 3UIEA 4DHWA 5ALVA 3IOMA 1VG8A 1DQSA 1NNI1 2GN6A 1DAIA 3QM1A 4MLDA 5DYIA 2R25B 3RGWS 4LQ4A 5K51A 1AUPA 1Q0QA 3T0IA 5ES4B 3ZW8A 4IWNA 4BU0A 3KTFA 1FTWA 3QBJA 1CDEA 3WLTA 1D4FA 2AFIB 4RL4A 3HMKA 5AXCA 2FF5A 2Q6KA 1QSGA 2IYQA 4N03A 4R68A 4IIGA 3MLBA 4IJUA 2COUA 1ODJA 3KKMA 3MBOA 1LBSA 3UAVA 1VLVA 2IU0A 1C8LA 1EGAA 2XOKD 3DM5A 4LZNA 3V34A 5MDHA 1WXEA 4MRSA 2MYPA 3EFEA 4F9EA 2ECOA 3GRFA 3M6WA 2BFCB 2HRRA 2VDVE 1TCCA 2AX4A 3UPTA 1V6SA 2B0JA 3NDPA 4CKXA 3PUWA 4UJ3A 2V7UA 3HCCA 4MGEA 1FDIA 1KY2A 4Q82A 1YNSA 5HG0A 1BHJA 2P2SA 3EDQA 1Q3HA 2QHXA 3GLFB 1QG0A 3VDNB 4CW7A 4U2EA 2V74B 1HYEA 2VPPA 3QHQA 4IKPA 4MUMA 5BQ3A 4JJIA 2DMRA 4TZ6A 3GRAA 3OCCA 3FDZB 3VVLA 3F3YA 1FZTA 1TJYA 3D7MA 3ZK7A 1OBOA 1R18A 4ZI5A 4CCSA 3DTVA 1C0KA 1L6RA 4GVXA 2H48A 1COWD 2VUHB 3DBLA 3N7UA 3PIDA 4G63A 4MWZA 4O4JA 4JLSA 3V00A 3U62A 4FFBA 2ZE6A 3Q3HA 3RAFC 4BO6A 2BZ0A 5K3OA 2G7MC 2PUFA 1Y7LA 2XDAA 1E7SA 4UMEA 1PBTA 3UGKA 3PGMA 4ARZA 4DA8A 5CFLA 2ON6A 5JW6A 1G18A 1RI5A 2NO1A 3DOHA 3LV8A 1P62B 4X3PA 1QHIA 4K1LA 4R9NA 1RZRA 1SG0A 3NIWA 3G8AA 3GK3A 3VO9A 1A27A 4K2HA 3BTVA 1YFJA 1VLJA 3EQ8A 2AJCA 2QP9X 2EJUA 2A1UA 2V59A 3K9CA 2Z08A 2XA9A 1XJQA 1Z13A 3DE1X 3KUCA 4JI3B 1J42A 1IBKB 5F4ZA 1J0AA 1J8YF 4DR6B 3ZS9A 4AF6A 4DCNA 3WLIA 3RSQA 3O8RA 3HA2A 1D1PA 3W79A 2GHIA 3CJQA 4R9RA 1Y8RB 5KX5B 2ERCA 4ZVMA 2IH4A 3BWYA 1QRSA 4FUTA 2R8YA 5CX1A 1GL9B 4QQ8A 3V48A 1FDTA 4TS9A 3WYGA 2QUJA 1NVXQ 1FL9A 1PWEA 5EVJA 3W9BA 3PF9A 4H7DA 3JQ8B 1TAUA 3VQTA 3VYSB 3GFTA 3IEPA 4IFTA 1O8CA 3JALB 1W59A 5E4YA 5IC5A 3RRBA 4C6SA 1T6ZA 3E9EA 1XZIA 3W90A 4CT4B 3Q3CA 3LPLA 4XSVA 1DO0A 1IPFA 1BMDA 3ICCA 1RKVA 1K8YB 2G04A 3EFOB 3AUUA 4PS0A 1M67A 1P2BA 3VX3A 2QYHA 4KFSA 5F73A 1SCUB 2GT1A 4UW9A 3Q7QA 5TQ2B 3KU4A 2PS9A 2HXGA 1HG1A 3A7EA 1U7UA 1SD1A 1BNCA 3CEMA 3DO5A 1QH9A 3I4FA 3LZCA 3OIUA 1X74A 3UAYA 3VPDA 4ER5A 4QFMA 5BSTA 1FNCA 2W71A 1Y1SA 4AJKA 4JDUA 7AT1A 3WA7A 1JA9A 1EE9A 3MBIA 2ZR7A 4FR0A 4PGHA 3IAM1 2I6QA 1L5OA 4QDZA 4HYEA 2W2VA 4E03A 1AD2A 4I50A 2PX8A 5HQTA 5C37A 4XUDA 1YJ8A 3D64A 1C7QA 4WCVA 3CSUA 4DCOA 1ZMOA 2C5BA 3G2KA 2NUTB 1CDDA 3T0GA 2OQVA 1ZONA 4GPZA 3IP5A 3QPBA 3DXYA 4JI6B 2V3WA 3ZZNA 3QTTA 2GH1A 2XE7A 3L7LA 4H31A 4WLOA 2J9FB 4AULA 5EMMA 2C58A 3PQ6A 1VHQA 3S70A 4ZZ1A 5CT9A 2JJMA 4LC9A 1JDSA 4WESB 4I4IA 3SICE 1YAJA 3OQ6A 3MJSA 5FWDA 1D1SA 2GN1A 1RI1A 2V8OA 4JQZA 2AF4C 2WF8A 3V8PA 4DMLA 4WE3A 4QJIA 2DPLA 4Q00A 4EBFA 4EG4A 2VTBA 1PDWA 2R62A 2F1HA 2MIIA 3M83A 2FG7C 4FQ7A 3QMWA 1V8FA 3D3WA 4I5FA 1CQPA 4DRXA 1WHTB 2RI0A 3CEJA 4QDUA 3QITA 1B8NA 1G4HA 2C2OA 3D8HA 3KZOA 1KDOA 1CX9B 5EUMA 1HNWB 1SUSA 3WYCA 4F2DA 1PGPA 1FSZA 4P7KA 4HPJB 4E2XA 1RWMA 4NBRA 4D4KA 1GRNA 4OCZA 3G2JA 3DV2A 3T1HB 2GN0A 4X1IA 4HDQB 2EIXA 3AIMA 2IHKA 5IJWA 1J99A 1ZICA 5FFNA 5JD5A 2ZBRA 1N7HA 2TRSB 4CKEB 1RXVA 2Q41A 4KXVA 3REOA 4Q6BA 5E0KB 1GPLA 1WPGA 2OG2A 4LOKA 2J7PA 5AI5A 1Z25A 4HXGA 2P75A 2V45A 3T5DA 5F7JA 3QTBA 1JX6A 1A8SA 4HLNA 4YIHA 1UEIA 4G0VA 4JU8A 2ZS8A 3WMFA 3HJBA 3CPEA 3WX0A 4HK4A 1A8PA 4J6EA 3PG5A 4IVRA 3IIKA 1G19A 1H2FA 1ZHHA 5K0BA 3AEKA 2JLRA 5EWMB 1OV6A 1UXIA 4QEDA 1NLYA 1E66A 5JS7A 3LUDA 1OH8A 2BGGA 1XUOA 4ZIRB 2X9VA 5L8VA 2GJSA 1SUEA 4HN4B 1NSFA 1ZGHA 4I5DA 5TSDA 3SF8B 3P32A 2XY4A 5JPIA 1T4BA 1FJGB 2CLFB 1T8SA 5A7FA 1Q15A 2XNDD 1VYVA 3G0BA 3KZXA 4CR7A 4EHIA 5JY6A 1O94D 1XZNA 2HPAA 2ST1A 3BGOS 3QVOA 4EG3A 3PUHA 3R7FA 4LG1A 3HDYA 2PRSA 3HJGA 5TX7A 4R9SA 1VMIA 2IA5A 3NHAA 3PFWO 2WAMA 3DP7A 1GARA 5ALHA 1XWWA 3H2SA 1TMGE 4ZDIA 4CHTA 4GPEA 3B6MA 3T06B 2Z1DA 3W4KA 2HTEA 2PLRA 2JDID 1GXSA 2YYYA 3K0AA 2OB2A 1SIOA 4B83A 2CYCA 3GFQA 2WG2A 3DFZA 1IHXA 1SFRA 1ZBDA 1M1YA 2R6HA 1UP6A 2IPOA 3NJ4A 4WA8A 6NULA 2FSUA 1OAKA 4U7PB 2R96A 4GXNA 4NI5A 1PSZA 2WU8A 4DWWA 3L0BA 3T3NA 1GUDA 4RMJA 2XDWA 5JH7F 4EP1A 1WV0A 1YK1A 3KBOA 4NE2A 2OXEA 4ZXPA 3TOSA 1N5MA 3DGEC 3RH0A 1BW9A 3IQXA 3R6DA 4MWTA 3ZY4A 3GLHE 3N6VA 1BOOA 1U3CA 2O2XA 1PQYA 1WW8A 2ZJBA 3EEYA 3JCZA 4ZIRA 3QFTA 2CN1A 5JI2E 3U44A 5IDQA 1JIUA 4QHYA 8LDHA 3L8DA 4RFSB 1QQAA 4P32A 1GN9A 1PJZA 3DEKA 3IUJA 1P72A 4ZYZA 5HBGA 1VCHA 1EDBA 3W2IA 4CMCA 4RACA 1JUDA 5DBEX 3R5TA 3TXAA 1Y1TA 1YA4A 2HCTA 4ZU3A 1N2CA 3UATA 1NQAO 4AJ2A 3E8MA 5FWNA 2HT1A 4WASA 3RABA 5FR1A 4MIKA 2HXSA 3QNWA 3NHFA 1WO8A 4WOBA 4ZHQB 2PUCA 1C1YA 5GQSA 2X7HA 2IU6A 5K3AA 4BAZA 2JHCA 3EEQA 1WDLA 3R09A 4GIBA 3CZ5A 3TGWA 4LYEA 3EW7A 3MRVA 4JLOA 4LJSA 4YRRA 1RRVA 4MSUA 4KVGA 2OFFA 2GS9A 3SEQA 5LXTB 1BQ4A 3EVGA 2OD9A 5FFMA 3E9CA 3W1WA 4FR5A 1JHXA 2EFDB 3MSCA 1K4YA 4TN1A 5EXSA 1NQTA 1Z4IA 3MWDA 3L6RA 4S1PA 4UNPA 1MP0A 2WW8A 1XP8A 2BZ1A 2WJ6A 1LDGA 2JZCA 3HBJA 4G5GA 3O82A 1H0KA 1GFWA 1LW7A 5K3FA 3UY4A 5DMXA 1II0A 2P5UA 1KIMA 3DHNA 3EPPA 4L6AA 1Z9BA 2CF6A 2JIBA 1RWKA 2ZJ3A 1C3XA 1K27A 2NACA 4NLLA 3VJMA 1U0GA 5K0JA 3CBGA 3A26A 3EZLA 4AJPA 1J20A 3RC7A 1FW8A 3OWHA 1UOPA 3P2IA 1W4LA 3N5KA 1WSWA 3WGLA 3WKDA 3VYRB 