2RCBA

Crystal structure of the nr3b ligand binding core complex with d-serine at 1.62 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
282
structure length
282
Chain Sequence
RPKLRVVTLVEHPFVFTRESDEDGQCPAGQLCLDPGTNDSARLDALFAALVNGSVPRTLRRCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRGTELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of ligand recognition by NR3 subtype glutamate receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate [NMDA] receptor subunit 3B
total genus 96
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2rcbA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2rcbA02
4C1UA 2DS9A 3V89B 3RY3A 1N04A 4OFOA 1FTKA 2Y7PA 3I6VA 3H6UA 4NE4A 3FJMA 3K2DA 5KZTA 2VD3A 2W7YA 4U1ZA 4KYSA 3TTRA 3G7WA 1FQAA 5AA2D 1ZIUA 5H8QA 3TODA 3MJNA 4Z7EA 1VR5A 3K1PA 1Y9UA 3PPPA 3U94A 5I2NA 2ZNTA 4FIMA 1TXFA 3VLUA 4LZ8A 1QW0A 4XKRA 5IAIA 1UIVA 2HZKA 1PB8A 3MUQA 4LP2B 4ZEKA 1B5JA 3Q29A 2D5WA 3TELA 4U2RA 1D9YA 4ELOA 3CI8A 1AH5A 4F1UA 3VVDA 2UVJA 1I69A 5AA2B 3V8XB 3U8QA 5H8FA 1B7ZA 3JYRA 2P2AA 2DE3A 3KOSA 3IB1A 1B7UA 2OZZA 2FA7A 4GRKA 3U1OA 1DMBA 5CC2A 1AOVA 1A99A 1WDNA 4THIA 1OIBA 1MQGA 4OVJA 1GTKA 4GQOA 4G8NA 3KBRA 1B3EA 1A55A 3TQWA 2AYSA 2XXVA 3ILTB 2F7CA 4GXAA 1O7TA 1URGA 1H44A 3HO7A 3PPRA 4C1TA 1B4HA 3JV9A 2DE2A 2PX1A 3B6QA 3O28A 2F5XA 3MW0A 4YB5A 1MXVA 4RYAA 5KDTA 3T93B 2O6AA 2Q2CA 4OENA 5H8HA 3EHTA 3VE1B 5H8QB 2ALUA 4YB7A 3W15C 2XXUA 3H06B 4DXCA 1B1XA 3DM0A 4R73A 3DELB 1FTOA 2I4CA 1IEJA 5CMMA 2THIA 3CG1A 2Y7IA 1LGBC 1MXZA 1USYE 2XX9A 3IJXB 3SEWA 4BDMA 3S9EA 4DCYA 4QRZA 5AA2A 2VHAA 5AA4A 3H03A 3ZKKA 1FQBA 4LATA 4QFOA 1H45A 5I2KB 4IO4A 4YZZA 5H8NA 4LZ7A 1OLCA 2FNCA 3C9HA 4NWCA 4ZDMA 1GGGA 2AL5A 1SW1A 2HQ0A 4FEDA 4JDFA 3TDJA 1N3XA 4F18A 5TPAA 1MH4A 1YTVA 2GHBA 4NF6A 5DVIA 3G3IA 3SEVA 3S4UA 3THIA 1XOCA 5TP9A 1LSTA 1QUIA 3FD3A 3K1NA 2QMWA 3MVXA 1Y1MA 4TQUQ 3G3FA 4OETA 2GHAA 4ECFA 4UA8A 3CFLA 3S9NC 1N0TA 3TQLA 3E13X 1Y20A 2PT1A 4OTEA 5LOMA 