2RBIA

Structure of binase mutant his 101 asn
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAEVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGFRNADRLVYSSDWLIYKTTDNYATFTRIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE
molecule tags Endoribonuclease
source organism Bacillus intermedius
publication title RNA cleavage without hydrolysis. Splitting the catalytic activities of binase with Asn101 and Thr101 mutations.
pubmed doi rcsb
total genus 31
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 1996-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2rbiA00
1HZ1A 3WR2A 4RNTA 3KCHA 1RGCA 1RN1A 4GHOA 1I3FA 1YGWA 1RGLA 2F5WA 1YNVX 1I2FA 2RBIA 4HOHA 1AQZA 1RHLA 1MGWA 1RGEA 1RNBA 5BIRA 1BGSA 3BU4A 1HYFA 1BRGA 1I2EA 1RN4A 3DGYA 1T2IA 3GSPA 1RNTA 1BVIA 3HOHA 1RGFA 4BIRA 2F5MA 1A2PA 6GSPA 1LOYA 1RGGA 1TRQA 3WHOA 1BRSA 1BNRA 1FZUA 1BU4A 1LOWA 1BNFA 1GOVA 1UCIA 5GSPA 1IYYA 1BRNL 1I3IA 1BSBA 2KF3A 1BRHA 6RNTA 1RDSA 1B21A 1RGAA 1LNIA 1C54A 1FUSA 5RNTA 1X1YA 1BAOA 3D5GA 1UCLA 2HOHA 1BRJA 2KAAA 5HOHA 1FW7A 7RNTA 3AHWA 1B2SA 2GSPA 1PYLA 1RCLA 2KF5A 1BOXA 1CH0A 1JBRA 1RMSA 1BNJA 1FUTA 3AGOA 1BNIA 1BSAA 1GMRA 1LOVA 2BU4A 1SARA 2ZA4A 1BSDA 3AGNA 1RGKA 1BRIA 4J5GA 1PY3A 1X1WA 2SARA 1JBSA 1B2ZA 1RCKA 3RNTA 3D4AA 1FYSA 1X1UA 2F4YA 1BSCA 2AADA 1GOUA 1I8VA 1DE3A 1TTOA 1AY7A 9RNTA 2AAEA 1G02A 1GMPA 1JBTA 1B3SA 1Q9EA 1YVSA 1RTUA 5BU4A 1B2MA 1RLSA 3DH2A 1BNSA 1B2XA 1UCKA 2KF4A 7GSPA 1DETA 2BIRA 1B27A 2C4BA 8RNTA 3Q3FA 1BIRA 1BNEA 1BSEA 1GOYA 1LRAA 1BRKA 2RNTA 1UCJA 1I0VA 3AHSA 3URPA 1GSPA 1GMQA 1TRPA 1I0XA 1R4YA 4J5KA 1MGRA 1BUJA 1B20A 2F56A 1B2UA 1I70A 1X1XA 2KF6A 1BNGA 3D5IA 3A5EA 1ZGXA 1T2HA 4BU4A 4GSPA 1BANA 3SYUA 3BIRA 4HAAA 1I2GA 1RSNA 1RGHA
chains in the Genus database with same CATH superfamily
2I9WA 4XB5A 1JB2A 2PZVA 3WR2A 2YFIB 3KCHA 3JVCA 2P09A 1UW1A 1WMOA 3G713 2WGOA 3I553 1I3FA 1YGWA 3CME3 1RGLA 3BLZA 1UUGB 2A15A 5EQLA 1Q42A 2ZDJA 1GY6A 2BT3A 2YFLB 3NV0A 2MF7A 2HMJB 3K0ZA 1NB5I 1HYFA 1BRGA 3N54B 3ROBA 1NWWA 3CNMA 1TFOA 4EXRA 1STDA 3FGYA 2BMRB 4BIRA 3JUQA 4HM7B 3OW22 1OGXA 1A2PA 4KVHA 4WYKA 6GSPA 2IY2A 3GZXB 2QIYA 1NU3A 1BNRA 1W2B2 1FZUA 1U8CB 1N5HA 1BNFA 1GOVA 2OTL3 1W02A 3ECFA 2CX0A 4KFEA 1IYYA 1SQWA 1E3VA 2XRXB 1IVUA 2OOVC 4K1UA 3T8UA 3PXMA 1WQLB 2KF3A 3KE7A 1BRHA 3NHXA 3G16A 1RGAA 3MKIA 2GBXB 2RSXA 3BNDA 2XF3A 2OCTA 4IIAA 1M1XB 1FUSA 3G6E3 5IF6A 1C54A 2STDA 1BAOA 2GU1A 3FG3A 3PS8A 4LEHA 1STFI 1VQ63 2HOHA 5DRVA 2KAAA 1IQ8A 4MMYB 7RNTA 1W6GA 5FW5A 2GSPA 2KXGA 2JQ5A 1Z1SA 3X42A 7STDA 1CQSA 2F99A 2KF5A 1GS3A 5IG0A 1JBRA 4GL6A 1OACA 1US1A 3S29A 1MWRA 1FUTA 5G1LA 2WGQA 3CC43 3HIIA 1BNIA 5EEOA 1JB5A 1KD14 1DMQA 1OF5A 1BSDA 1GD3A 2UX0A 1O7HB 5AIFA 1CYVA 2BHMA 2W56A 1B2ZA 4WWUC 3CCR3 5KP1A 1AV4A 2W56B 2J8XB 3IJEB 5IENA 1SIIA 4H61A 2AADA 