4EA6A 1K3UB 3GLQA 5GVRA 3D02A 4WK0B 2QXYA 4KDEA 1GZDA 5DXJA 2Y2VA 4CTKA 5ICSA 3SBOA 4EMTA 4MVJF 1VIDA 3OZDA 4HLUA 4JZKA 4AZVA 1SVWA 3W2EA 1U81A 2QNBA 2W11A 4Y2JA 4AFNA 5AP9A 3KDSE 2HSGA 4RX1A 4U3JB 5HXAA 3Q0EA 1PE0A 3C6BA 5FYQA 4C4TA 4CYMA 4BY9E 2P27A 3NIFB 3U48A 4E07A 1XZFA 4NBUA 4Q4AA 1AF7A 1CP2A 4MQMA 5K0FA 2AXEA 3ZCRA 5J9FA 1B23P 1P1KA 1HYHA 3D6NB 1Z0ZA 3F5FA 3L1HA 4FGJA 4N5MA 5CH8A 3SIPA 5K8JB 2YV5A 4Q7QA 4YS6A 3R2JA 1JT9A 3H2JA 3ZLBA 4DARA 3VNVA 1P2SA 1K86A 1UPBA 4DJJA 1EQ2A 1ZX1A 3IKLA 4ODIA 3PNPA 2IDKA 5E4FA 1OXUA 1W5EA 3QLUC 5ALQA 2H4YA 1GP2A 4RKYA 2VP4A 4A8HA 2BH2A 1X2BA 1W2WB 1II8A 3MWFA 1NW7A 4PLCA 2CDBA 4R7GA 2H1HA 3T3GA 2ZM6B 1PSDA 1DIBA 3EVBA 3FD8A 4B6FA 1Z47A 3B5EA 3SF0A 2I91A 4PHCA 4H7KA 1A2OA 4RDHA 2L69A 1G5RA 4P38A 1G17A 2AR7A 4RPGA 4TYMA 1HLFA 4Q9IA 1VECA 1BGVA 3WA6A 1CY7A 3PXBA 4L22A 1MEEA 1DGQA 3AEQB 1J23A 4LE0A 1J0XO 2H0QA 1SZJG 2CCJA 1TYZA 3MCVA 3PNLA 3WLRA 3FIJA 1A7KA 2NG1A 5JXIA 2BI4A 3PDHA 1VLLA 2V4ZA 3E9DA 5HBRA 1KEPA 4B9EA 2W93A 1ECBA 2ZYWX 1RRPA 3C6ZA 3I9NA 1XDWA 1ZC3A 1B1AA 2VSQA 1AQJA 2WSIA 3WMXA 3ISVA 3RHTA 2X13A 4CLOB 1BGWA 4GX2A 5DE3A 4A4DA 3NDRA 1IB6A 5KOIA 4JOQA 3HH8A 1MX5A 5CMLA 1P5RA 1VL0A 4JN6B 3Q7TA 4N5NA 5HWSA 4S2EA 1LI7A 3SC2B 1KAEA 1QGUB 1DIHA 3FIUA 1Y5IA 1ISSA 2I76A 3KOZA 1F6DA 3ANNA 3NATA 3ORRA 4M9XA 1R0ZA 2HH9A 3VNQA 1RACA 3DR5A 2I3DA 1I3LA 1QOZA 2XVMA 3SHTA 1XMIA 2FDXA 1RS0A 3DBLB 4MVWA 3VPFA 4Z3OA 4JC5A 2CFCA 1XD8A 3GDOA 4HB4A 1S7CA 5TQ0A 2PANA 2GBIA 5BV1A 4MR7B 2E9SA 5HJ7A 3LUBA 1RYDA 2NOAA 3V2IA 2AGVA 2Z04A 3TE6A 4D44A 4H4DA 3UYLA 1KVSA 1E9RA 2C3PA 2FPMA 4RK5A 1T8YA 2L42A 5JMPA 1MQSA 4G67A 4X1KA 2ZUDA 4RF5A 3KUDA 1L5RA 3RTAA 4F21A 3TQCA 4BGEA 3LJKA 3AWIA 3B9PA 4U02A 5C31A 3V7NA 1XMXA 2C7GA 3HABA 4KQMA 2EKQA 1U0HC 1Y6RA 2QLFA 2YY5A 3CUUA 3JALA 3LYLA 2PUTA 3QLJA 1H3NA 4LXYA 3UW3A 5A5FA 1ZH6A 5KTYA 1V35A 2FEAA 2K2QB 4OV6B 3AVXA 4O2BB 2FRDA 2X8BA 3MT0A 1CW2B 5FF9A 2BONA 5LFAA 1OPXA 4LZLA 3I6IA 5HEKA 1RRCA 4CL0A 3I76A 4B6RA 1EWYA 1R4AA 2PVPA 4L28A 5DBIA 3UKJA 4DUGD 2XDYA 5KSWB 1JTEA 3ND5A 1OBHA 3DMDA 4FCCA 1VHJA 2ZATA 3E15A 4EDFA 4NU0A 2OAQ1 1BX0A 2ZYRA 3COVA 3VR1A 4LJAA 4FZVA 3ZWYA 1KFJB 4AJOA 5JZOA 4WHMA 3K2QA 2DWCA 2HA5A 3HLYA 4PAMA 5DEIA 5HCIA 3WJAA 4YP1A 2BSQA 5KYUA 1NJSA 4QECA 1E20A 4GSKA 4BFXA 4GF5A 5AO9A 4YRSA 5KCZA 1I7QB 3R7NA 5GTDA 4HH1A 1RYEA 2WT4A 3ND7A 3K5PA 1ADBA 1FMFA 3UT5A 1XD2B 1GXSB 1CVLA 2Q1YA 4NZNA 3EGEA 2P4UA 4PAQA 5TGDA 1A50B 1M1NA 1USGA 2QV7A 2B36A 4L9WA 4OQ4A 4GYJA 5GONA 2PZLA 3AW8A 5ENVA 5IT4A 3GP3A 3I2KA 5LLSA 2FRDC 2WPDD 5IUKC 1J8DA 1SN7A 1GSIA 3DT8A 3MOIA 2AN4A 2ZU0C 4BEWA 5KOHA 3QBVA 5BUQA 1CZLA 3R3XA 3WGVA 1W9MA 2BV3A 4RPCA 4A2WA 2C4NA 3CX4A 4KEAA 4WJLA 2WB2A 4YRQA 2Q1TA 4M88A 1Z62A 5CW2A 5UKDA 3RRXA 3NHPA 2C3YA 2J5KA 2XX3A 5CT6A 1BDBA 1MN6A 2NYUA 4MRMB 4PC2A 5JMOA 5EEGA 2P9HA 1R12A 3NB0A 4DIBA 1QRUA 3RTCA 1E58A 4IYJA 1UC8A 3GH1A 1U3FA 2FSFA 5HZHA 3TZHA 1M2EA 2GTHA 3ZNQA 3PRJA 3A6PC 1CRWG 1MTZA 3TB6A 5IP5A 4P4GA 2NSYA 3LC7O 4QOHA 3RS5A 3SM9A 1A5TA 2ZIAA 3HJUA 3ZWPA 3WC4A 2OT3B 3M1YA 4YJHB 1EFTA 1MAUA 3DONA 5LQSA 4A8PA 2FE4A 3EVCA 1TIPA 4AJ4A 3P5SA 3VOSA 4CM1A 4DT1B 3KEGA 4KX3A 2BGMA 3I5UA 5AKGA 3IBFA 1XD9A 3K1YA 4II7A 1QH8B 1YZKA 1SD5A 4AZ3A 4B3RB 1EK5A 2HLPA 4LNUB 1QIIA 4Y2SA 1E2BA 2PMBA 3BBLA 4D3SA 3EXFB 4UAGA 4A73A 4GLLA 4ZVUA 4AP9A 2DUMA 2BKVA 2EW2A 2QL7A 3E0QA 3GHYA 3HCNA 5EKUA 1AHHA 2Q3MA 1ENPA 3K70B 1F5NA 1MJHA 3BIXA 4C0WA 1L7AA 2DQKA 1GTMA 2GZRA 3GUHA 1MO5A 3JWEA 1PVDA 4Y6QA 4L6IA 2JLVA 1H69A 3KTDA 2Y0CA 1ECGA 1NW9B 2J3JA 3CVJA 3QWBA 3H13A 2ZUVA 2G88A 4BWYA 1WXXA 1UXOA 4LXXA 2O14A 1P74A 4KWCA 2ECQA 1HE2A 1FC0A 3F7MA 4W9NC 1OLXB 5JAIA 1MC8A 3ZVKA 3ZGNA 3L8EA 1K8QA 4F4JA 3QEKA 1P4AA 2EJWA 3E3NA 3RSZA 1MV8A 4L95C 1Y1RA 1RRKA 4F4HA 5C7YA 1B76A 1P9WA 2YN0A 4M83A 1HY3A 2IIQA 1E2UA 2F3TA 2OAEA 3AI3A 5FA8A 4AK9A 1DCTA 5BSMA 4KIWA 1RAFA 5C7IO 2XUQA 4JT2A 3RQSA 2FWNA 5CRIA 3WLHA 1BAPA 2BKEA 2JEYA 5JZVA 1HR0B 2QTNA 1NSTA 3RT7A 3T3IA 5EKDA 1N34B 3G5TA 2FPRA 2R8ZA 4Y7DA 3ROFA 5CYGA 4ZTBA 1PQPA 2FZVA 1KEZA 2GNAA 2J87A 2QAGB 5B1YA 5HPYB 4BAUA 2YS7A 1Y7PA 3ZNPA 5FEUA 3TECE 4P8RA 1Y4UA 1IY2A 1QGED 1SCAA 2GZ1A 3K8OE 1H2RS 5DHTA 1O2DA 3WIDA 1P60A 3I73A 2P6UA 3AF5A 4UM7A 3WVNA 5H3LA 1JG7A 5CDFE 4DB2A 4IJ6A 4CUZA 2HO4A 2XNKA 3FPJA 4IXNA 2GAIA 4GGMX 5FL3A 1ZXXA 2CNBA 2Q2NA 1UCFA 4YT4A 2JAWA 4YV7A 3OJOA 1BG6A 1N32B 1EINA 1E5TA 1N2BA 1Z5PA 2WYOA 4MVJA 4QYIB 4CLDA 4GU5A 4JUCA 4LIPD 3DMFA 4HYYA 1ZQ1A 4JUIA 4RENA 4HS9A 2QGNA 1BWSA 5M29A 4MDFA 1ZR2A 2IZ5A 1QFYA 1ZM2A 3K92A 4RESA 2GFQA 4BBAA 2JBWA 4I4TF 2J1LA 3DQQA 3GQBB 3OHSX 3QX9A 5EKSA 3DKPA 4M89A 2HF9A 3TLMA 2DWOA 1DHTA 1JSRA 1L4HA 3OCVA 5CNMA 2Q9AA 2JAPA 4RO0A 3UQZA 2OWDA 2Q2QA 4D0RA 1SA0B 4I3FA 3H1FA 1XEWY 5AI0A 5KREA 4PWZA 4V03A 5EIFA 2JIPA 5BN5B 4DLBA 4JLJA 3AEQA 4X7RA 3L4JA 4HB0A 4DMKA 