4R74A 2GFEA 3TYHA 3C33A 3K01A 4ELQA 4ESWA 3LSXA 4Z0IA 3FXUA 5JTYB 5I56A 3E4RA 3QK6A 5DVFA 5DVJA 1LFIA 2ESNA 3ONMA 1B05A 2I48A 4R2BA 1NNKA 1AMFA 4ZEIA 2OJTA 1FQCA 4I1DA 3T9XB 1B9JA 1J1NA 1DTGA 4ZE9A 2QS2A 3UGWA 5I59A 1O63A 4N6PA 1B4ZA 1POTA 3IR1A 1MDQA 2XXTA 2DVCA 5I59B 3LSLA 1EZPA 3Q27A 3RT6B 4XKPA 3N94A 5H8NB 3MZ9A 3HCQA 5ICQA 4AQ4A 3E3KA 3K02A 3TMGA 2CZLA 3OOAA 1I6AA 1IXGA 1NKXA 2KLFA 1FQEA 2HCAA 2I58A 2PMSA 3P7IA 2Y7RA 4MLQA 3FXRA 2DWHA 4GL0A 4IY6A 1P1QA 3HHFA 5HM4B 5KDTB 1Z7NE 2F7AA 1B51A 1FTJA 5BWJA 4G77A 4C0RA 5I57A 5I84A 2OCUA 2OWSA 3G3HA 4F29A 4L17A 4GXSB 4R2FA 3V5AA 3DLNA 4RY1A 2H25A 1NFTA 4JSDA 1SVXB 4HCYA 1MY0A 3N6UA 4TLMB 1Z7ME 5CMCA 2Z8EA 3FGSA 2DOJA 3O97A 3TTKA 2UVHA 4BDNA 5H8HB 3LBSA 4F3SA 3OO6A 1JQFA 3K1MA 1NH7A 1SDXA 2OK2A 4NF5B 4PFWA 4XXUA 1LFGA 1PBQA 3PD8A 3IL1B 3SDFA 1I6QA 3TPAA 2F97A 4H5FA 3PPOA 5AE4A 1PB9A 4ZE8A 3PMVA 3QUFA 3FIRA 5TPAB 3T66A 1FTLA 3N5LA 4JWXA 3VXCA 4DDDA 2P0SA 1P1WA 2XXYA 3F11A 3FUZA 4I62A 4NTLA 3C35A 4ONYA 2OBGA 2UYFA 3FJ7A 2HZLA 2RCAA 3WAEA 4EDPA 4HW8A 4GF8A 1NNPA 1MXYA 2UXAA 1OQHA 2HFBA 1LBBA 1XS5A 1B52A 4G8MA 3VXBA 2PYYA 1N7WA 1MM7A 4NF6B 2E0SA 1PDAA 2VD2A 1MPCA 3QUJA 2Q2AA 2B65A 3CSBA 4H8JA 4O3BA 4XTCQ 2FYIA 4ZZEA 3FJGA 3TFLA 3ZKLA 2VOZA 4FAJA 2I4BA 5JTYA 3FV1A 3KJ7A 4M1VA 2F34A 1AIVA 4QFNA 1MY2A 5ICTA 2F7BA 2A5TA 1MRPA 3MP6A 2HEUA 2O51A 2V25A 4H6DA 4NF4B 4PFUA 5HBCA 4RA1A 2OWTA 4KQPA 3UORA 4DZ1A 4GWOA 3D4CA 3O6HA 4KD5A 4IY5A 3LSFB 4OFJA 3VV5A 5J1DA 4UACA 2ONKE 4QHQA 4YMBA 1JW4A 1URDA 4G8HA 4YKKA 2HAUA 3R26A 1MXWA 1BKAA 3O66A 1GVCA 4WXJA 3H7MA 1Y3QA 2H99A 2HXWA 3MPKA 1B5HA 3V83A 1B3GA 1I6BA 4ZECA 1M5DA 1P1NA 2R6GE 3C4MA 1BTJA 1QJMA 4KYEA 4PETA 4IGRA 3GBBA 1FW0A 2B3FA 3L6GA 1B1HA 2O68A 3A09A 4OYVA 1PC3A 4OZ9A 2DE4A 4WEDA 4NEDA 2DWJA 1OLAA 4FJPA 3FASA 3KN3A 1B0HA 3ODBA 1M5FA 4Q0CA 4IO5A 1F9BA 1DTZA 4GL8A 3OSRA 5K2XA 1Q1KA 1Y4CA 1NH8A 4F3PA 2R71A 3SESA 3KOTA 4Q5TA 1R1NA 3IOTA 1LB9A 3PUYE 3FV2A 1VSOA 3FXQA 2B3BA 4MH5A 