3G8ZA 3CCM3 1I8VA 1W4NA 4IT7A 1QAFA 1TTOA 4WFOA 1G02A 1UDII 2GEYA 4AKYA 1KWIA 1AR0A 1Q9EA 2GBWB 3G4S3 5IEOA 2R41A 5EVHA 3OXAA 3PCSA 1U5OA 1O7MB 4EV5A 1TUHA 3FF0A 1B2XA 3CCE3 1UGIA 2IMJA 3MG2A 5AIIA 4LZIA 1TIJA 5STDA 3FF2A 8CHOA 3MYTA 1MWTA 1B27A 2C4BA 3A76A 3V98A 2Z77A 2CX1A 1BNEA 1BSEA 1W7CA 2XGLA 1I0VA 3WODG 1YJ93 2W2CA 4L8PA 3X3YA 3U1WA 1DYUA 1I0XA 2OTJ3 1VQ83 1IT8A 1JN5B 2W0QA 3MHEA 1MNLA 4N6V0 2FXTA 1B20A 2CWUA 2B24B 4BTWA 3F8HA 3S28A 1QMAA 3D5IA 3HZPA 2HMOB 3BNCA 3A5EA 5IG4A 1ZGXA 2CK3H 1N9EA 3DM8A 5D81A 1JNQA 4EC6A 2KCDA 2P0XA 2Y73A 2LQVA 1UI8A 4BL3A 3DXOA 3SLUA 1O7GB 1LQGC 1BUQA 1NJI4 4RNTA 1ZO2A 4RBNA 2H0HA 3T8NA 3D9RA 1YIT3 1YJN3 1DVDA 2CFLA 1YJW3 4GHOA 4JRFA 3EBYA 1YNVX 5AI1A 1GYBA 4HKVB 3HI7A 3F9SA 1EA2A 1IV9A 1MGWA 1OPYA 1T3BA 1VQ43 1VQN3 4HM0B 1ULIB 1G96A 4EV2A 3K63A 2D1WA 1A67A 3KZTA 5AIHA 3FH1A 1T2IA 4N6MA 1WTHA 3GSPA 2UUGC 3CC73 4HM5B 1IVXA 4HM8B 1EQKA 2F98A 1UI7A 4N6LA 2CC3A 5TGNA 1LOYA 5IG5A 4FR9A 5IERA 1W5ZA 2IUKA 1TFKA 2BMQB 3BNEA 3DZLA 3F40A 2W04A 5GSPA 3MG1A 2Y74A 2ML5A 3HK4A 1CYUA 3D3LA 4N6NB 4EYCA 1W6CA 1I3IA 4LSOA 1OHPA 5IW9A 1B21A 2YFJB 4FMCA 4BTXA 3EE1A 4QWTA 2WOFA 3Q2PA 4FMBA 3NBJA 1MOLA 4FMDA 3NQZA 3AHWA 1IVWA 2HMNB 1OCVA 3F8XA 5LC7A 3EN8A 4CJNA 1BOXA 1CH0A 2CWTA 2OWPA 1ROVA 3N8BA 5AIGA 3AGOA 1OUNA 3STDA 3CPW2 3EN1B 3S5CA 1GMRA 1LOVA 1NO3A 3JUNA 5CF2A 1RGKA 1BRIA 4J5GA 1PY3A 1X1WA 2XSHB 3E99A 2L4VA 3Q90A 2HMKB 3RGAA 3CC23 5ELJA 1RCKA 1VQO3 3OWUA 1OGZA 2XGNA 1OF5B 2F4YA 3DGMA 3NUVA 4HM4B 1JKGB 1Q864 4KZ1A 1FGOA 1ZS7A 3WMDA 3RGRA 1AY7A 3FG4A 2W03A 2YX9A 4BTYA 2RGQA 1IDPA 2INXA 4RNZA 2CFWA 1RTUA 5BU4A 1B2MA 1Y4KA 1ASKA 1LVNA 1SIHA 2XFSA 5JPPA 3DH2A 3D79A 3LTDA 4CCVA 1R4CA 3EHCA 3EBTA 4XBXA 1QVG2 1K9M4 2KF4A 4R9KA 3J7Yd 2RFRA 8RNTA 1VQ93 1RKYA 2PNCA 1BIRA 2W9PA 3FG1A 4Q53A 2BNGA 1BRKA 2FNQA 1UCJA 2RNTA 3AHSA 1FUWA 3UJMA 1R4YA 4J5KA 2IYJA 2CIUA 1W00A 1MWSA 3BNBA 4RZMA 3WOFB 1MGRA 1O7NB 3WOEB 1BUJA 1QALA 1IT7A 3SOAA 3LMLA 2IA7A 1A2KA 2K0MA 4FCZA 4JF8A 1ISKA 1JZDA 1NDOB 1DMMA 4KT3B 2ML6A 3S27A 1Q7Y4 1G0TA 1YIJ3 1BANA 5AYRB 1IVVA 1I2GA 2ZA4A 3LT8A 1HZ1A 4L8OA 3H3HA 2D42A 4XDWA 2Q07A 2F5WA 1K8A4 3AMOB 2IUJA 3UL6A 1LOXA 3F7SA 2RBIA 4HOHA 1RHLA 2W9QA 1RGEA 1V58A 2P0MA 2UGIA 4HM6B 4K90B 4N6OB 1RNBA 1PU4A 5BIRA 3LZAA 4DKIA 1OH0A 3EF8A 3G0KA 4HZBB 4LYLB 4PEJA 1SPUA 1RN4A 3B4PA 1ROAA 4R9LA 5M19A 1FGTA 5D83A 1KC84 1JV2B 1O7PB 5DREA 4U13A 1D6ZA 2LYXA 1BVIA 1N8R4 1RGFA 1DVCA 3NM2A 2F5MA 4FCJA 1NNVA 3UNLA 3BB9A 1OHOA 4O2HA 5JPUA 1JJ22 1TRQA 1RGGA 3GZRA 4L7KA 1BRSA 2OQEA 5BXQA 4WP5A 2FGTA 4O8SA 1LOWA 3CXC2 2CG0A 5AEWB 3CD63 1Q7HA 1ZX2A 3VGNA 4I5QA 3PCRA 3KIIA 1F8NA 4ZM8A 5CLKA 1BSBA 1E3RA 1CEWI 3DUKA 1RJOA 5G2GA 3SX1A 2HMMB 2B1XB 3EB8A 5A0OB 6RNTA 1Q824 3ALAA 3OWSA 1JB4A 4X2OA 2XFTA 3M8CA 1K734 1LNIA 1V57A 3NX0A 2CG1A 3WDGB 4K1VA 4TX4A 