2DPMA 1MAVA 1G21A 3OEHD 1PWYE 3E7DA 4Q1BA 3S1LA 4XR4A 2FPGB 3KZCA 1DX9A 2VN8A 3VZBA 1KI9A 2M1ZA 2Q3HA 2ZJAA 1G2QA 3O26A 1UBMS 3ASZA 4S35A 2NUPA 5YASA 1K4KA 1XU9A 2QSUA 3QVMA 1XMSA 1V5GA 5HKAA 1KYZA 1U98A 1NJ5A 4BE4A 1QZ3A 3HXOA 4WECA 3OX3A 1GFSA 4E6PA 4TT3D 4U9UA 4WUTA 4ISBA 1GNVA 4MVJH 3GJ3A 4A2QA 1ZL0A 5EE1A 2DFKB 3G13A 1L5GB 2BTQB 4L0QA 4GSLA 3GCZA 5IWCA 4UHKA 5AVWA 5JIBA 4G85A 2PQMA 3OKFA 3E4CA 2JLBA 5T8KC 4YT2A 1T36B 4D02A 5IKPA 1H9CA 2VR1A 3IULA 4MO9A 3T61A 1G20B 3TR0A 3L0OA 1AGRA 2IV3A 5IC6A 3ZOKA 2MOKA 1WZEA 1I2CA 2ES4A 2ZFUA 2ZWVA 2ZUTA 2ZT8A 5SYMA 4EGQA 3ZJVA 4JR0A 1CUDA 4QUAA 2CVOA 3ZY2A 4GPBA 3RLIA 5H1YA 3FPLA 2HKIA 1VIAA 2BI8A 3B70A 5IARA 1OJ7A 2ETVA 5FPTA 3CINA 3UICA 3GPBA 3KWMA 4KN5A 4ENQA 3ED1A 1TJPB 4DYHA 3FRIA 3HUFA 2AZTA 2E82A 1V3QE 4PHHA 4YRMA 5DNAA 4DPLA 2WSBA 3VJKA 5I47A 2C1ZA 5D01A 4J6FA 1QBKC 2OHXA 1VPTA 3V1UA 5LDHA 1Q0UA 2CCGA 4LQCA 4YYEA 1TUEA 4FZJA 2P5YA 3R6WA 4TRJA 1QH8A 4TL7A 4E32A 3G23A 3C5HA 2PT9A 3K32A 3GA5A 3KRTA 1XWFA 3ND9A 1D3AA 1SIBE 1XCLA 1ZK2A 2R1UA 2WSYB 3HA7A 3QY0A 4PGAA 5EGSA 5FQNA 5I9TA 4PV7A 1GG5A 1LDMA 3DL7A 2MR6A 3CONA 4UBNA 4H2DA 10MHA 2Q1SA 3IR7A 1KQ3A 3I2IA 2Z2XA 1UOQA 2D2FA 2VXYA 3FKQA 3L0SA 3O6VA 3ZNNA 1SBHA 4ZQCB 1FTNA 3GX1A 1Q3KA 3EA4A 4JSYA 1YF3A 3QXSA 5C5DA 3FTEA 3FKSD 3I9KA 3V4FA 3B82A 2VSYA 1N6OA 4FEEA 3RAPR 1DI0A 2AFIE 4O4HF 1IJKA 1VBKA 2CC2A 2E2WA 2DFTA 2AKEA 2B8WA 2WOJA 1RC1A 3L7YA 4GOJA 4W8HA 4WOCA 3OM1A 4QTUB 4GWGA 3T9AA 1PX2A 3VU9A 1W1IA 4FYIA 4R8LA 2VJQA 1VJ1A 1U2ZA 1C9EA 2P41A 3OOYA 4ITVA 3ZHYA 4EYEA 3A05A 1L7QA 3E58A 4G23A 2R8XA 1HYGA 2XQGA 1BD4A 3TLCA 4M7WA 4QRIA 5G2OA 4ASUD 4MB2A 4BQPA 4PW0A 4NQZA 2FUCA 4TLCA 4BHTA 2WMOB 1I1NA 2ID7A 3C3YA 4M9SA 2RKBA 5IEBA 5EJ9A 4NMWA 4RV9A 4UU8A 4TT8A 2IYYA 1YKFA 3N2GB 3TWOA 3ZZTA 3JATA 1WXHA 4BVKA 1CQWA 1XTVA 3RIXA 4FN5A 2BFNA 1VM6A 1BYUA 2GM9A 1IUKA 1SRRA 1KDYA 3VR3D 5FD8A 2BGIA 2FZGA 2D3TA 2C96A 2O3TA 2YXBA 2BIFA 3KTAB 3AQ4A 4KJXA 3TBFA 2SHKA 4OB8A 4Y2TA 4PC6A 4ETNA 5ITZA 4OIFA 1D5CA 1IUOA 3LS2A 1EYZA 1ZN9A 3S2EA 1HKUA 4XJXA 3LOUA 2DT5A 2ADFA 2XRYA 3MRTA 2OO5C 1B73A 4KI0A 4UMFA 4ALJA 1ESNA 3AHDA 4E1AA 4WKBA 4XW2A 4HQKA 1GM5A 1CRZA 2MINB 2YR0A 3NWOA 2XT6A 4BZZA 4C21A 3AJ9A 3JSXA 6REQB 1E1NA 2P11A 2ZRMA 4JEUA 1AGXA 2A8YA 3TKYA 2IS4A 4C7OB 4Q21A 3AB3A 1ZJ6A 1NMEA 2CXXA 2VKQA 3I92A 4IDDA 4O4LA 3R24A 1H6DA 3EGOA 4O1IA 2GAAA 4QGSA 3PA8A 4ZVKA 2VSOA 4Q7KA 3NV7A 3ZDZB 3T1YB 3TG8A 1XQ1A 2SNIE 3DOOA 3EDRA 4BMCA 3DJYA 3NBKA 3TFWA 4ZRDA 4ZAWA 4FX5A 4F1JA 4IHJB 1UPCA 3GRPA 4Y9RA 3L8YA 3GLHB 3NRBA 5DGCA 4C4XA 4DG8A 4P3XA 1UMDB 1RZRD 1Q6YA 1GL7A 3I2FA 5E7IA 4EGAA 4G9GA 4AJLA 3H16A 2AG5A 2WEKA 1MBZA 4Y30A 1J9ZA 4MTLA 2CHFA 3O03A 3ZIAD 4GMHA 3A1CA 2BAGA 5CFZA 4XSGA 5EMNA 1X94A 1IM2A 3DKKA 3KHKA 1JAZA 3NORA 1W581 3RF7A 1X8XA 3G89A 3BGWA 1YB5A 3NH9A 4LYHA 1AQ6A 1X7YA 4G3XA 3VHXA 3EG5A 4Q3CA 3EA5A 3JRXA 5EKTA 4AX8A 4IQ4A 2IBSA 4CEHB 1GGEA 1I3KA 3B12A 4YBRA 1CJMA 4WX2B 3PFBA 4HNUA 4X91A 3U4AA 3F7TA 4UPDA 5ECWA 3TSWA 3VC3A 2E4VA 1DKUA 4EJ2A 3PUVA 2G6TA 2A0UA 4WFIA 5E38A 2PKYX 1KYTA 3QV1A 3FCCA 3ODGA 2H08A 3QKSA 1LPPA 2IUTA 2BFDA 5E2BA 2J5RA 3PEFA 1Z22A 3HFGA 1GRQA 4KE9A 3M6AA 5THXA 2QUIA 4ZKDA 4MP8A 5K99A 3KQLA 4XWAA 1C9KA 3C5WP 2IXBA 2QW8A 2W6ZA 2I4OA 1WNTA 1RC0A 3NKVA 4BQOA 4O25A 2BF4A 4UJ5A 4HZIA 4BX0A 3FJYA 4WXEA 3T5CA 2NV0A 4CVNA 4HQNA 4TVOA 5EZ6B 3PFGA 1PZFA 5BWBA 4CZ2A 3IKTA 1TA4A 3DW3X 2V54A 4DLVA 5AW7A 1EDDA 3C14C 1FTGA 1V71A 3I12A 3UCFA 5B4TA 2R79A 1P5HA 3JQQA 2HT6A 2J0UB 4V2IA 5AUNB 3OZCA 3GQBA 4DLPA 1RE1A 1PKEA 3L0CA 1F1BA 4MGIR 1SUAA 3CLSD 4EUNA 1J56A 4EITA 1Z36A 2Y2UA 3I9MA 2GHRA 3FWZA 3VVMA 4JC0A 2GCEA 2CLLB 4OXIA 2DB3A 4DE5A 3J80A 4XDYA 3ACCA 3W1EA 2QYSA 4MYCA 5GJCA 1ZEJA 3ZS8A 2VNAA 4BP3A 4BFCA 3KXDA 4FILA 3PC2A 1M76A 4MPPA 1J2YA 5FR2A 3ZVLA 3Q72A 2G8NA 1PWXA 2IEGA 2DFVA 5TQ2A 1MGOA 2YQ5A 5CLJA 1AHIA 4H9GA 1J0DA 2RARA 4Q4AB 2WAAA 4DVJA 4K7JA 1QPBA 4AMVA 2NZYA 1Q95A 4J2OA 4QHTA 1HLGA 1E2PA 2IT1A 3GROA 5DYWA 1YJQA 1M7GA 5JOQA 1UAGA 1IONA 2OV1A 2WSLA 2PS3A 3BMQB 2V9ZA 3F4LA 5K6AC 3INNA 1KDVA 3NAMA 4FC6A 1ZIPA 3DNMA 4XQCA 2G71A 2O0KA 2G77B 4L50A 1KAQA 4TN5A 2XQKA 1D1TA 3ESCA 5NLLA 2GASA 3SS8A 4KNWA 4NTZA 2A0XA 2IZ7A 3FMIA 5LNK6 2C0PA 2ID9A 4RCVA 1KI6A 4FR2A 2P4HX 1JA0A 3C6MA 4HDOB 4F2GA 2UVQA 3TEJA 1KERA 1CUUA 1CE8B 1P61B 1WP4A 1OI3A 3ENWA 1E62A 2I7TA 4JZYA 5IVDA 5K0LA 3ZHSA 2B8NA 3LH5A 5FBVB 1A4XA 4TM7A 3JZAA 1IVNA 3L4BC 4JI0B 2GBGA 2ZREA 4IIEA 1H2HA 4M38A 5PGMA 5ICEA 3IT3A 1XNRB 3C3PA 4YC7A 4GBGA 1CUXA 1UFRA 3RNOA 1GZ7A 4NS1A 1TKBA 2V58A 1Z4MA 1S8AA 4GICA 2GOYA 3C1TA 1I4OA 1JKJB 1SKYB 1D0IA 3LX4A 3T6KA 4GZMA 4O4LB 1RAAA 4WERA 5KYUB 5CFQA 3PQ3A 1EUYA 1UXGA 1OWPA 3MJVA 4LWPA 1TM4E 1UODA 2GYVA 2WV9A 3LYUA 1EUCB 4P4NA 2W4IA 4QGAA 1JIQA 1WBDA 3OY2A 3KXKA 4XH9B 1WETA 3EW9A 1RBMA 2CJPA 3KVVA 5IDYA 4MGZR 2HCRA 5EI5A 