3SEXA 3PMXA 3SEUA 5AA1A 5CBRA 5I57B 5L9MA 1JEUA 1DPEA 2XX8A 2F6PA 3M3KA 4IO6A 4ZS9A 1VFDA 4LA9A 5FHNA 3SKPA 2ZNUA 4OESA 1HSJA 1CE2A 4R9FA 1ZU0A 4LQ5A 3IB0A 3TTNA 5A5XA 1II5A 2OLBA 2PBWA 3VLVA 3EHUA 4JBZA 1LB8A 2XXPA 3GLBA 3HN0A 4HS7A 1T0KA 3B6TA 2XXXA 3BFTA 5CBSA 1WODA 2ABHA 1JVXA 2QL3A 2WKYA 3FATA 1LAHE 4YU0A 4KHZE 1PB7A 4F22A 3N26A 3O6GA 1N84A 3H3GA 1CB6A 2E1SA 2I49A 2RC8A 2I3WA 3IB2A 3LC8A 4JWOA 1B3LA 4O3CA 4RPNA 5FTHA 1MS7A 4IO7A 2ZXTA 3AXFA 3MC2A 4RK2A 1JW5A 3FVOA 4JWYA 2I0BA 3LSWA 2X7QA 3LR1A 1SW5A 1B46A 1MPBA 4XKNA 5FTIA 2GH9A 4I9DA 1RYXA 1ZMGA 2A5TB 1XHYA 1PEBA 4NF4A 3RUMA 3C31A 2H98A 3O6IA 4POXA 3MZ1A 1LBCA 3PU5A 4DXBA 1SYHA 2ZYNA 3QXMA 1B3HA 1MQIA 1D3KA 5KCJB 3S9MC 1FCKA 3IORA 1TFDA 1H76A 1USYH 1ELJA 2QS1A 1YCJA 4X48A 1B58A 1XT8A 3EPEA 4RJZA 2NOOA 3FVKA 2XX7A 4Q8RA 2REGA 3MP1A 3GBAA 1JETA 1LAGE 1D4NA 3K6UA 2Q8JA 5DYHA 1B2HA 4H0WA 4Q30B 3MVWA 4NMYA 4F1YA 2HAVA 2XHDA 1NL5A 2XXWA 4U23A 5ITPA 1R9LA 4KI0E 5L9SA 5IKBA 1JW1A 4QF9A 1QULA 3MBPA 3ECRA 2NUVA 1LAFE 2RKMA 4MFIA 3KEIA 1S7YA 3DP6A 3KG2A 3OXNA 1ZJLA 2M8CA 2V84A 4U21A 3KZGA 4YKIA 4G4PA 4FORA 2ANJA 4JB7A 1OQGA 3PUXE 4X9TA 4ZEFA 1MM6A 1QVSA 1EU8A 3OELA 3M3LA 4YKJA 1VFEA 5TP9B 2LAOA 4LVQA 2DP8A 3USDA 3VVEA 2IEEA 3HPIA 4XKQA 4M4GA 1SQYA 3HSTA 3O2AA 4H65A 4QSEA 3MQ9A 4R6KA 3T9VA 2XXIA 3QSLA 4KCCA 4BDOA 5BUUA 1JNFA 4HTGA 1IZ1A 4PE5B 5EYFA 1GV8A 3M8UA 5CMKA 4QSDA 2XXHA 3H6TA 3OMBA 2DXRA 1R6ZA 2H4IA 2V93A 3PPQA 4R9GA 1M5CA 2QJEA 3VDFA 1B3FA 2QRYA 5I56B 5JK4A 2Z22A 4F2QA 4F1VA 3C36A 1ZTYA 4E0XA 2ZYOA 4DCXA 4O3AA 4MF3A 4EF2A 4H1XA 4BDLA 3TCFA 4MBPA 4FECA 4NF8B 1UQWA 3KSXA 5A5XB 4JXIA 4N13A 4F3GA 1OVBA 3C34A 1YPNA 3I5OA 5DEXA 3UA8A 3PV0E 4KPTA 3ILUB 4IGTA 4GLIA 4X1BA 1IXCA 4IO2A 3R6UA 1HSLA 2DYXA 4P0GA 4POWA 2NWJA 3QYTA 3KSJA 4LUBA 4GD5A 3TZAA 4OEUA 4DXUA 1BP5A 3R7XA 4PFYA 2F78A 5AA3A 3CRBA 3UP9A 3BKIB 2DSFA 2PT2A 2D3IA 3IX1A 1A8EA 4LZ5A 2O1MA 3Q28A 3RNNA 2P1SA 5I2NB 1ZBMA 2H5YA 4LONB 3PD9A 4DIGA 2DVZA 2XD2A 