2BO9B 1D6YA 1HU9A 1UCLA 1YVBI 2MC8A 1WNHA 1BRJA 2GU3A 3FSDA 1Q40A 3WA3A 1B2SA 2XH9A 3NQYA 1RCLA 3KN4A 5AYSC 2HMLB 3F14A 4R4KA 3ZG0A 2QA43 1TJDA 1K41A 4OK0A 1RMSA 1BNJA 2V1LA 4CDLA 5I97A 2OOVA 1BSAA 3B7CA 3OX9A 5KP4A 3DY5A 1HKXA 1JKGA 1SARA 3AGNA 4LMIA 5IEPA 4EW5A 4XDVA 1VZZA 1V74A 4XM4A 1E97A 1D6UA 4HBRA 4HM1B 2H0GA 1UGHI 1FYSA 1VQ53 3SOYA 3FZWA 1BSCA 1WMPA 1DE3A 1S5AA 2W6JH 2ZHXB 3X40A 6STDA 3I0YA 2AAEA 2ZL8A 3NM7A 3ZFZA 1SJWA 1JBTA 4O3VA 5M1AA 1JN5A 1IQYA 1YVSA 3PYJA 2CKFB 2L1SA 3LT9A 3I563 1LXEA 2CFKA 5CF1A 3KKGA 1VQL3 2CWVA 3OV4A 4N3VA 1IV7A 4KFFA 1N5PA 4G1MB 1IQXA 4EBGA 2QEX3 7GSPA 1DETA 4FCMA 3CCL3 1O7WB 1PFPA 2SBLA 2BIRA 2Z7AA 3GZYB 1VQ73 1VQK3 3Q3FA 1GOYA 2O3OA 3MG3A 5CK6A 4HM2B 3B8LA 1GY7A 3URPA 1GSPA 1GMQA 3JUPA 2Z6BA 3PGBA 4RNYA 1J2BA 3X3XA 4J9AA 1QJGA 3X3ZA 3WA2X 1MWUA 2CH9A 4GB5A 2K3DA 5FGOA 2F56A 3HIGA 3H51A 4HM3B 5ELUA 3NBRA 1TP6A 4NHFA 1I70A 1BNGA 1N8QA 2GEXA 4OUQA 3K5TA 3L0RA 3SXXA 3CCJ3 3U97A 4BU4A 3ER7A 4N6TA 3MWZA 4GSPA 3SYUA 3BIRA 3LTCA 2E2UA 4HAAA 1RSNA 1A90A 3RDEA 3GAXA 1YI23 2H0IA 2Z76A 4NREA 1EEJA 1RGCA 1RN1A 3JUMA 3PZWA 5BVBA 1RN7A 2CW9A 3DGOA 2JDIH 1LNHA 1I2FA 1YGEA 4R80A 1IK3A 4K61A 1AQZA 1NB3I 2XR8B 3N9HA 4X2HA 1LQMB 1BGSA 3BU4A 3UL5A 3GWRA 1I2EA 1DMNA 4STDA 3DGYA 1M9GA 3F7XA 1RNTA 1EUIC 3HOHA 3O8YA 4ILFA 3DGLA 3K9MC 5CXOA 5IG3A 5HGRA 1FGRA 1FGMA 4HVNA 3CNXA 1A2VA 3FKAA 3K7CA 3WHOA 1BU4A 1IU7A 2M7OA 3KSED 3EX9A 5KP3A 3X41A 1UCIA 3IPTA 5JBSA 3EQQB 3VF1A 1BRNL 4XBYA 1EG9B 2K54A 4I4KA 1C7HA 1JZOA 3SVAA 3TDGA 1TU5A 1Q40B 3VSYA 2OQEC 1RDSA 2RCDA 3LTBA 1UUWB 1EKMA 5LC6A 5RNTA 1X1YA 3ZG5A 3D5GA 2WO0A 3LTAA 2BMOB 3GRDA 5HOHA 1FW7A 1QVF2 4HZ9B 1PYLA 3HX8A 3KSPA 4WHAA 3KFQC 4R1KA 1L5GB 1KSIA 1M1K4 1Q814 3AMOA 3S67A 4N6UA 2E2TA 1RRLA 2F86B 2QGUA 2BU4A 4CPKA 3CCV3 3T0UA 1UUVB 5M18A 3FCSB 1W6YA 3EC9A 3GZBA 4HJLB 3CCQ3 4IPBA 1S723 4WYKB 1M904 2SARA 2C10A 3IMAB 1JBSA 3RNTA 3D4AA 4H3UA 1X1UA 2E2VA 3OWYA 2CFGA 1OHSA 2CHCA 1GOUA 2O9UX 3CPOA 3Q1CA 3DGNA 2P38A 9RNTA 4O02B 2C11A 1GMPA 4AKZA 1AVLA 4BL2A 1B3SA 3NV0B 1GD4A 2WOHA 4ORLA 1GY5A 3FLJA 1T5YA 1RLSA 4KFDA 1YHQ3 3SEDA 3B4OA 4MMZB 4AEQA 1BNSA 3CCU3 1W2ZA 3NXJA 1ULJB 1JRQA 1QAKA 4FMAA 4HYZA 1UCKA 3UB1A 1VQQA 3LYGA 4OVMA 2KRTA 3QRDA 1LRAA 2R4IA 1VQM3 2XSOB 5AEUB 1VQP3 2CFDA 1TRPA 3CU3A 3LXUX 4MEIA 1KQS2 3NBBA 3V92A 1WMNA 4LGQA 3LH4A 1FA3A 4NPBA 4MMXB 3CCS3 3EJVA 1N9JA 1B2UA 4J8TA 1AVKA 2P05A 3LOYA 1X1XA 2KF6A 3MPHA 5G1KA 3QK9A 3JUOA 3V99A 3MSOA 5D82A 1T2HA 3CMA3 1FGQA 1W01A 3DMCA 4MJDA 1RRHA 2GXFA 1K28A 2XEPA 4XBTA 1RGHA
chains in the Genus database with same CATH topology