4Y2HA 4TWIA 2A14A 1Z07A 3GYGA 4I2VA 5A5VA 2VT2A 1T5BA 1SVIA 4AN1A 1O87A 4MIEA 3WLSA 4URYR 2VO1A 3SDSA 2BE9A 4AIRA 1EXWA 4RTLA 4EPTA 3DEZA 3WXBA 3DE0X 1D6MA 3HN6A 1KDRA 2FN4A 3PXXA 4RV5A 3RS4A 2KS6A 6PFKA 4EJSB 3RVMA 4BO4A 2QI9C 2Y1LA 3N59A 3KR9A 4H1TA 4PZYA 5B37A 2G9NA 3OQJA 2OHGA 4PNZA 1PJ3A 1KQGA 3U5TA 4CEIB 1DFIA 2CYAA 4J0CA 4F7DA 3SEZA 2QN7A 4QPDA 3F3KA 3I6QA 4N3GA 16PKA 5GIOE 3EDCA 2GF9A 3HE3A 2GBPA 4JEHA 4WKGA 2OLEA 7MDHA 5KWEA 5LQJA 3RC8A 2D1RA 1FFCA 3LP6A 3UJ3X 3EQ7A 4B7UA 2I62A 1V3TA 3PICA 4R1PA 3SQNA 3WQQA 2F3QA 5B7PA 5HF9A 2B4AA 1O6ZA 3GG9A 5BWCA 5L45A 1ZI8A 3DR3A 5IASA 4EF5A 1E2MA 4Y2GA 1EVLA 2QAIA 3EGVA 4YPVA 2DCUA 5FWYB 1M1NB 1XTTA 5T4FA 3T12A 5LOVF 2I7DA 3H5TA 1AIPA 1VLQA 1WWKA 2NT3A 3BEDA 1NKVA 1U8YA 3BRWA 3W7VA 1TYDE 1WCV1 4GNRA 5MN4A 4OXYA 2GHQA 2PR2A 4QBHA 4LGYA 2QZSA 4B0OA 2ZBEA 4PGGA 1AB6A 2OHOA 1E6CA 4U0KA 4FI3F 1E6WA 3AHGA 2O6HA 2IRWA 4BDSA 2OK8A 1AT1A 4J7XA 4YLGA 3JQ9A 3TIFA 4JYMA 2C7OA 2L82A 3M82A 5IKMA 2A3RA 2XUGA 3KJZA 5ESDA 2XZTA 4B6EA 3DCYA 2CFOA 2VPXA 5BVGA 3RWOA 3G2OA 4HNAA 5ELLA 4BWGA 5BSKA 1VTKA 1Z2DA 3EZYA 1NP6A 4RZSA 2BPOA 2OFOA 3F8SA 4KFUA 3KSAC 3DBHA 1ZMBA 1MZPA 3L6EA 1JYSA 2G3YA 1UJCA 1YQEA 2JCGA 4QYIA 4B3GA 2HQSA 2WU3A 3HVUA 3ETGA 1Q7BA 3M5PA 4LKOA 5AKYA 3RBZA 4ALIA 1UDAA 3PEEA 5ISMA 1ZGZA 3LGAA 1V47A 1FXWA 1KH3A 1SVNA 4X41A 4R51A 5J4KA 2RI6A 3AU9A 3L1IA 3DA8A 4RVHA 1DJQA 4LJ9A 4YCAA 1VSQA 2G5GX 1F2VA 4YAWA 1Q1GA 1T9ZA 3B52X 1E6KA 1PR4A 2ZRPA 2DBZA 2EFHB 1DOAA 5JNWA 1P1FA 1OHHA 3WJ7A 4RL6A 2J8ZA 4D81A 4O4HA 1OE0A 4L3OA 3LNTA 1EVYA 2BM8A 3MTJA 2PEYA 3KAKA 4R2XA 3K0CC 4Q34A 1ATIA 1YIDA 2JJ2D 1FP4A 2IEYA 1TQDA 4XVRA 4JJ8A 5TEVA 5KOYA 1XR3A 4FXOA 3M4ZA 1QXSA 4X92A 4J8PA 2W6IA 3PQ5A 2TS1A 4RXMA 1RJEA 2XDQA 3CN7A 3DL2A 3EG9A 1SBIA 3R9WA 1YZHA 1LZLA 4KBYA 5JADA 2PXHA 2RI1A 1X7DA 2V65A 3LK7A 3NEAA 4JBGA 3STYA 3VH3A 1FFSA 1N6PA 4D9IA 4F2HA 2FPGA 1Z16A 3DMGA 4I5IA 1UKCA 4OHXA 1KZ9A 1DKPA 5K3CA 3OTWA 3UAOA 3L49A 4AJJA 3W6NA 3KAQA 1Y6GA 5I9SA 4R16A 1E1RD 2G67A 3SMVA 1L7XA 3VR4A 5KYNA 1PVVA 1V5WA 4RFLA 1QGYA 2Q6TA 1QCCA 4JSTA 2I8LA 1N8NA 4RW0A 4UCWA 4XUEA 5I9NA 1N0IA 2LUOA 1G5IA 4OHOA 4LF9B 2ZRNA 3VYWA 4L7QA 2IIPA 3M3DA 3UT6A 2V96A 3WK5A 4PX2A 5HNKA 2WWXA 2XUAA 3AR4A 1G3QA 3EB9A 3IKVA 4I5EA 1II8B 5EIBC 1WE2A 2C7PA 2R8RA 5A6SB 1R3DA 2PE5A 4KSYA 3U7FB 4WBNA 3FH0A 2H0RA 4IIYA 5C35A 1CS4C 3DVAA 4CTNA 4OJYA 2H9IA 2X6RA 4YRCA 5ESWA 4GKAA 1XCMA 1L4UA 3FBTA 4DWJA 4UZSA 2GEKA 4X1IB 3D2BA 3DAHA 5FTLA 1NVGA 1XQWA 4ED9A 3M6VA 1M34E 1J0CA 1K6MA 1Q20A 1PFQA 1U8XX 5HE9A 4RSRA 5CLFA 4LXGA 3C6KA 4A0SA 1LLDA 2XZLA 3B78A 4FWIB 3BK2A 1GWNA 4EW3A 1TYBE 1A4RA 3GJ4A 4GR9A 4L9AA 1Y89A 4S1VA 4U8HA 4GYKA 4U4AA 2FWRA 4F3YA 4CTJA 3PXEA 5HMMA 4LVUA 3Q3VA 1FQJA 1YR9A 2HY7A 3TI9A 4NENB 4F0JA 3RUDA 1JDTA 2OQ2A 4FOTA 1E5XA 1YRLA 1DEHA 4L27A 4M1YA 3UW1A 4FMDB 4DREA 1MO6A 1MRNA 3ONVA 4RZUA 4U7FA 5KQGA 5KWJA 3VFDA 4GW3A 4UNQA 2ZLBA 3UA3A 2FMHA 1CUAA 5CA0A 4F6RA 1BDMA 2ZSBA 2NXJA 3HB1A 4DMRA 2XOEA 1NATA 2ODQA 3FN4A 2REQA 1D5WA 3HU5A 5JE8A 4IIUA 3TDMA 4KVZA 3U13A 2ZIFA 1LJUA 4D42A 1Z5ZA 3T5GA 4C2TA 4HS4A 2BFWA 4U9IS 3AIOA 1XHLA 5CR9A 1BTOA 2GI4A 3M6XA 2J3IA 3A3OA 3CW9A 4UCXA 3FTNA 5HKBA 3VI4B 3ANLA 4MUEA 1FJ2A 4FLFA 8AT1A 1SKBA 2O05A 1K0FA 3S1SA 3D4PA 4ZPJA 2OO5A 5DGXA 1JNXX 3DLIA 1JIIA 1DARA 1LY1A 2RIPA 1C5KA 1DIAA 1TJ4A 2HDOA 4ONEA 1PFYA 2LP4Y 3FZYA 4YGXB 1DEXA 4WNAB 3G0GA 5EXXA 1FDRA 1ZH2A 2I4MA 2JS7A 1J8QA 1GGKA 2KLBA 4F9FA 4IAOA 1XU7A 2E87A 2YIJA 3IBCA 2G76A 3LCMA 4Z9YA 5EG5A 5JRDS 1XT6A 1Z3IX 2VBGA 2P2NA 1A5BB 1KS2A 4WK2B 5LP1A 3UWKA 4MYTA 4J4HA 1SOAA 3DL4A 3GAZA 3W6PA 2G70A 2X8JA 2CFIA 3U3JA 1Y4AE 1KGDA 3T35A 4NBWA 5CG1A 2POCA 4YGYA 4FSDA 5ICGA 3EH2A 4IOLA 4NICA 3UJ9A 5A4DA 1YU6A 1RI3A 5J5AA 4ARIA 1JMYA 3NIGB 3AV3A 2A4MA 2JA2A 2QB5A 4LY3A 3IMEA 2EC5A 2IV7A 3EXEB 3GLGE 3PX3A 3ETDA 4FMCF 4M98A 4ZRMA 4Z3DA 3BFPA 2A59A 2YOFA 3U44B 4IHAA 4P1ZA 1Z45A 1YQTA 2DHEA 2O23A 2GN8A 3W8DA 3X43A 1QS0B 1SOMA 2Q9BA 3Q2OA 1E6UA 1OXBB 2ZI5A 1LPSA 2YWJA 2CXSA 4MVJG 1LSJA 3OIDA 5CA1B 4CFZA 3KOUA 3EH1A 1W87A 1ZIXA 1ESEA 2EVWX 4DR7B 4GRDA 2V6GA 3CHYA 1WA5A 1T6XA 1U2RA 4W1SA 3RYHB 1FYEA 1ID1A 1VPVA 5EXDA 1IY9A 3WICA 4GGOA 4E1BA 3HADA 4YUXA 4BS9A 4IQ0A 1U8UA 2EFEB 3AJ8A 2LBPA 2P90A 2EBHX 3AF1A 2WWIA 5JXWA 4LTNA 3I5YA 2PSHA 4KH1A 4FOSA 4F97A 3AXSA 4ARZB 1UBOS 2QXUA 3DQZA 5AUPB 4EB3A 5IZCA 2CE2X 3W5AA 3DTTA 1F8YA 4WOKA 3ZBTA 2SKCA 4IP0A 4AWAA 2P0AA 4W6ZA 4C87A 2AJLI 1W4RA 3GW8A 4IZHA 3BF7A 2HA3A 5GONB 3SC2A 1OC4A 1UANA 1HC7A 2D7DA 1G2OA 4IUBS 4L78A 4RTJA 1W76A 1Y6QA 4JXKA 3B9BA 2ZYSA 2DBQA 2QJWA 4TS3A 5FBLB 3W0LB 5C1BA 3ZVNA 1NVMB 1KSHA 1SULA 3MQ4A 1I5OA 4UXHA 2XKJE 3D8TA 3K73O 3SHQA 4ZVNA 4OHYA 1E2HA 1RQRA 1TLFA 1N1DA 3OO0A 3IAFA 3F6EX 3ROKA 3RSOA 1F0NA 2HIGA 1CUCA 2QRKA 3TOVA 1I7SB 1NU8A 2J0SA 3LQQA 4QXRA 4PZLA 1YCGA 3E9RA 3ZE1B 1NUPA 