2ONSA 1SD3A 2DWAA 1Y3PA 4DE8A 4YKPA 5FHMA 4F31B 3LUYA 5KCJA 3EF7A 5HPQA 1Y3NA 1MQJA 2D21A 4ZZAA 1N7XA 2Q9TA 4ELPA 4RNSA 4FE8A 2VGQA 3N6TA 4KR5A 2Q88A 4OQOA 1VE4A 2I0CA 2R9JA 2QSXA 2O69A 3RT8A 4F39A 1MY3A 3BFUA 3EN3A 4BDRA 4DLDA 5L8DA 5FHOA 2A5SA 4BDQA 3VFJA 2V3TA 4GIZA 3H4ZA 3PUZE 1IUDA 3IO6A 4ELRA 2Z23A 2AIXA 2DWIA 1FTMA 1MXXA 4EQBA 2Y84A 2UVIA 5ISUA 1WVJA 1IIWA 1B6HA 1LLSA 2YJPA 2Q89A 4IB2A 3JZJA 3O9PA 1LCFA 1B7HA 2X26A 1NMUA 2GRVA 3OEKA 4GVOA 4KCDA 2O7UA 1N3WA 1UIUA 3G3GA 5ITOA 3K6WA 3RLFE 2V3UA 2ZYMA 3SETA 4U4SA 3M3FA 3RPWA 2QMXA 3PPNA 2Y7KA 1MQHA 3DP4A 3D4GA 4LQ2A 4OXVA 2O7IA 3E9XA 1L5TA 3HHGA 1P1OA 2RF1A 3T22A 4EXLA 1AL3A 3CR9A 3TEPA 1LAXA 4G68C 4OEVA 1LCTA 4RXLA 5CRYA 5EHSA 1US4A 4ZEDA 2G93A 4NF8A 2XD3A 4QFPA 3ZS6A 1MPDA 5AA4B 3QAXA 4JSOA 3FVNA 2XXQA 2F36A 4WKMA 5DEXB 3CG3A 4H8IA 3UK4A 1FQDA 2REJA 1HSEA 1Y1ZA 1XC1A 1TFAA 1A8FA 1UTHA 4F2OA 3O29A 1MG1A 3CFXA 3RGYA 4TOZA 5EHMA 3IAZA 3KN7A 1ZKBA 3OENA 1SI1A 3MP8A 4OMBA 3TTLA 3RTWB 3U93A 1IXHA 2H9BA 1S9TA 3TCHA 1M5BA 4MLVA 1QUKA 1D9VA 2UYEA 3G3JA 3S2VA 2QPQA 1Q35A 4P11A 4AB5A 5CI5A 1O64A 1URSA 2RC9A 3IOUA 4PP0A 3UIFA 3W9VA 1DPPA 1EZ9A 3Q25A 3CIJA 3CFZA 4G2ZA 3TCGA 5I58B 3L6HA 4G68B 2XXRA 4HCWA 4QFLA 3KN8A 2ZNSA 2X7PA 3PUWE 3IJOB 2UVGA 4R75A 1OVTA 3A3UA 5ELVA 3EHSA 4N07A 1ATGA 2DQVA 1QUJA 3OO8A 2AL4A 4F3BA 5K2YA 1EH3A 1P99A 4R6HA 4PQJA 3IOWA 1KWHA 3S9LC 3G3KA 2F6GA 1JVYA 2BJJX 1SW2A 3RQTA 3ZSFA 4ESXA 3PUVE 1DSNA 4OFLA 2Y7WA 1PBPA 1UTBB 3SEYA 4RPOA 4ZEBA 1TT1A 3PGFA 4OWDA 4PFTA 4FATA 4EXKA 3IOVA 5B70A 4H67A 3TTMA 3OO7A 1IQ7A 3FVGA 3GXAA 3CSGA 4U4XA 2Z8DA 3T96B 4U22A 1N76A 3K4UA 4XIGQ 2NVUB 2ZMBA 4AB6A 3TAJA 5H8SA 3HV1A 5CMBA 4ND9A 1MQDA 4EQ9A 4KFQA 1H3DA 5JEIA 3A3CA 3KJTA 1B5IA 3K6VA 3MZBA 1DOTA 1ANFA 1JEVA 3EQ1A 4P0IA 2O1LA 4NF5A 1B32A 2F8DA 4OERA 5DT6A 4YMAA 4OHNA 2QS3A 5TU0A 2QS4A 1Y4TA 2I3VA 2ZYKA 1MDP1 1SI0A 2G29A 3MWBA 3OSQA 4EQ7A 5L9OA 1A54A 1S50A 2RINA 3BBRA 4QSCA 4K3FA 2IA4A 4I8CA 3RN8A 2O84X 1QKBA 2ONRA 