1HZ1A 3WR2A 4RNTA 3KCHA 1RGCA 1RN1A 4GHOA 1I3FA 1YGWA 1RGLA 2F5WA 1YNVX 1I2FA 2RBIA 4HOHA 1AQZA 1RHLA 1MGWA 1RGEA 1RNBA 5BIRA 1BGSA 3BU4A 1HYFA 1BRGA 1I2EA 1RN4A 3DGYA 1T2IA 3GSPA 1RNTA 1BVIA 3HOHA 1RGFA 4BIRA 2F5MA 1A2PA 6GSPA 1LOYA 1RGGA 1TRQA 3WHOA 1BRSA 1BNRA 1FZUA 1BU4A 1LOWA 1BNFA 1GOVA 1UCIA 5GSPA 1IYYA 1BRNL 1I3IA 1BSBA 2KF3A 1BRHA 6RNTA 1RDSA 1B21A 1RGAA 1LNIA 1C54A 1FUSA 5RNTA 1X1YA 1BAOA 3D5GA 1UCLA 2HOHA 1BRJA 2KAAA 5HOHA 1FW7A 7RNTA 3AHWA 1B2SA 2GSPA 1PYLA 1RCLA 2KF5A 1BOXA 1CH0A 1JBRA 1RMSA 1BNJA 1FUTA 3AGOA 1BNIA 1BSAA 1GMRA 1LOVA 2BU4A 1SARA 2ZA4A 1BSDA 3AGNA 1RGKA 1BRIA 4J5GA 1PY3A 1X1WA 2SARA 1JBSA 1B2ZA 1RCKA 3RNTA 3D4AA 1FYSA 1X1UA 2F4YA 1BSCA 2AADA 1GOUA 1I8VA 1DE3A 1TTOA 1AY7A 9RNTA 2AAEA 1G02A 1GMPA 1JBTA 1B3SA 1Q9EA 1YVSA 1RTUA 5BU4A 1B2MA 1RLSA 3DH2A 1BNSA 1B2XA 1UCKA 2KF4A 7GSPA 1DETA 2BIRA 1B27A 2C4BA 8RNTA 3Q3FA 1BIRA 1BNEA 1BSEA 1GOYA 1LRAA 1BRKA 2RNTA 1UCJA 1I0VA 3AHSA 3URPA 1GSPA 1GMQA 1TRPA 1I0XA 1R4YA 4J5KA 1MGRA 1BUJA 1B20A 2F56A 1B2UA 1I70A 1X1XA 2KF6A 1BNGA 3D5IA 3A5EA 1ZGXA 1T2HA 4BU4A 4GSPA 1BANA 3SYUA 3BIRA 4HAAA 1I2GA 1RSNA 1RGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ1 A;  3WR2 A;  4RNT A;  3KCH A;  1RGC A;  1RN1 A;  4GHO A;  1I3F A;  1YGW A;  1RGL A;  2F5W A;  1YNV X;  1I2F A;  2RBI A;  4HOH A;  1AQZ A;  1RHL A;  1MGW A;  1RGE A;  1RNB A;  5BIR A;  1BGS A;  3BU4 A;  1HYF A;  1BRG A;  1I2E A;  1RN4 A;  3DGY A;  1T2I A;  3GSP A;  1RNT A;  1BVI A;  3HOH A;  1RGF A;  4BIR A;  2F5M A;  1A2P A;  6GSP A;  1LOY A;  1RGG A;  1TRQ A;  3WHO A;  1BRS A;  1BNR A;  1FZU A;  1BU4 A;  1LOW A;  1BNF A;  1GOV A;  1UCI A;  5GSP A;  1IYY A;  1BRN L;  1I3I A;  1BSB A;  2KF3 A;  1BRH A;  6RNT A;  1RDS A;  1B21 A;  1RGA A;  1LNI A;  1C54 A;  1FUS A;  5RNT A;  1X1Y A;  1BAO A;  3D5G A;  1UCL A;  2HOH A;  1BRJ A;  2KAA A;  5HOH A;  1FW7 A;  7RNT A;  3AHW A;  1B2S A;  2GSP A;  1PYL A;  1RCL A;  2KF5 A;  1BOX A;  1CH0 A;  1JBR A;  1RMS A;  1BNJ A;  1FUT A;  3AGO A;  1BNI A;  1BSA A;  1GMR A;  1LOV A;  2BU4 A;  1SAR A;  2ZA4 A;  1BSD A;  3AGN A;  1RGK A;  1BRI A;  4J5G A;  1PY3 A;  1X1W A;  2SAR A;  1JBS A;  1B2Z A;  1RCK A;  3RNT A;  3D4A A;  1FYS A;  1X1U A;  2F4Y A;  1BSC A;  2AAD A;  1GOU A;  1I8V A;  1DE3 A;  1TTO A;  1AY7 A;  9RNT A;  2AAE A;  1G02 A;  1GMP A;  1JBT A;  1B3S A;  1Q9E A;  1YVS A;  1RTU A;  5BU4 A;  1B2M A;  1RLS A;  3DH2 A;  1BNS A;  1B2X A;  1UCK A;  2KF4 A;  7GSP A;  1DET A;  2BIR A;  1B27 A;  2C4B A;  8RNT A;  3Q3F A;  1BIR A;  1BNE A;  1BSE A;  1GOY A;  1LRA A;  1BRK A;  2RNT A;  1UCJ A;  1I0V A;  3AHS A;  3URP A;  1GSP A;  1GMQ A;  1TRP A;  1I0X A;  1R4Y A;  4J5K A;  1MGR A;  1BUJ A;  1B20 A;  2F56 A;  1B2U A;  1I70 A;  1X1X A;  2KF6 A;  1BNG A;  3D5I A;  3A5E A;  1ZGX A;  1T2H A;  4BU4 A;  4GSP A;  1BAN A;  3SYU A;  3BIR A;  4HAA A;  1I2G A;  1RSN A;  1RGH A; 
#chains in the Genus database with same CATH topology