4DDHA 3T9DA 4RJKA 4QJ5A 2AWNA 2M6SA 2Z6VA 1Q16A 3PKJA 5I4CA 1M74A 1PZMA 1NI4A 1PW7A 3OZ7A 2NNWB 3SXUA 5BYKA 1T9AA 4HXYA 4K03A 1Z0AA 5I8ZA 1DKNA 3UJ8A 2WZQA 4Q7MB 2VDLB 4ND3A 3EC7A 2RBGA 1BA3A 2XA2A 4BASA 5AK3A 1RABA 3Q5GA 4J7AA 1O08A 2GM3A 1IU9A 2WHYA 4YAGA 3H11B 2XWJI 3I30X 4G01B 4E21A 2NYRA 4YXFA 4KITB 1T4CA 2GWHA 3TM5A 5TS3A 2GK6A 1QB8A 1OCEA 2I6TA 2V03A 3FCXA 4O02B 3T3DA 3V3TA 1N36B 3R74A 1HQCA 4BLTA 3TPCA 5AVYA 2W9XA 1UQTA 1WCYA 4R69A 1Z4PX 3U6KA 4JJKA 4OX9B 1JKJA 2V0GA 1SHUX 3RFCA 2ZJ4A 1R88A 3HO6A 3ISJA 5D6OA 1REQA 3JY6A 4IW3B 5GJBA 3LPAA 2G08A 1O54A 1UM9A 2QM8A 3D0KA 1MQ9A 3WB2A 5I3ZA 1N0WA 2FV8A 3GEPA 4GG1A 4F04A 1SXJC 2DG2A 3O2NA 1NURA 3SHFA 3GIWA 2D06A 5HCUA 4LOAA 4PX3A 2AA3A 2X0EA 3SY8A 3N2NA 1HE8B 5JNSA 3H9GA 3JYOA 1GILA 4IYRA 5EXTA 4FIDA 5JNLA 2G28A 3FCOA 1BDHA 2Y1OA 3OQIB 3Q9LA 4L3VA 2J9FA 1IY1A 4I4LA 4KQJA 4WACA 2YJ6A 4REQA 4PCAA 4EQ6B 1N5DA 3U1TA 2ZQZA 3I2HA 3JSAA 3GVHA 1Y1KE 5BNZA 5JI3E 1L5FA 1TO6A 1Q2XA 2XDQB 3FYCA 4JNCA 4N3NA 4HY3A 2OUIA 1BJKA 3LW8A 4HWRA 3H2YA 1QO9A 5AHWA 3WGUA 2ZR0A 2DERA 4UTNA 3LWBA 3FUCA 4G24A 3S8EA 3FYDA 1B16A 1FP4B 5JPCA 4GDMA 1WXQA 2GCPA 4L5JA 4PLYA 3CISA 4JVMA 2KW5A 3TJMA 4CFYA 4F6LA 4XVUA 1ZH8A 4QOGA 4ZJZA 5LIRA 2QPAA 4TROA 2XQIA 1IMJA 4I1VA 5FDFA 2FZLA 2YWDA 3GGOA 1R64A 3CYFA 2WLSA 4BX2A 4KOAA 1G3IA 1C1DA 4BX8A 4TRNA 4BQIA 5CDSA 2PX5A 2V98A 5IDVA 2FG6C 3TTSA 4KO3S 3EAGA 5A3QA 4MR8B 3V7FA 1OA0A 3FDXA 4UHHA 4OGWA 2Q6IA 4IZIA 4U6SA 1GAQA 2VL7A 3FUTA 3VAAA 2BGRA 2IOHA 1BH6A 2IODA 4K9MA 3OQVA 5AVKA 1PW5A 1XAGA 4OB7A 4UZEA 3DNPA 3ZE9A 4KV7A 4ESHA 4UQLA 3RBXA 2JGFA 4PTZA 3D7SA 2FR0A 4OP1A 5BMVB 3NKLA 3IRVA 3GGPA 1W75A 5HDQA 3D0QA 4JGGA 5JATA 1W25A 1XEWX 5TY0A 5IMSA 4E5MA 2AQHA 1FUEA 1GV0A 1N6LA 1SXJB 2QRJA 2RCNA 4GE0A 3QZUA 4Y6GB 4B17A 1WZCA 2GETA 2JKZA 2ODTX 4JGIA 4KKVA 4RKWA 5LQNA 2QZPA 3NQ41 3ULKA 3HWRA 3DG9A 1KSGA 3DFKA 4BLQA 5A4KA 1E3EA 5KNCH 5LCXA 1T3TA 3AVOA 4ZQEA 3L40A 5CVDA 2PGDA 2W43A 1XRJA 1BO6A 1VLHA 4C1BA 1H2AS 2BEJA 4RTKA 1RPNA 1GT6A 1WBJB 4RPIA 3AUFA 2IS1A 4XGIA 1UWVA 4MH0R 3H3XA 4E5YA 5K8VA 1TO2E 3RK0A 1KAOA 2PMFA 3JASA 1FE8A 2AIRA 5GAJA 3R3JA 4A1OA 4F45A 4Y1RA 3T5AA 1VPEA 1E1MA 3G8CA 4F8JA 1FYFA 1A71A 4EYGA 1VYUA 3JTEA 5FTMA 4C7BA 5A2QA 1DS6A 4RVCA 1F8UA 1RHRA 2JB9A 3GDWA 4WEOA 2GF0A 3TX6A 5T6BA 1JR6A 1M8PA 1VE1A 1YQWA 2EL7A 5FFFA 1KK2A 2JLSA 1UXKA 4EMBA 4RHFA 3JATB 4PSVA 4B3XA 2AB0A 4HUQA 4KN8A 1MJGA 2PGNA 1XTJA 3LOQA 4H7IA 1LTKA 2BEUA 2BSAA 5EYPA 4BKQA 1G66A 4O2LA 5JSHA 1XX6A 1W4ZA 1Q83A 1GKKA 1GPWB 2QZ9A 3A04A 1ULTA 3CPJB 2OCYC 3KZKA 4FFBB 2VCYA 2IPMA 2X6QA 3FYSA 4IKEA 2PWZA 3L1VA 3OT1B 4BNHA 4N12A 1TGYA 4TWZA 3CH4B 4PZPA 4GI5A 2OP1A 2P3LA 2X40A 2ZB2A 3SN6A 2X8AA 1G8MA 5IXYA 1E2KA 5KQMA 1MX9A 1VYTA 4MJLA 4BO0A 1BOFA 1XXHA 3F6RA 2GJ8A 2OLJA 4KFRA 3I3SR 1DDOA 1RBYA 4B6SA 4EMSA 3KPWA 3I2JA 2Y1CA 1CR2A 3JQDA 4HWKA 1UKVY 5LJLA 1E69A 1W34A 1TFUA 5TDHA 4QAQA 1I7LA 1N2CB 2KBFA 5KAPA 1GD1O 4ZZ0A 3SVTA 2ZJ8A 4M53A 4K3UA 2QL6A 1IRIA 1OWNA 1E92A 3LDAA 1H0HA 1LNSA 4BATA 4HVLA 3H9BA 3NTXA 3NIDB 3FOEC 1TZJA 3B36A 3NBMA 2VWQA 4UVEA 1XZMA 2HLDD 4XEHA 1X7HA 2Z2ZA 3ROMA 1XZJA 4EGJA 4C1NA 1GQ2A 4L85A 5BQPA 2RB4A 3VU0A 4CGYA 4CUKA 5CDYA 2ZR9A 3N75A 3SSAA 3T4XA 3R4CA 2JD1A 1Y5NA 2I3AA 2YKGA 3A10A 2FDCA 5JCOA 2P4QA 4HUQB 5D6NA 1OTXA 2CSUA 4DR3B 3OF3A 3JVUA 5DHUA 2BFAA 1E8MA 3DMYA 2Q7DA 1K08A 4OUKX 2LGJA 5A9RA 3P2MA 1P39A 4YDSA 3GEIA 1M2KA 4EVRA 3AZQA 3R7WB 7REQA 5JMTA 3BF8A 1PSWA 4QWWA 1RVV1 1W19A 1YB7A 2HV8A 4LSMA 2KM1A 3U56A 3UA4A 4FMDF 3ME5A 3LCVB 5C8VA 3O3OB 4YJDA 1ZD3A 2F59A 4G26A 5F76A 3B1VA 5KHLB 5MN5A 3EWNA 1QGDA 2AFRA 2AI3A 1GTSA 5JS6A 1ISPA 2HHLA 2EIHA 5A4FS 1Z08A 5DBOA 1JTVA 3EIWA 2XWBF 4YJ2A 4N8EA 1Z35A 1XAJA 4MHSA 2XXBA 5HUHA 3UFBA 3KLOA 5C1OA 2DXIA 3L6UA 3HDGA 5FNVA 4X24A 1FA9A 1NFFA 5AD1A 2CD9A 3ZE6A 4CLHA 2A33A 2J5XA 4D45A 1RQNA 3DZGA 1H42A 1N9GA 3CWZA 1HL3A 5L3QA 5KPDA 4B44A 4RY0A 4RCYA 4XRRA 2ENUA 4CKCB 3FYHA 1YNOA 3PQ7A 1P2VA 4QASA 4OQFA 3RRMA 3GAMA 3H84A 4NCXA 3ODPA 4BC1A 1RAGA 2FFRA 1NIJA 1JLSA 1R16A 1TUIA 2QAGC 2HPZA 2VK4A 1VKHA 2VT6A 5FPSA 1H94A 1U9ZA 2Q3LA 5DU2A 3QPAA 3RHZA 2BSXA 4C4RA 4QIHA 2VK8A 1OI7A 2Z3ZA 4UBIA 2H1SA 2WTAA 1DAGA 1M6WA 1SOWA 4FVTA 4CCYA 4BTLA 4R4JA 4D4GA 4LV8B 1SC9A 2XCUA 2HSWA 4E15A 1JQDA 5AT1A 3BD8A 5CNIA 1BHSA 4YJ3F 5E7MA 4C06A 2SCUB 4YONB 1Z0KA 1NF3A 3AKDA 5DM2A 4XYMA 1J1UA 1GGHA 4K9PA 2GCNA 3TFOA 5AM3A 5JFGA 2GQ0A 2WRZA 3GBVA 4TQ9A 2TMYA 1IMOA 3IMKA 2H7YA 3CZ4A 3I8OA 3NTOA 3PRKE 4P36A 1Q7CA 2XE6A 1YDFA 4LY0A 4XPIA 1VFNA 3R7LA 5DVZA 8ATCA 3A1SA 1Y7HA 3ZXSA 2AYZA 5DNWA 3LHSA 2BEWB 1XZGA 2R00A 1DCFA 3RF6A 4ZAFA 3K0FA 1V1MA 4JEMA 5LC1A 3UJAA 3O1IC 1ZGAA 1VDZA 4BEJA 5KJCA 3Q3JB 1FSPA 3AUAA 3MUEA 3PGJA 4TLDA 2E21A 1N2GA 1B3RA 5JAPA 4ZCMA 3DF7A 3ESZA 1KFKB 2A88A 2I29A 2A9JA 3E9QA 1VA4A 3LXRA 1H0RA 1VSUA 1J25A 1XN1A 3PLRA 4HGYA 