1A40A 1M5EA 2Z8FA 2RC7A 1XVYA 4E0WA 3SERA 1LFHA 1MH3A 4BLAA 3MPLA 1YAEA 4GFRA 1UTHB 4NWDA 3U72A 3MAMA 4EF1A 4IO3A 3OEMA 1UTBA 4YAHX 2I6EA 3KFMA 4WEPA 5B7DA 3MVZA 1B0LA 1IXIA 1GR2A 2PVUA 1SBPA 2YPNA 3DP8A 3IO4A 1BLFA 3KGCA 3K00A 4R6YA 4U1OA 5CM6A 1NNTA 2DXYA 5I58A 3T9HB 2V3QA 3H6VA 1FQFA 1BIYA 3MVYA 1B40A 3W9WA 1TWYA 3K6XA 3K0VA 3TKDA 3VLWA 4EUOA 4ISUA 4F19A 1XVXA 3GZGA 4H5GA 4R72A 2CMOA 4FEBA 5F7VA 3WAFA 3TUSA 3FZVA 4YB6A 2RCBA 5F1QA 3RTFB 5H8FB 1IITA 2NXOA 4G68A 5DTBA 1EZOA 3OO9A 4X1DA 2YLNA 4TLLB 5I2KA 4KYDA 4QFKA 1RYOA 4GOTA 1ZLQA 3IK6B 4YICA 1QKAA 3CVGA 1R9QA 1H43A 1SW4A 3B7DA 1US5A 3Q26A 3UN6A 1P1UA 3H6WA 1MY1A 3OD7A 1NNFA 3PMWA 1RKMA 3C32A 3I3VA 1A7LA 1OMPA 2VP1A 3T9UA 4RK9A 5M2VA 3B6WA 3U92A 1MY4A 3QIMA 2F35A 1SYIA 1POY1 1MXUA 3VVFA
chains in the Genus database with same CATH superfamily
2DS9A 3RY3A 1N04A 4N17A 2Y7PA 2VD3A 4U1ZA 4KYSA 5AA2D 3PPPA 3K1PA 1QW0A 3B8BA 3MUQA 4ZEKA 3Q29A 4ELOA 2D5WA 1AH5A 4HE1A 2UVJA 5AA2B 3U8QA 1LBXA 3IB1A 2FA7A 3B50A 1B3EA 1A55A 3TQWA 3ILTB 2F7CA 1URGA 1B4HA 3JV9A 2PX1A 2F5XA 4YB5A 5KDTA 2O6AA 4OENA 5H8HA 5H8QB 2XXUA 3H06B 1B1XA 4R73A 1FTOA 3SEWA 1LGBC 3IJXB 4BDMA 2WYKA 3H03A 4NWCA 4ZDMA 1SW1A 2GHBA 2HHMA 1XOCA 3K1NA 1YZ0A 2OX3A 1Y1MA 4OETA 3CFLA 3S9NC 5J16A 5JTYB 2ESNA 1B05A 1NNKA 1AMFA 4I1DA 4ZE9A 1POTA 1MDQA 3LSLA 3MZ9A 5ICQA 4AQ4A 3E3KA 2PMSA 2ZZVA 2Y7RA 3P7IA 1P1QA 1IMEA 1B51A 4C0RA 1SVXB 4HCYA 4TLMB 2Z8EA 3FGSA 1LBYA 4N4UA 5H8HB 3LBSA 2B4MA 4NF5B 3PD8A 1I6QA 3TPAA 1RDXA 4DDDA 5IZ1A 4JWXA 5I59B 2P0SA 3F11A 3FUZA 3C35A 4EDPA 4HW8A 1JP4A 1NNPA 1MXYA 1B52A 2PFZA 2VD2A 1MPCA 3QUJA 2Q2AA 4ZZEA 1AIVA 1MY2A 4NF4B 2O51A 4PFUA 4P8BA 5HBCA 2OWTA 4KQPA 3QMFA 4IY5A 5J1DA 5LTCA 4UACA 1URDA 3R26A 2HXWA 4PETA 4IGRA 3GBBA 2B3FA 3TYHA 3L6GA 1B1HA 4NEDA 1OLAA 1B0HA 4Q0CA 4IO5A 5K2XA 3FBPA 1LB9A 3PMXA 5CBRA 4PCDA 2XX8A 3M3KA 5FHNA 2CEXA 4R9FA 3IB0A 5A5XA 1FRPA 2OLBA 2PBWA 3EHUA 1LB8A 3HN0A 3B6TA 2XXXA 3BFTA 2ABHA 1NUWA 1LAHE 4YU0A 