 2I9W A;  4XB5 A;  1JB2 A;  2PZV A;  3WR2 A;  2YFI B;  3KCH A;  3JVC A;  2P09 A;  1UW1 A;  1WMO A;  3G71 3;  2WGO A;  3I55 3;  1I3F A;  1YGW A;  3CME 3;  1RGL A;  3BLZ A;  1UUG B;  2A15 A;  5EQL A;  1Q42 A;  2ZDJ A;  1GY6 A;  2BT3 A;  2YFL B;  3NV0 A;  2MF7 A;  2HMJ B;  3K0Z A;  1NB5 I;  1HYF A;  1BRG A;  3N54 B;  3ROB A;  1NWW A;  3CNM A;  1TFO A;  4EXR A;  1STD A;  3FGY A;  2BMR B;  4BIR A;  3JUQ A;  4HM7 B;  3OW2 2;  1OGX A;  1A2P A;  4KVH A;  4WYK A;  6GSP A;  2IY2 A;  3GZX B;  2QIY A;  1NU3 A;  1BNR A;  1W2B 2;  1FZU A;  1U8C B;  1N5H A;  1BNF A;  1GOV A;  2OTL 3;  1W02 A;  3ECF A;  2CX0 A;  4KFE A;  1IYY A;  1SQW A;  1E3V A;  2XRX B;  1IVU A;  2OOV C;  4K1U A;  3T8U A;  3PXM A;  1WQL B;  2KF3 A;  3KE7 A;  1BRH A;  3NHX A;  3G16 A;  1RGA A;  3MKI A;  2GBX B;  2RSX A;  3BND A;  2XF3 A;  2OCT A;  4IIA A;  1M1X B;  1FUS A;  3G6E 3;  5IF6 A;  1C54 A;  2STD A;  1BAO A;  2GU1 A;  3FG3 A;  3PS8 A;  4LEH A;  1STF I;  1VQ6 3;  2HOH A;  5DRV A;  2KAA A;  1IQ8 A;  4MMY B;  7RNT A;  1W6G A;  5FW5 A;  2GSP A;  2KXG A;  2JQ5 A;  1Z1S A;  3X42 A;  7STD A;  1CQS A;  2F99 A;  2KF5 A;  1GS3 A;  5IG0 A;  1JBR A;  4GL6 A;  1OAC A;  1US1 A;  3S29 A;  1MWR A;  1FUT A;  5G1L A;  2WGQ A;  3CC4 3;  3HII A;  1BNI A;  5EEO A;  1JB5 A;  1KD1 4;  1DMQ A;  1OF5 A;  1BSD A;  1GD3 A;  2UX0 A;  1O7H B;  5AIF A;  1CYV A;  2BHM A;  2W56 A;  1B2Z A;  4WWU C;  3CCR 3;  5KP1 A;  1AV4 A;  2W56 B;  2J8X B;  3IJE B;  5IEN A;  1SII A;  4H61 A;  2AAD A;  3G8Z A;  3CCM 3;  1I8V A;  1W4N A;  4IT7 A;  1QAF A;  1TTO A;  4WFO A;  1G02 A;  1UDI I;  2GEY A;  4AKY A;  1KWI A;  1AR0 A;  1Q9E A;  2GBW B;  3G4S 3;  5IEO A;  2R41 A;  5EVH A;  3OXA A;  3PCS A;  1U5O A;  1O7M B;  4EV5 A;  1TUH A;  3FF0 A;  1B2X A;  3CCE 3;  1UGI A;  2IMJ A;  3MG2 A;  5AII A;  4LZI A;  1TIJ A;  5STD A;  3FF2 A;  8CHO A;  3MYT A;  1MWT A;  1B27 A;  2C4B A;  3A76 A;  3V98 A;  2Z77 A;  2CX1 A;  1BNE A;  1BSE A;  1W7C A;  2XGL A;  1I0V A;  3WOD G;  1YJ9 3;  2W2C A;  4L8P A;  3X3Y A;  3U1W A;  1DYU A;  1I0X A;  2OTJ 3;  1VQ8 3;  1IT8 A;  1JN5 B;  2W0Q A;  3MHE A;  1MNL A;  4N6V 0;  2FXT A;  1B20 A;  2CWU A;  2B24 B;  4BTW A;  3F8H A;  3S28 A;  1QMA A;  3D5I A;  3HZP A;  2HMO B;  3BNC A;  3A5E A;  5IG4 A;  1ZGX A;  2CK3 H;  1N9E A;  3DM8 A;  5D81 A;  1JNQ A;  4EC6 A;  2KCD A;  2P0X A;  2Y73 A;  2LQV A;  1UI8 A;  4BL3 A;  3DXO A;  3SLU A;  1O7G B;  1LQG C;  1BUQ A;  1NJI 4;  4RNT A;  1ZO2 A;  4RBN A;  2H0H A;  3T8N A;  3D9R A;  1YIT 3;  1YJN 3;  1DVD A;  2CFL A;  1YJW 3;  4GHO A;  4JRF A;  3EBY A;  1YNV X;  5AI1 A;  1GYB A;  4HKV B;  3HI7 A;  3F9S A;  1EA2 A;  1IV9 A;  1MGW A;  1OPY A;  1T3B A;  1VQ4 3;  1VQN 3;  4HM0 B;  1ULI B;  1G96 A;  4EV2 A;  3K63 A;  2D1W A;  1A67 A;  3KZT A;  5AIH A;  3FH1 A;  1T2I A;  4N6M A;  1WTH A;  3GSP A;  2UUG C;  3CC7 3;  4HM5 B;  1IVX A;  4HM8 B;  1EQK A;  2F98 A;  1UI7 