3AM5A 3F7NA 1SURA 3R0QA 4LY6A 3ZIAA 1L7PA 3D5TA 4HX2A 1J2JA 1XMQB 4GM0A 4Q9LA 1BX1A 4LOHA 3RUPA 1NDQA 1AX9A 1Q3TA 5CLGA 5K3EA 4TV8F 1QQTA 4DLUA 4MRPA 4ZOLA 4DV7B 3B3QA 2OCKA 2ZRDA 3HYCA 2HHAA 4MW9A 4N7RA 4TWBA 5HJ2A 2QGFA 4KLNA 4M1EA 5TJHA 1XI2A 3G2PA 5I9BA 1V1RA 3U7IA 1J49A 1N1GA 4ZOBA 1LPOA 1F17A 3AKCA 4RSGA 2PYIA 3V5NA 4B48A 5A1JA 2E5WA 1XPUA 1GR1A 4IIJA 2FK7A 3EBOA 4LNHA 2ZANA 4XE5A 3WBKA 4BFUA 4WKCA 1F9EA 1PG0A 3O4HA 1O6GA 1QVVA 2IZ6A 2NUPB 2NTYC 4OGFA 3MWJA 4TMZA 5AI6A 3X0DA 2H4XA 1RIIA 1JEEA 1YTUA 1SUCA 3TQTA 1CUJA 1WW3A 3FAZA 3NTLA 3ZV7A 4HB3A 2VZ0A 1H6BA 1SKQA 5DTQA 3ZE7A 2NGRA 1QFSA 1WB5A 5LA6F 4PLPA 4PEVA 3PS9A 4BNTA 4BPBA 4MR8A 3AZPA 4E2YA 4EHFA 4K81B 1TNDA 3ECAA 1DADA 2FZ5A 5GZ3A 2X2OA 5B53A 3SJZA 1JG1A 3V33A 3WWDA 2B4KA 1IWOA 1O58A 2FSVC 5F33A 4AS2A 3OSUA 1U0TA 2AG8A 1SQGA 3HBLA 2ZJ1A 1RLOA 3ZX5A 2PL5A 3IP8A 4R98A 2F9LA 2AE1A 4BN4A 5HP4A 4XCXA 4OKSA 3O8LA 1NA5A 2BWJA 5C4IA 3ADCA 4XTRA 3U4IA 5H59A 1X0XA 2QL5A 1FXWF 3PC8A 4HI0E 4OAPA 3A28A 1PHRA 2A2ZA 1TVKB 1W46A 3IEUA 1MQ8B 4KPUA 5DULA 4QTYA 1PJ8A 1KPGA 1XRSB 4JR1A 4A8JA 3C43A 4H08A 1YULA 4QQKA 3NR2A 3JVDA 1LRJA 1QFJA 1EAMA 4EG7A 2Y4OA 1U5BA 4Q7JB 5JAOA 1ZKDA 1HO3A 1XXLA 4N7JA 4FGLA 4UE6A 4LXTA 3CCFA 2BGTA 4OXXA 3PXUA 4RU1A 2WWVD 4J0QA 1UZNA 4BQEA 1D6JA 3T9EA 2CW5A 2ZJZA 2VP5A 1TJ3A 1I3NA 4J0JA 3HUDA 4RK6A 3ZDYB 1YKGA 1YV9A 2I4IA 1XO1A 2J4DA 1HYBA 4YV2A 5CIYA 2PKQO 3H5IA 1D4ZA 1L3IA 1U7DA 2FX3A 4XWWA 5AK6A 3GDHA 4WLUA 3KQKA 1WQ3A 1PL7A 1NR5A 3HU2A 2WKSA 1OH7A 1VHDA 1NPYA 4DUYB 1T5IA 1Z4JA 3ECCA 1RJ9B 3N86A 3ZR4B 1C41A 1G8JA 1LTHR 3N3BC 3SR3A 3O9MA 4BMDA 1DJNA 8ABPA 1RRGA 4G4GA 2ZEJA 4D82A 3I53A 4FYHA 2I3GA 1MFPA 1Q1BA 2VT3A 1SQ5A 3D59A 3GOHA 3ICVA 3IIMA 4B2PA 3LY8A 3WWYA 3ANXA 3PYLA 1OVMA 2VWHA 5BW8A 5LP6A 3QEAZ 3GFGA 2NN3C 5B3JC 1XVUA 3E61A 1LS6A 4O5OA 1W1UA 2R6AA 3CLTD 1F20A 4S3MA 2X7XA 2GO1A 1Y80A 3NYRA 3CVYA 3I72A 5GIPE 1G3RA 1HUQA 2CMGA 1A76A 5J2TA 3IHLA 3DWFA 3HDJA 2HU8A 3QYPA 2YICA 4Y2YA 3F2IA 4BNVA 3OOEA 4L8GA 5J5CA 3HC7A 5EP4A 4YACA 5LD2B 3ZD8A 2AFIA 5L51A 3D6UA 5IW8A 1HTTA 3PYXA 2EW1A 3EUAA 3EZ2A 2GNOA 4Y2QA 2FJUA 4BUJA 2LPMA 4JC4A 3CH5A 3UWSA 1CF2O 1X15A 3WRYC 2A9OA 3AR8A 2YRXA 1XZ8A 4DSZA 1S3IA 4RDXA 3TRFA 3V8VA 4CETA 2H1IA 5H70A 1L7DA 3VDRA 3OA2A 3LVFO 2GEVA 4YB8A 2C4VA 3HL0A 1ML3A 1ICEA 4DG5A 4LNUA 2XUKA 3WB0A 4NU8X 2FZKA 1KVRA 1SPXA 2EU8A 4PZ0A 4FBGA 4OI4A 5KYXB 3N58A 5AJYA 4CU2A 4DM7A 1GAJA 4IS3A 5CT5A 3FR8A 2VP3A 3I4LA 5K9ZA 5J5VA 1ZMXA 1W52X 2JHPA 3TXYA 3UC5A 1VIYA 1E7YA 1ZKMA 2VSFA 4FEGA 2HU2A 3AM4A 3EE6A 2XYGA 2EZ9A 2Z8ZA 4MAFA 2OORC 3H99A 4NZYA 4OXQA 1TKCA 3CRZA 4KWEA 3ROXA 4YJGB 3VNUA 3DMTC 1HFWA 4D80A 1Z0DA 4ENPA 3O2SB 4B3CA 4ER3A 1G6KA 4FE4A 1U3TA 4V0NA 4M76B 3ZKWB 4KMRA 1IEXA 3FTQA 4I1SA 4G5YA 5AW3A 2C9MA 2FSSA 2Q9CA 1U3WA 1OKKA 4FEAA 4D9NA 5DB4A 1YRWA 2BHRA 3JQ6A 2QY9A 4RDIA 2ACWA 1SNYA 2QVLA 4O59O 1S9DA 3PF8A 1ZZGA 1U7ZA 2ZYTX 3C6YA 3GPIA 2DWUA 4WPGA 4I3HA 4N4AA 3RVSA 3ZDDA 1N8SA 3F5DA 1LW6E 3BZWA 3ZXUB 4J0HA 1FVOA 1LV8A 2YJTD 3O4IA 5IH3A 2AZ4A 4WAUA 1VL1A 2AC7A 2AUMA 2PM8A 3PT9A 5JLAA 2PUGA 3ABZA 3ESXA 3LVBA 4GGPA 3QFRA 3RC1A 3PL1A 3CVXA 2HJGA 2VJAA 5AI8A 5CITA 1IG0A 3GEMA 1EFLA 5BNIA 5EXPA 1YT5A 3K70C 4OLAA 3ZTTA 3RTBA 2R3SA 2V5VA 3O4FA 2HHJA 4AY5A 5DM60 4MVJD 3H6GA 1YZUA 3OEEA 1C3JA 1J8FA 2ACEA 1DINA 2WU1A 4MHTA 1FCJA 1NRJB 3IJEB 4G4JA 1OV4A 1V8OA 2V7PA 3K09C 3VAZA 5EMJA 3ZGLA 4G4SO 3ITNA 3VYUB 3FZQA 5F77A 2I5PO 4JASB 1AF4A 3HLKA 4IEIA 2Q7XA 3WYEA 1ADFA 2O20A 4K6HA 4C0QC 1FLNA 3V4RA 3DNFA 1YB4A 1UAYA 2MSCB 2G4CA 3PEWA 4S1TA 1R3UA 1MB0A 4TL6A 3RS2A 3E05A 2CNOA 1PK7A 3TLBA 3KOMA 1YB2A 4MINA 1DBSA 1KS9A 1QMGA 1U7WA 3WLOA 2Z5FA 3ZTYA 3AV0B 4AY2A 3DT9A 4KQKA 1HEUA 1RP1A 3L5OA 4A0HA 3JQFC 4B45A 1UBSB 4UCFA 5L7YA 4CQLA 1XPOA 1FYDA 2DX7A 2ZCVA 4RWZA 4YCSA 5KDOA 1E59A 3O8DA 1T9GS 1GA6A 3NYQA 4QOIA 1TCAA 2X9LA 3R0IA 1AGNA 2G0NA 2V5UA 3ORQA 5BWMA 2FKNA 4HEJA 1CNMA 3HJRA 3IGFA 5JSZA 1P7PA 2QW1A 5AVOA 2RH5A 1W49A 3OOHA 3TW0A 3HYSA 4F6RB 1NPDA 1NXOA 1S8FA 2BEVA 1Z73A 1GAXA 1X1AA 3JARB 1DQYA 1T9BA 1SC6A 2GD6A 5K8CA 3P1JA 4FHDA 1KJZA 5DGHA 3UK6A 5J63A 3PV0A 1NJ8A 4O8CA 4YUZA 4EO7A 3HY3A 1CNEA 3PQDA 1Y8ZA 3LPCA 1Q21A 4NBNA 4QNRA 3FRHA 2FVYA 3IJPA 3AEZA 4OFWA 5EQDA 4YRNA 1YCFA 2OBMA 1U5AA 3GRKA 3OLYA 3ZBUA 5DYTA 2REOA 3SIRA 5AUOB 2XMCA 1Z4NA 3G9QA 2YWEA 4QDTA 5CCDA 4FT4A 1C9MA 4LA4A 5A3SA 4D3FA 4B3DA 4ZCQA 1I4LD 3FHTA 5AI9A 2W98A 4KO2S 2PX4A 4GLOA 2PVSA 4Z53A 3OVMA 3C7CB 4YEDA 4M8IA 2W6JD 1DJMA 2X5OA 4IRXA 2YN2A 2NO6A 2B78A 3QV2A 4ZQHA 2Z56A 5FH9A 4NU6A 4QICA 3FE2A 3SI7A 5C5EA 3L7DA 1GYQA 1IJEA 4W1QA 5F9FA 5EZYF 4GVLA 4G4IA 3DUFA 5H68A 4LV6A 3RU7A 4QQNA 4NOMA 4EPXA 3GVXA 4J90A 1ZUNB 3H97A 4DR2B 2ZJ6A 3R7BA 3M9WA 4V1CB 3QVSA 1QYCA 1V43A 4B6GA 2HMYB 4R2HA 4JUFA 1CG6A 1O5OA 3TDNA 1UBCA 4RZQA 1N8KA 4GBJA 2JGRA 1OX4B 3B1ZA 5HRUA 1L3CA 