3N26A 3O6GA 2I49A 3LC8A 4JWOA 1B3LA 4IO7A 3LR1A 1SW5A 1B46A 1RYXA 2A5TB 4F18A 1XHYA 4DXBA 2H98A 3PU5A 1B3HA 5KCJB 3S9MC 1YCJA 1XT8A 4RJZA 3K6UA 2Q8JA 5DYHA 4H0WA 2HAVA 1R9LA 4AS4A 2NUVA 1OQGA 3OELA 3M3LA 5A5LA 5FBPA 4LVQA 2DP8A 2IEEA 4MCOA 4XKQA 3QSLA 3H6TA 3RYDA 1R6ZA 2H4IA 2V93A 3PPQA 4R9GA 2QJEA 4MEVA 2ZYOA 4O3AA 4EF2A 2XWIA 4H1XA 4BDLA 3TCFA 5A5XB 3C34A 1K9YA 3UA8A 3PV0E 4GLIA 4X1BA 5IM2A 1NV7A 1HSLA 2DYXA 4GD5A 4OEUA 4PFYA 5AA3A 3BKIB 2PT2A 4LZ5A 2O1MA 4O7IA 2ONSA 5DW8A 5FHMA 5KCJA 3LUYA 3EF7A 5HPQA 1VDWA 2D21A 4ELPA 1KA1A 2Q88A 2VPNA 2I0CA 4DLDA 3IFCA 3IO6A 4ELRA 1FTMA 1XI6A 2V4CA 1LLSA 4IB2A 5IZ3A 2Q89A 1FTAA 1LCFA 2X26A 1NMUA 2GRVA 3OEKA 1UIUA 3G3GA 4GWWA 3K6WA 2QMXA 2Y7KA 3D4GA 4OXVA 2O7IA 3E9XA 3HHGA 2HPGA 4EXLA 3T22A 1AL3A 2QVRA 1DBZA 1LCTA 5EHSA 1NV4A 4RXLA 1US4A 2G93A 4NF8A 2XD3A 4QFPA 5DEXB 1FQDA 1XC1A 1TFAA 1UTHA 4F2OA 3RGYA 3KN7A 1FJ6A 1ZKBA 4OMBA 3MP8A 3U93A 1IMFA 1D9VA 3G3JA 4P11A 4AB5A 1O64A 4PP0A 2P3NA 2XXRA 3PUWE 3PTYA 2UVGA 3A3UA 3EHSA 1G0HA 1ATGA 2FVZA 1P99A 3GYYA 1KWHA 1JVYA 2F6GA 2BJJX 2F3BA 3RQTA 1TT1A 4PFTA 3TTMA 1IQ7A 3GXAA 3CSGA 4U4XA 1N76A 3K4UA 2NVUB 3TAJA 1MQDA 5EYHA 3KJTA 1B5IA 3MZBA 1DOTA 5DT6A 2QS3A 2QS4A 1Y4TA 2I3VA 3KC1A 1MDP1 3MWBA 3E79A 5I5PA 3BBRA 4I8CA 4E0WA 3ISPA 1MH3A 4BLAA 1UTHB 4IO3A 3OEMA 2I6EA 5B7DA 1IXIA 2PVUA 3DP8A 2YPNA 2PFYA 4PE3A 3K00A 4U1OA 3T9HB 3H6VA 1B40A 3K6XA 5EQ9A 5F7VA 1IITA 1EZOA 5I2KA 1RYOA 4GOTA 4YICA 3Q26A 1SW4A 3UN6A 3H6WA 1MY1A 3OD7A 3PMWA 3C32A 3I3VA 1OMPA 2FBPA 2OWZA 3B6WA 4C1UA 3H6UA 5ET6A 3FJMA 3K2DA 1FQAA 5H8QA 3MJNA 4Z7EA 1Y9UA 3U94A 5I2NA 2ZNTA 1TXFA 3VLUA 4LZ8A 1UIVA 4LP2B 3CI8A 1I69A 3V8XB 3D1RA 2P2AA 3KOSA 1B7UA 1G0IA 2OZZA 4GRKA 5CC2A 1DMBA 1WDNA 5LDZA 1OIBA 5T3JA 2R8TA 4G8NA 3KBRA 2WX9A 1H44A 2DE2A 3O28A 1MXVA 4RYAA 2Q2CA 3VE1B 3EHTA 2ALUA 3DM0A 1DK4A 5CMMA 2THIA 3CG1A 1MXZA 2XX9A 1FPIA 4QRZA 4OVQA 4LATA 5I2KB 4IO4A 4O7MA 2FNCA 3A29A 1GGGA 2AL5A 3TDJA 1N3XA 5TPAA 1MH4A 5DVIA 1IMDA 