A;  4N6L A;  2CC3 A;  5TGN A;  1LOY A;  5IG5 A;  4FR9 A;  5IER A;  1W5Z A;  2IUK A;  1TFK A;  2BMQ B;  3BNE A;  3DZL A;  3F40 A;  2W04 A;  5GSP A;  3MG1 A;  2Y74 A;  2ML5 A;  3HK4 A;  1CYU A;  3D3L A;  4N6N B;  4EYC A;  1W6C A;  1I3I A;  4LSO A;  1OHP A;  5IW9 A;  1B21 A;  2YFJ B;  4FMC A;  4BTX A;  3EE1 A;  4QWT A;  2WOF A;  3Q2P A;  4FMB A;  3NBJ A;  1MOL A;  4FMD A;  3NQZ A;  3AHW A;  1IVW A;  2HMN B;  1OCV A;  3F8X A;  5LC7 A;  3EN8 A;  4CJN A;  1BOX A;  1CH0 A;  2CWT A;  2OWP A;  1ROV A;  3N8B A;  5AIG A;  3AGO A;  1OUN A;  3STD A;  3CPW 2;  3EN1 B;  3S5C A;  1GMR A;  1LOV A;  1NO3 A;  3JUN A;  5CF2 A;  1RGK A;  1BRI A;  4J5G A;  1PY3 A;  1X1W A;  2XSH B;  3E99 A;  2L4V A;  3Q90 A;  2HMK B;  3RGA A;  3CC2 3;  5ELJ A;  1RCK A;  1VQO 3;  3OWU A;  1OGZ A;  2XGN A;  1OF5 B;  2F4Y A;  3DGM A;  3NUV A;  4HM4 B;  1JKG B;  1Q86 4;  4KZ1 A;  1FGO A;  1ZS7 A;  3WMD A;  3RGR A;  1AY7 A;  3FG4 A;  2W03 A;  2YX9 A;  4BTY A;  2RGQ A;  1IDP A;  2INX A;  4RNZ A;  2CFW A;  1RTU A;  5BU4 A;  1B2M A;  1Y4K A;  1ASK A;  1LVN A;  1SIH A;  2XFS A;  5JPP A;  3DH2 A;  3D79 A;  3LTD A;  4CCV A;  1R4C A;  3EHC A;  3EBT A;  4XBX A;  1QVG 2;  1K9M 4;  2KF4 A;  4R9K A;  3J7Y d;  2RFR A;  8RNT A;  1VQ9 3;  1RKY A;  2PNC A;  1BIR A;  2W9P A;  3FG1 A;  4Q53 A;  2BNG A;  1BRK A;  2FNQ A;  1UCJ A;  2RNT A;  3AHS A;  1FUW A;  3UJM A;  1R4Y A;  4J5K A;  2IYJ A;  2CIU A;  1W00 A;  1MWS A;  3BNB A;  4RZM A;  3WOF B;  1MGR A;  1O7N B;  3WOE B;  1BUJ A;  1QAL A;  1IT7 A;  3SOA A;  3LML A;  2IA7 A;  1A2K A;  2K0M A;  4FCZ A;  4JF8 A;  1ISK A;  1JZD A;  1NDO B;  1DMM A;  4KT3 B;  2ML6 A;  3S27 A;  1Q7Y 4;  1G0T A;  1YIJ 3;  1BAN A;  5AYR B;  1IVV A;  1I2G A;  2ZA4 A;  3LT8 A;  1HZ1 A;  4L8O A;  3H3H A;  2D42 A;  4XDW A;  2Q07 A;  2F5W A;  1K8A 4;  3AMO B;  2IUJ A;  3UL6 A;  1LOX A;  3F7S A;  2RBI A;  4HOH A;  1RHL A;  2W9Q A;  1RGE A;  1V58 A;  2P0M A;  2UGI A;  4HM6 B;  4K90 B;  4N6O B;  1RNB A;  1PU4 A;  5BIR A;  3LZA A;  4DKI A;  1OH0 A;  3EF8 A;  3G0K A;  4HZB B;  4LYL B;  4PEJ A;  1SPU A;  1RN4 A;  3B4P A;  1ROA A;  4R9L A;  5M19 A;  1FGT A;  5D83 A;  1KC8 4;  1JV2 B;  1O7P B;  5DRE A;  4U13 A;  1D6Z A;  2LYX A;  1BVI A;  1N8R 4;  1RGF A;  1DVC A;  3NM2 A;  2F5M A;  4FCJ A;  1NNV A;  3UNL A;  3BB9 A;  1OHO A;  4O2H A;  5JPU A;  1JJ2 2;  1TRQ A;  1RGG A;  3GZR A;  4L7K A;  1BRS A;  2OQE A;  5BXQ A;  4WP5 A;  2FGT A;  4O8S A;  1LOW A;  3CXC 2;  2CG0 A;  5AEW B;  3CD6 3;  1Q7H A;  1ZX2 A;  3VGN A;  4I5Q A;  3PCR A;  3KII A;  1F8N A;  4ZM8 A;  5CLK A;  1BSB A;  1E3R A;  1CEW I;  3DUK A;  1RJO A;  5G2G A;  3SX1 A;  2HMM B;  2B1X B;  3EB8 A;  5A0O B;  6RNT A;  1Q82 4;  3ALA A;  3OWS A;  1JB4 A;  4X2O A;  2XFT A;  3M8C A;  1K73 4;  1LNI A;  1V57 A;  3NX0 A;  2CG1 A;  3WDG B;  4K1V