4L57A 3R8CA 3W7AA 2W22A 3EGXB 2E1PA 1YC5A 2WFMA 4URFA 3HN2A 5COBA 3O9VA 5LKAA 4X3CA 4G1BA 2WJPA 3ROQA 3Q88A 4F86A 1BXRA 1FX0B 1XMJA 5FEMA 4ZXFA 1F0PA 4H77A 2X23A 4EEKA 2BMAA 5E9WA 4LHYA 2G17A 4ZKEA 3H4TA 3F9CA 2AMFA 1EFRD 5K2MA 3VSAA 1FLDA 1DBRA 2CFTA 3NAQA 2ORED 2OTCA 4DEVA 2Q5LA 4NFSA 3L7CA 4Z4CA 1EBBA 3HHEA 1IUPA 2PMDA 3DZBA 1XLVA 2J6HA 4DWVA 4CEHA 3EAFA 3K20A 4FGUA 2O7SA 4O4HB 1AKYA 3GRUA 3BREA 3IB3A 3RANA 2NU8A 2GGSA 1EHIA 2I71A 2BN4A 1NU6A 2A78A 1I7NA 3LQ1A 4X61A 4Y1FA 3SFTA 1A7UA 3HP1A 2JFQA 1P17A 1BXZA 1EP1B 4NG4A 4OQLA 2C78A 5CNKA 2O54A 3TOCA 1CYDA 2FSGA 2DBRA 4MPTA 3IVMA 4RE5A 2NYAA 2FOIA 4JITA 1FLAA 4UM8B 1ZA1A 1N2EA 3CUVA 3GA7A 4QDOA 1N75A 4LS3A 3R3WA 1ITZA 3KJFA 1KDPA 3CE6A 3VU1A 3O21A 3LU1A 2VDQB 1ZITA 3VR5A 1T4MA 4YVFA 4DUGA 4EENA 5BUZA 3HG7A 4MOWA 4ND8B 3I42A 4NS4A 5GWXA 4TXMA 3OSZA 4X6YA 1IBSA 1YA6A 2O8VA 4G0XA 4G84A 4QU8A 1RT9A 2ZDHA 2FW1A 3FTPA 3FPBA 4BZPA 2FMIA 4CBVA 3I6YA 4BN0A 4J0IA 5A3VA 1WUJS 3IV9A 2O8CB 4FFOA 4HH3C 1G3UA 2YCBA 3CS3A 4JYBA 4M55A 1JIKA 2YDXA 4QYSA 4JI2B 4DDVA 1ILWA 2B4QA 2YFYA 3PC7A 2PNFA 4TTQA 4KSBA 1U2PA 2QTWB 3GZ4A 4C3OB 4PCVA 3O4RA 1CB7A 2YVAA 5LQUA 2DUNA 1J1ZA 4EECA 1X1QA 1ZNWA 3NP9A 5J2UA 3KKZA 4FZ5A 5EE3A 4BEBA 2KX7A 3N53A 3FSRA 4D79A 1LBIA 1GL6A 5EZSA 3AL3A 4TS4A 2QD3A 1LLUA 2X9GA 2ZOSA 3VR5D 5GOZA 3T7RA 4M0KA 5E0OA 1YOVB 3MZ0A 2IE8A 4NESA 4DIUA 3PVSA 1XEXB 2RGNA 4PYIA 5EJ2A 4EUHA 2WMNB 4BWFB 2UZ0A 1OJLA 4CFSA 1UK8A 5BQ5A 4TVSA 2VUUA 3GL9A 3CVOA 4ND2A 2VJMA 5ER6A 1NF8A 1Z39A 1JILA 1X9HA 1PNOA 2QN6A 2KHZA 4C89A 2VQFB 4NABA 3H9QA 4LJKA 2OCAA 1QIGA 2Z3WA 5CGQB 3OKCA 3EASA 3GDGA 4F92B 1QQ5A 3PD1A 3QKWA 3WJ2A 4BNDA 4DDMA 1VI2A 1IN8A 2PJUA 3DKIA 4P84A 1M1YB 1TTHA 3JPWA 5CLLA 1EFPB 5IG2A 1Z8DA 4FFSA 5DT2A 4CKBA 1R8YA 4C7KA 1P45A 4IQFA 1H1LB 4Q9NA 1U6KA 2FPPA 1NNEA 2WHEA 4EHDA 5K45A 3EBPA 3RS3A 3K9NA 4QFBA 4KR0A 1P31A 4R2LA 5DZSA 3U3ZA 1EUCA 3IVAA 4MKZA 2P0YA 3KM0A 2XZOA 4MK4A 2AYYA 2PMCA 1MB2A 2IXEA 5FUYA 2PL3A 3KQTA 1QOPB 2KWIA 4C20A 5ALIA 2JHFA 1SQ0A 1QJCA 5LL6P 4LSGA 1WSBA 1YHNA 1ACLA 3DPUA 5KINB 1N6RA 3OFND 4GC9A 3QUSA 5LZ5A 4R2WA 4E13A 2ZRAA 2WSSD 1NMXA 4YQZA 1TT5A 4I6GA 4G0UA 1DO8A 2YW9A 4X64B 1PX0A 5FADA 1Q1QA 4Z54A 2G5TA 5IAOA 3OIYA 1ZHOA 1Y8AA 1H5QA 5KC9A 3BN3A 1EG7A 4KREA 3TD2A 5BW5A 1T10A 1RPJA 1QU2A 4MHOA 1ULBA 3MJEA 4UHFA 4ECAA 2NTEA 1I7DA 1BCSB 3TE7A 3AUJB 1JBQA 2XOKA 1FMLA 3BE8A 2WP0A 5LP6F 4OLHA 3PUIA 2V7WA 4F12A 3K9LA 1ID8A 5K3SA 3FM9A 1Z8HA 1HYQA 1JPNA 1N5KA 1XRPA 2COKA 4DNQA 4EFLA 4Z1MD 2QG4A 1XU4A 4HR7A 4Q37A 1Q0SA 1FQOA 2O0MA 1JFFA 2RGAA 3UPUA 1HFJA 2EZ8A 4NONA 4WINA 5GGYA 1JKIA 3L82B 3WIUA 5ICCA 3BT7A 1QHGA 2GXQA 1G8YA 4F9TA 1G2PA 1ZISA 2C7VA 2YHIB 4D57A 3HEBA 4DSNA 5FORA 3U7HB 4O4IB 1JKMA 1PGNA 5IFKA 1XB2A 4IRUB 1RXEA 2FZEA 4FSHA 3PGLA 4CLOA 3O74A 3U7EB 4BV9A 1K1EA 4F7WA 2AR9A 4R0VA 1Z5NA 2HN9A 5ECDA 2C2ZA 1LDYA 5DSXA 1FFAA 1V95A 2IPXA 3BDVA 4JB0A 3SZ3A 1LJ8A 1ZWKA 3NXKA 2BEVB 3PENA 3R3YA 3OQIA 1XP5A 4BYGA 5AJTA 1T0IA 3OE1A 2ZUWA 3UT0A 1YDGA 3L02A 4IDNA 4ZJYA 1RI4A 3K5IA 5BN5A 2YMQA 1PVOA 1WY5A 1FBTA 1CY0A 4EATA 3S6JA 1SB9A 1G3MA 4JLNA 5EE5B 4LDAA 4EFKA 4ER7A 1DQPA 3NG1A 2B1GA 1CJCA 2PJDA 3MAGA 5FTWA 5L40A 2DETA 3ACBA 1WV1A 5K8UA 2FAXA 1JFSA 1L1RA 2B99A 4HVAA 5DV9A 3SC3A 1LFDB 2I3BA 4DUZB 5JMWA 3ADKA 2VJBA 4GQIA 4QREA 5BMVA 2YBEA 4S04A 4DADA 1RFGE 5KEIA 4OBEA 4DSTA 5HK9A 1ZYUA 3P0HA 3AJDA 1R4NB 4O4IF 2YNMA 1U1EA 3DZDA 3GGGA 3C3XA 1TA0A 4J1TA 4AS1A 2OCPA 2XNCA 2Z5GA 1V9SA 2C4HA 4ZEXA 1DRUA 3NPAA 2B98A 4CN8A 5ITZB 4KP7A 5AHKA 1QM5A 3GPCA 4K9SA 3TD6A 5ILOA 1JB1A 1BS2A 1QAOA 2D6FA 3FBGA 1DU4A 4B85A 4B2LA 4N5DA 4F06A 5IKEA 1OD6A 3V8QA 3FYUC 3ETLA 1ZUIA 4N9WA 5KX5F 3OT5A 1T1SA 3GD7A 4M0UA 1YRQA 2GVDC 5HUQA 1OPRA 3H1BA 3VZCA 5JBQA 2V6MA 2HF7A 2I99A 3O3CA 2VJLA 5JQGB 1MFZA 3U9LA 3JD4A 4J16A 5HTKA 1XDGA 1HZJA 4LXQA 4UTOA 4YRGA 4MKGA 3BXFA 2FW7A 1T1RA 3IS3A 1ETUA 1S4MA 4L8WB 4AZSA 2BGNA 1J06A 4R41A 3D6AA 3LWZA 2CK3A 4ALLA 2WFAA 5J2UF 3WLNA 1TTTA 2KE5A 5JASA 1MJGM 1MC5A 2XNDA 1XYGA 3RROA 3AOEC 4BO8A 2IX9A 4BRZA 1KPIA 1MDFA 5JEDA 3D2LA 4OU4A 3WQRA 2C4TA 1NOJA 1YSCA 1S2OA 3IB6A 3KYBA 4A8TA 3IIIA 1F9AA 1T1IA 1PJRA 3K09A 4HAZA 4A1FA 4KO1S 4RY2A 2VYND 4Q7EA 3EPRA 3FVVA 4I9GA 3MPOA 3UGTA 2PX3A 4B3FX 3FYTA 2FGKA 3OM0A 2H4WA 5EY5B 2HWUA 2N75A 1AKEA 1RYYA 2XB8A 3AM3A 2YNMC 3NS7A 3ZZUA 4AMGA 4LWQA 4L07A 5AJXA 1EWTA 1GKLA 721PA 4Z3KA 4IJMA 1WD5A 2VDWA 1BMTA 3Q5EA 1BRTA 2H7CA 4HF7A 4HLCA 2CVZA 3MNFA 3RS8A 1D2RA 1CBUA 2G9UA 3P96A 4ZO8A 3ERCA 3I62A 1NBOA 3PPIA 3OT4A 2JFBA 1NM5C 1OF1A 4OHRA 5U1PA 4DQLA 1ZNQO 3AFIA 2H5LA 3DV0B 2YJGA 3OMLA 3CX3A 5B4VA 4NBKA 5K6AA 3QVTA 4ZYXA 3CR8A 2Q4TA 2WAOA 3OIFA 4KC0A 1L7NA 1ZD2P 5H0IA 1ESDA 2YWXA 1R8SA 1V25A 2FEWB 2GARA 3I52A 3CMMA 2YFKA 3R44A 3ZYCA 1G21E 1RYMA 3K3PA 2EKPA 3T3MB 1JLHA 3F96A 2QK4A 4MUXA 1YRAA 3DVLA 2C7QA 1COZA 