3S4UA 5TP9A 1EYIA 1LSTA 3FD3A 1NUYA 3MVXA 1LEVA 4TQUQ 2QVVA 3TQLA 1Y20A 4OTEA 2GFEA 4ELQA 3C33A 4Z0IA 5I56A 3E4RA 2L5VA 4P1EA 4R2BA 2OJTA 1FQCA 4KXPA 5I59A 1O63A 4N6PA 1B4ZA 2F3DA 2XXTA 2DVCA 3K02A 2CZLA 3OOAA 2KLFA 1FQEA 4MLQA 3FXRA 2DWHA 5EQAA 3HHFA 4QXDA 1Z7NE 1FTJA 5I57A 4HXVA 4L17A 2CZKA 4GXSB 3V5AA 3TTKA 3O97A 4BDNA 3EKIA 4F3SA 4PFWA 3K1MA 1NH7A 2OK2A 1FPLA 1PBQA 2F97A 1PB9A 4ZECA 2XXYA 3FJ7A 4NGUA 4GF8A 1OQHA 3VXBA 4PBQA 4H8JA 4O3BA 4XTCQ 3SZPA 4FAJA 4QFNA 3UORA 4GWOA 3D4CA 4OFJA 4QHQA 4YMBA 1JW4A 4G8HA 4YKKA 2HAUA 1MXWA 4N15A 2H99A 1B3GA 1M5DA 1P1NA 2R6GE 4PFRA 1BTJA 3A09A 1PC3A 2DE4A 4WEDA 3FASA 1M5FA 3MYUA 1F9BA 1DTZA 4GL8A 3OSRA 1Q1KA 1NH8A 1FBCA 3SESA 4Q5TA 1R1NA 3IOTA 3PUYE 3FV2A 4MH5A 3SEXA 5I57B 2F6PA 2ZZWA 4LA9A 3SKPA 1CE2A 1T0KA 2XXPA 5CBSA 5EQ7A 2WKYA 3FATA 4F22A 4P3LA 1CB6A 4RPNA 1NUXA 2I3WA 1MS7A 2ZXTA 4RK2A 3FVOA 3LSWA 1MPBA 4XKNA 2GH9A 3RUMA 1PEBA 3C31A 3MZ1A 3IORA 4X48A 3BIHA 3EPEA 4Q8RA 3MP1A 1B2HA 2XWVA 1NL5A 2XXWA 1JW1A 1QULA 3MBPA 1LBWA 3ECRA 1YYZA 3KEIA 3KG2A 1NV2A 3OXNA 2M8CA 4U21A 4YKIA 4G4PA 4FORA 4JB7A 4P56A 1MM6A 1QVSA 1EU8A 4YKJA 4O8MA 2LAOA 4PAIA 2KR0A 4M4GA 1SQYA 1NUZA 2WBBA 4QSEA 4R6KA 2XXIA 4BDOA 4PE5B 5CMKA 3M8UA 4QSDA 1EYJA 2Z22A 1ZTYA 4E0XA 4DCXA 1AWBA 4JXIA 4N13A 4F3GA 1YPNA 1NV5A 5ET7A 4IO2A 3QYTA 3KSJA 4NF0A 3BIGA 2DSFA 1LBZA 1FBHA 1ZBMA 4MNPA 5IZZA 1Y3PA 1MQJA 4FE8A 3N6TA 4OQOA 1VE4A 1Q9DA 4HE0A 3EN3A 2A5SA 3H4ZA 2Z23A 2DWIA 1MXXA 4EQBA 2UVIA 1WVJA 4ECFA 3JZJA 3O9PA 4KCDA 2VT5A 1N3WA 3RLFE 2ZYMA 3PPNA 1MQHA 2WBDA 3DP4A 1P1OA 3TEPA 3CR9A 1LAXA 3TUSA 1MPDA 5AA4B 3FVNA 4WKMA 4H8IA 1HSEA 3O29A 1BK4A 3TTLA 1SI1A 4N6KA 1S9TA 4MLVA 1QUKA 4MX6A 2UYEA 3S2VA 1FPBA 5F24A 3UIFA 3W9VA 3CIJA 3CFZA 3L6HA 4R75A 5ELVA 2X7PA 1OVTA 4GWUA 2BJIA 4I3EA 3OO8A 4F3BA 5K2YA 3S9LC 3ZSFA 1PBPA 3SEYA 4EXKA 3OO7A 4U22A 4XIGQ 5CMBA 4ND9A 4EQ9A 1H3DA 3K6VA 3EQ1A 4OERA 1B32A 4OHNA 3RPLA 1FJ9A 5TU0A 1SI0A 1A54A 1S50A 2RINA 3RN8A 1A40A 1M5EA 1XVYA 1LFHA 