A;  4TX4 A;  2BO9 B;  1D6Y A;  1HU9 A;  1UCL A;  1YVB I;  2MC8 A;  1WNH A;  1BRJ A;  2GU3 A;  3FSD A;  1Q40 A;  3WA3 A;  1B2S A;  2XH9 A;  3NQY A;  1RCL A;  3KN4 A;  5AYS C;  2HML B;  3F14 A;  4R4K A;  3ZG0 A;  2QA4 3;  1TJD A;  1K41 A;  4OK0 A;  1RMS A;  1BNJ A;  2V1L A;  4CDL A;  5I97 A;  2OOV A;  1BSA A;  3B7C A;  3OX9 A;  5KP4 A;  3DY5 A;  1HKX A;  1JKG A;  1SAR A;  3AGN A;  4LMI A;  5IEP A;  4EW5 A;  4XDV A;  1VZZ A;  1V74 A;  4XM4 A;  1E97 A;  1D6U A;  4HBR A;  4HM1 B;  2H0G A;  1UGH I;  1FYS A;  1VQ5 3;  3SOY A;  3FZW A;  1BSC A;  1WMP A;  1DE3 A;  1S5A A;  2W6J H;  2ZHX B;  3X40 A;  6STD A;  3I0Y A;  2AAE A;  2ZL8 A;  3NM7 A;  3ZFZ A;  1SJW A;  1JBT A;  4O3V A;  5M1A A;  1JN5 A;  1IQY A;  1YVS A;  3PYJ A;  2CKF B;  2L1S A;  3LT9 A;  3I56 3;  1LXE A;  2CFK A;  5CF1 A;  3KKG A;  1VQL 3;  2CWV A;  3OV4 A;  4N3V A;  1IV7 A;  4KFF A;  1N5P A;  4G1M B;  1IQX A;  4EBG A;  2QEX 3;  7GSP A;  1DET A;  4FCM A;  3CCL 3;  1O7W B;  1PFP A;  2SBL A;  2BIR A;  2Z7A A;  3GZY B;  1VQ7 3;  1VQK 3;  3Q3F A;  1GOY A;  2O3O A;  3MG3 A;  5CK6 A;  4HM2 B;  3B8L A;  1GY7 A;  3URP A;  1GSP A;  1GMQ A;  3JUP A;  2Z6B A;  3PGB A;  4RNY A;  1J2B A;  3X3X A;  4J9A A;  1QJG A;  3X3Z A;  3WA2 X;  1MWU A;  2CH9 A;  4GB5 A;  2K3D A;  5FGO A;  2F56 A;  3HIG A;  3H51 A;  4HM3 B;  5ELU A;  3NBR A;  1TP6 A;  4NHF A;  1I70 A;  1BNG A;  1N8Q A;  2GEX A;  4OUQ A;  3K5T A;  3L0R A;  3SXX A;  3CCJ 3;  3U97 A;  4BU4 A;  3ER7 A;  4N6T A;  3MWZ A;  4GSP A;  3SYU A;  3BIR A;  3LTC A;  2E2U A;  4HAA A;  1RSN A;  1A90 A;  3RDE A;  3GAX A;  1YI2 3;  2H0I A;  2Z76 A;  4NRE A;  1EEJ A;  1RGC A;  1RN1 A;  3JUM A;  3PZW A;  5BVB A;  1RN7 A;  2CW9 A;  3DGO A;  2JDI H;  1LNH A;  1I2F A;  1YGE A;  4R80 A;  1IK3 A;  4K61 A;  1AQZ A;  1NB3 I;  2XR8 B;  3N9H A;  4X2H A;  1LQM B;  1BGS A;  3BU4 A;  3UL5 A;  3GWR A;  1I2E A;  1DMN A;  4STD A;  3DGY A;  1M9G A;  3F7X A;  1RNT A;  1EUI C;  3HOH A;  3O8Y A;  4ILF A;  3DGL A;  3K9M C;  5CXO A;  5IG3 A;  5HGR A;  1FGR A;  1FGM A;  4HVN A;  3CNX A;  1A2V A;  3FKA A;  3K7C A;  3WHO A;  1BU4 A;  1IU7 A;  2M7O A;  3KSE D;  3EX9 A;  5KP3 A;  3X41 A;  1UCI A;  3IPT A;  5JBS A;  3EQQ B;  3VF1 A;  1BRN L;  4XBY A;  1EG9 B;  2K54 A;  4I4K A;  1C7H A;  1JZO A;  3SVA A;  3TDG A;  1TU5 A;  1Q40 B;  3VSY A;  2OQE C;  1RDS A;  2RCD A;  3LTB A;  1UUW B;  1EKM A;  5LC6 A;  5RNT A;  1X1Y A;  3ZG5 A;  3D5G A;  2WO0 A;  3LTA A;  2BMO B;  3GRD A;  5HOH A;  1FW7 A;  1QVF 2;  4HZ9 B;  1PYL A;  3HX8 A;  3KSP A;  4WHA A;  3KFQ C;  4R1K A;  1L5G B;  1KSI A;  1M1K 4;  1Q81 4;  3AMO A;  3S67 A;  4N6U A;  2E2T A;  1RRL A;  2F86 B;  2QGU A;  2BU4 A;  4CPK A;  3CCV 3;  3T0U A;  1UUV B;  5M18 A;  3FCS B;  1W6Y A;  3EC9 A;  3GZB A;  4HJL B;  3CCQ 3;  4IPB A;  1S72 3;  4WYK B;  1M90 