2E6UX 2XKAA 1IE3A 3TLAA 4W6QA 3ELWA 2R1TB 4N7MA 1JIVA 2VF8A 1V0JA 4PBTA 3ZCQA 3RVDA 4RLQA 5AW6A 5T67A 3L77A 1S6YA 2B0CA 1YDMA 1A9OA 2RC6A 3HKCB 3PWZA 5DYYA 4C4OA 2EJVA 3N0RA 5BNTA 2ZUEA 2BP7B 2FFJA 4CQJA 4K9KA 1MGPA 2PMKA 1YOVA 2C9OA 3H7IA 4HYQA 4Q48A 5AW2A 2HQ1A 3WLPA 1ORHA 1GSAA 5KNBD 3QBEA 1AHPA 1J2TA 5AW8A 4QXOA 2J5QA 3SXJA 3AF2A 5AKHA 2I2XB 3W78A 3LLSA 7REQB 3ILHA 3AHCA 5IANA 5M7EA 1SGWA 2C7BA 1W47A 2QMYA 3MQ2A 1AKRA 1X70A 3G8YA 3LL4A 3JASB 3H0CA 1K5GA 2FPSA 3NM4A 4FWTA 4LFBB 3AB7A 3CLRD 4HDSA 2FVXA 1MOSA 4I9NA 2J3HA 2CMFA 3RRFA 3LUPA 2XNHA 3THOA 2P2CA 1WBBA 3Q8MA 2C0QA 1SXJD 5IJ0A 4DGSA 1UWKA 4FEYA 2VQSA 2WM8A 1ZFNA 1Q0HA 2ZWAA 3M34A 2IYZA 2JVJA 4K5QA 3GVIA 3FHLA 4C07A 1E7WA 3BEOA 3M70A 3OTHA 2ARKA 2C9CA 3QYFA 3AH8A 4YXWD 4LZJA 1LH0A 1T1JA 3K9HA 1QCYA 3FLAA 5F12A 3QXHA 1EGHA 2JPDA 5F35A 3G0OA 3MCZA 4IR7A 1GY8A 3VO1A 3TQQA 5CXUA 1JI0A 2G06A 4DIFA 2PUBA 4U7WA 1XZBA 3U9TA 2MJLA 2ZQ5A 3IO3A 3HZOA 4ZREA 2JCSA 3KCQA 4FIZA 1QH1A 2Q49A 4NFLA 4QARA 2Y0DA 5FBKA 1A9PA 2RHTA 3TZCA 5KYVA 1I5RA 1J9GA 1XZAA 1FNDA 2QRNA 3N6RA 3PKIA 2Y0EA 2ZUSA 4PLVA 3AVUA 2JJ1A 4W5QA 4RANA 4BJ3A 4U7DA 2PU5A 3PCRB 2AOXA 2DQ4A 3DVAB 4B82A 2C07A 3A36A 4RTMA 2O5RA 1J1IA 1Y3AA 1HMPA 2P7HA 2V97A 3KVRA 1MENA 3LIPA 3K9FC 2HDHA 2EWWA 4ZI7B 1L4NA 1WXWA 3GFRA 2ATXA 1OLUA 1U7XA 3UB4A 3TQRA 4A91A 5KWSA 1S2IA 2IITA 2JLWA 4FKBA 2OCXA 1ISJA 1P7ZA 3AUYA 4NCIA 3BILA 5J40A 4G8JA 2ZB7A 4DV0B 2L0XA 2ZIXA 5LMCA 1IZ9A 2PKCA 5AIAA 1WABA 4DZZA 1Q0LA 1JE1A 1JHDA 2IPNA 2EFJA 3G5LA 1E8NA 4G4SP 5DSZA 3V2HA 2WUDA 3P7MA 3JQFA 1L4BA 1MO3A 1QUFA 1T0UA 1X86B 4ITUA 5A9TA 2I3ZA 1N2IA 1JE0A 4HZUB 2MT9A 2VTBB 2W58A 4B32A 1YZLA 3Q3EA 4P0TA 5E6RA 3SZUA 1Z4OA 1HEYA 3ECSA 1RMYA 3AIKA 1AXEA 4L4SA 1U6IA 1V1MB 1DC7A 1JN0A 1P8AA 3A6DA 4P98A 4FYXA 1OLXA 3LQ2A 5F7OA 1W2HA 1UBKS 1D2GA 4KQ9A 4PYMA 2E6KA 2A1UB 5EUQB 1KZGB 5CPBA 3SOPA 2CLSA 4QPJC 2JFPA 2PJZA 2XCOA 3PWTA 2W70A 2QUHA 1EFDN 3EIHA 3IUSA 3OJLA 1TVEA 3ICQB 1KAGA 1DRKA 4M1QA 3KL2A 5E7JA 1QWOA 3ZWDA 1VXRA 2NPFA 4HSGA 1MIOA 4IZOA 2D54A 2QE6A 1IRXA 1ZMRA 5KQRA 2DR2A 3Q3GE 3EOBI 1R5JA 1NR1A 3NDBB 3PRYA 5FLKA 4XLTA 1ADGA 3OLWA 1CB0A 2ZBFA 2Z30A 4TUYF 5EERA 2N9UA 4HTAA 3WL8A 4BLPA 5C2JB 3KVNA 2ZS7A 3LBHA 1R27A 3CUSA 2GA9A 3Q7IA 4GPIB 4IIJB 1GTG1 4LBYA 3WL5A 3H1GA 1JMVA 1NRWA 2D5AA 1DX6A 1LC3A 4YJHA 4IVNA 4Z4HA 3HJCA 2XHZA 3LM8A 4UEJA 3R0VA 5MF6A 4G65A 1SXIA 2QLBA 2X3UA 1Z6TA 5A05A 3DT6A 1I1OA 3MUOA 5E8RA 4CQMA 4GEGA 5JISA 3ONWA 3K9BA 1LK5A 1EU1A 3EBLA 3KNZA 2BCJQ 2ONZA 4OVKA 3SYKA 5K03A 3M33A 3W9YA 1KEEB 1G7TA 4LCJA 2WIDA 2WVGA 3DMTA 1AO3A 1QYXA 3CNBA 3MTEA 1DBIA 4N0MA 5FUXA 3IFSA 3W5IA 4BO9A 4ETIA 1OFUX 1LQTA 2YZMA 4QNNA 1RYZA 5KSYA 1PV1A 4HDSB 4CKZA 1FFGA 3HJHA 2IXDA 3TMAA 2R00C 2EWMA 3MHTA 2IYWA 4QDKA 4REQB 1UT6A 3LGSA 3OLCX 5DRTA 4HGQA 3ILVA 1GQOA 1PI3A 1Q50A 2DHRA 2P8SA 1ABFA 1KOGA 2JIZA 1EWKA 2ZAGA 4TM8A 4EBBA 1MABA 3WMWA 1E9CA 1JR2A 3FFAA 3AILA 3LYAA 4I19A 1PJ2A 2EG5A 3Q2KA 4I4CA 5JAUA 1YQ9A 2X15A 1XKQA 2ZE8A 1Y5RA 2IYLD 3IDQA 3K0AB 4YHBA 1ZSNA 1LV7A 1U9IA 2B82A 3OE7D 4NZ9A 4UUPA 3VR2A 1USUA 3CLSC 4ES6A 2QLNA 3D6JA 1JXOA 3LK6A 3PCTA 4HX9A 5TNXA 1AXGA 1U8AA 3TSOA 5JZMA 2VA8A 3D81A 3DGFC 1P0MA 1IOWA 1RKQA 3O1JC 3RR2A 1P2UA 1MW8X 1QTRA 4PC7A 2ATEA 5A2GA 3DF9A 2H51A 2H18A 4R9VA 4Z1OA 2DLCX 1UAAA 3H4IA 1JDNA 2Z8YM 4UPVA 3RGGA 5H16A 2FRVA 2JH9A 1XLTA 1R5OA 2JIRA 2HLDA 1UBRS 1AMUA 4TKLA 3TCKA 4J3JA 3GUYA 2CJWA 4F96A 3D2CA 3GJ6A 1PKXA 1ZUD1 2RGDA 3C48A 2WNSA 3R41A 4MWOA 4UD2A 1QHYA 1YDWA 4RETA 4YLEA 5JANA 5JWRA 5EP2A 1EK2A 5AJUA 3WHKA 2XCTB 5WRFA 4JBNA 3H5AA 4IIDA 1G9TA 1C8VB 4MLZA 3BIOA 1G6Q1 3FLEA 4N3CA 4RPJA 1YS1X 1IWPB 1PF7E 1XZCA 1W29A 2ZTLA 4OAOA 1U7HA 4UFNA 3L18A 3TRJA 4J43A 3ZEIA 1CRLA 1JG3A 4Z0NA 2V9CA 4YV1A 2EFCB 4G0PA 2M9MA 1RW4A 4I14A 5L95A 3B7PA 1KSJA 2O3UA 5CVEA 4MB6A 1Z6GA 3C87A 1IPEA 2Q2WA 1JIJA 4RQBA 4OATA 1JB9A 3EK2A 4WW0A 2Z8XA 5HDBB 5B7GA 2C5FA 2HBYA 3BVPA 2IGTA 1MOZA 3SBDA 2FZWA 4YQEA 3BD9A 4C4SA 2ZG6A 4ZYVA 1JJFA 2J30A 3KU1A 2GWRA 3WLEA 2G63A 1KJ9A 1SB8A 3T5MA 2QTZA 2P9EA 1R0KA 2OOKA 3VOBA 1NLFA 3ZHBA 3ZWCA 4RORA 2GPBA 1TC1A 5HUJA 4KGDA 3LX6A 2K4MA 1KA9H 3OO1A 4FE3A 2DY1A 4WTOA 5G0UA 1R6VA 2CEAA 2OBLA 5EWJA 4UBOA 4CQNA 3PNSA 5EIBD 3IYLW 4DJEC 3NH6A 4ZALA 1JVNA 2OCLA 3MJDA 1H1DA 3H8JA 3MB8A 1UBHS 1Z7WA 3MWLA 3D1VA 3PDIA 2FEKA 4BRWA 5JROA 2H0AA 2OK7A 1P2GA 4WH0A 1YJBA 2AHRA 2I6FA 1EVZA 3QELA 3GFBA 5DM70 1I9GA 3PNQA 3EJ6A 1B0UA 1ZIDA 3FMGA 3H19A 4RY9A 5EHIA 4NK5A 4C3ZA 1XCPA 2ISQA 2J3QA 1KY4A 2A84A 1MAAA 1V8ZA 2A5YB 2Y0BA 3E2IA 3FPKA 3GG2A 4LCBA 4PY2A 5HIMA 5ADHA 4RTOA 3A6EA 2Y77A 4HDKA 2PXAA 2XW6A 3IKMB 3V46A 3AESB 1DTSA 1RWPA 1YQGA 1QIEA 3I0NA 1TA9A 4UVDA 3RRZA 4RZXA 9MHTA 2BKLA 2F1OA 1RWQA 1XGKA 3UMSA 2FGJA 1X19A 1JZTA 3ONFA 1W8IA 4TV9F 2D7JA 3DLTA 4O2RA 1JQ3A 4KPFC 3GLFE 1CVRA 4G0MA 4HNSA 5EIHA 3T8YA 3UUFA <