4;  2SAR A;  2C10 A;  3IMA B;  1JBS A;  3RNT A;  3D4A A;  4H3U A;  1X1U A;  2E2V A;  3OWY A;  2CFG A;  1OHS A;  2CHC A;  1GOU A;  2O9U X;  3CPO A;  3Q1C A;  3DGN A;  2P38 A;  9RNT A;  4O02 B;  2C11 A;  1GMP A;  4AKZ A;  1AVL A;  4BL2 A;  1B3S A;  3NV0 B;  1GD4 A;  2WOH A;  4ORL A;  1GY5 A;  3FLJ A;  1T5Y A;  1RLS A;  4KFD A;  1YHQ 3;  3SED A;  3B4O A;  4MMZ B;  4AEQ A;  1BNS A;  3CCU 3;  1W2Z A;  3NXJ A;  1ULJ B;  1JRQ A;  1QAK A;  4FMA A;  4HYZ A;  1UCK A;  3UB1 A;  1VQQ A;  3LYG A;  4OVM A;  2KRT A;  3QRD A;  1LRA A;  2R4I A;  1VQM 3;  2XSO B;  5AEU B;  1VQP 3;  2CFD A;  1TRP A;  3CU3 A;  3LXU X;  4MEI A;  1KQS 2;  3NBB A;  3V92 A;  1WMN A;  4LGQ A;  3LH4 A;  1FA3 A;  4NPB A;  4MMX B;  3CCS 3;  3EJV A;  1N9J A;  1B2U A;  4J8T A;  1AVK A;  2P05 A;  3LOY A;  1X1X A;  2KF6 A;  3MPH A;  5G1K A;  3QK9 A;  3JUO A;  3V99 A;  3MSO A;  5D82 A;  1T2H A;  3CMA 3;  1FGQ A;  1W01 A;  3DMC A;  4MJD A;  1RRH A;  2GXF A;  1K28 A;  2XEP A;  4XBT A;  1RGH A; 
#chains in the Genus database with same CATH homology
 1HZ1 A;  3WR2 A;  4RNT A;  3KCH A;  1RGC A;  1RN1 A;  4GHO A;  1I3F A;  1YGW A;  1RGL A;  2F5W A;  1YNV X;  1I2F A;  2RBI A;  4HOH A;  1AQZ A;  1RHL A;  1MGW A;  1RGE A;  1RNB A;  5BIR A;  1BGS A;  3BU4 A;  1HYF A;  1BRG A;  1I2E A;  1RN4 A;  3DGY A;  1T2I A;  3GSP A;  1RNT A;  1BVI A;  3HOH A;  1RGF A;  4BIR A;  2F5M A;  1A2P A;  6GSP A;  1LOY A;  1RGG A;  1TRQ A;  3WHO A;  1BRS A;  1BNR A;  1FZU A;  1BU4 A;  1LOW A;  1BNF A;  1GOV A;  1UCI A;  5GSP A;  1IYY A;  1BRN L;  1I3I A;  1BSB A;  2KF3 A;  1BRH A;  6RNT A;  1RDS A;  1B21 A;  1RGA A;  1LNI A;  1C54 A;  1FUS A;  5RNT A;  1X1Y A;  1BAO A;  3D5G A;  1UCL A;  2HOH A;  1BRJ A;  2KAA A;  5HOH A;  1FW7 A;  7RNT A;  3AHW A;  1B2S A;  2GSP A;  1PYL A;  1RCL A;  2KF5 A;  1BOX A;  1CH0 A;  1JBR A;  1RMS A;  1BNJ A;  1FUT A;  3AGO A;  1BNI A;  1BSA A;  1GMR A;  1LOV A;  2BU4 A;  1SAR A;  2ZA4 A;  1BSD A;  3AGN A;  1RGK A;  1BRI A;  4J5G A;  1PY3 A;  1X1W A;  2SAR A;  1JBS A;  1B2Z A;  1RCK A;  3RNT A;  3D4A A;  1FYS A;  1X1U A;  2F4Y A;  1BSC A;  2AAD A;  1GOU A;  1I8V A;  1DE3 A;  1TTO A;  1AY7 A;  9RNT A;  2AAE A;  1G02 A;  1GMP A;  1JBT A;  1B3S A;  1Q9E A;  1YVS A;  1RTU A;  5BU4 A;  1B2M A;  1RLS A;  3DH2 A;  1BNS A;  1B2X A;  1UCK A;  2KF4 A;  7GSP A;  1DET A;  2BIR A;  1B27 A;  2C4B A;  8RNT A;  3Q3F A;  1BIR A;  1BNE A;  1BSE A;  1GOY A;  1LRA A;  1BRK A;  2RNT A;  1UCJ A;  1I0V A;  3AHS A;  3URP A;  1GSP A;  1GMQ A;  1TRP A;  1I0X A;  1R4Y A;  4J5K A;  1MGR A;  1BUJ A;  1B20 A;  2F56 A;  1B2U A;  1I70 A;  1X1X A;  2KF6 A;  1BNG A;  3D5I A;  3A5E A;  1ZGX A;  1T2H A;  4BU4 A;  4GSP A;  1BAN A;  3SYU A;  3BIR A;  4HAA A;  1I2G A;  1RSN A;  1RGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...