1YAEA 2HXRA 4EF1A 4FBPA 4YAHX 3KFMA 3MVZA 3T0JA 1SBPA 1BLFA 2DXYA 5I58A 4XF5A 1FQFA 4MNCA 3VLWA 3GZGA 5DTBA 4X1DA 4KYDA 1FBPA 1ZLQA 1QKAA 2P3VA 4DI3D 1RKMA 1A7LA 4RK9A 1MXUA 3VVFA 4OFOA 3CHGA 1FTKA 3I6VA 1YXIA 2W7YA 3TODA 4FIMA 1PB8A 1B5JA 4OANA 3VVDA 5H8FA 1B7ZA 3JYRA 3U1OA 1AOVA 4PGNA 4OVJA 1GTKA 4GQOA 1FPFA 2XXVA 1FPGA 4GXAA 3PPRA 4C1TA 2XWOA 1RDYA 4YB7A 4DXCA 3DELB 4NAPA 2I4CA 4PDHA 2Y7IA 1USYE 4DCYA 1FQBA 4QFOA 4YZZA 4OA4A 2HQ0A 4JDFA 4FEDA 1YTVA 4NF6A 3G3IA 3SEVA 4HE2A 2QMWA 4MIJA 3G3FA 4QBAA 4UA8A 1D9QA 3E13X 3K01A 3LSXA 3FXUA 5DVFA 2I48A 1B9JA 1J1NA 1DTGA 4O94A 1FPJA 2QS2A 3UGWA 3IR1A 3Q27A 5H8NB 3TMGA 1I6AA 1IXGA 4JVCA 4GL0A 3E78A 5HM4B 5KDTB 4PAKA 2F7AA 4G77A 4XFEA 3DLNA 4RY1A 1NFTA 4JSDA 1MY0A 5CMCA 2DOJA 1IMCA 3OO6A 1JQFA 1SDXA 4H5FA 5AE4A 3PMVA 3QUFA 3FIRA 4N91A 3T66A 4I62A 4OVSA 3KC0A 2UYFA 2RCAA 2UXAA 2FHYA 1LBBA 1XS5A 4G8MA 1N7WA 5ET5A 4NF6B 2E0SA 1PDAA 2B65A 3CSBA 2FYIA 5JTYA 3FV1A 5ICTA 2F7BA 2A5TA 1MRPA 3MP6A 2V25A 4H6DA 1FSAA 3U65A 4RA1A 4DZ1A 4LN5A 1BKAA 3H7MA 1Y3QA 1B5HA 3V83A 1I6BA 3C4MA 1QJMA 1FW0A 4GBVA 3V89B 3KN3A 4F1UA 1Y4CA 2KQZA 2R71A 3KOTA 3FXQA 1VSOA 1JEUA 1DPEA 1VFDA 4OESA 1HSJA 1ZU0A 4LQ5A 3TTNA 1II5A 4HS7A 1WODA 4KHZE 1PB7A 1N84A 1NV3A 3H3GA 3IB2A 1JW5A 4JWYA 2X7QA 5FTIA 4NF4A 4POXA 3O6IA 1LBCA 1SYHA 3QXMA 4X8RA 1MQIA 1D3KA 1FCKA 5I3SA 1H76A 2QS1A 1ELJA 5ESYA 2XX7A 1JETA 1LAGE 3MVWA 2XHDA 4U23A 4KI0E 4QF9A 4MFIA 1S7YA 3DP6A 1ZJLA 2V84A 3KZGA 2ANJA 1NI9A 3PUXE 4ZEFA 1VFEA 5TP9B 3HPIA 3HSTA 3MQ9A 5BUUA 1IZ1A 5EYFA 3OMBA 4GX3A 1M5CA 5I56B 2QRYA 2WYPA 4F1VA 3C36A 4NF8B 4FECA 3KSXA 5DEXA 4KPTA 3ILUB 4IGTA 2NWJA 3R6UA 4P0GA 4POWA 1CNQA 4OVRA 2F78A 3UP9A 3IX1A 1A8EA 3Q28A 2P1SA 2H5YA 1IMAA 2DVZA 2XD2A 1SD3A 4YKPA 4MMPA 1INPA 1Y3NA 4ZZAA 2Q9TA 4RNSA 2VGQA 4AS5A 1FBEA 2O69A 3RT8A 1MY3A 4BDRA 4I40A 4GWXA 2V3TA 2AIXA 4N81A 5ISUA 1IIWA 4ISUA 4GVOA 5ITOA 2O7UA 4GWZA 3SETA 3M3FA 4LQ2A 2RF1A 4NG7A 4G68C 3ZS6A 4PDDA 4MHFA 3QAXA 4JSOA 2F36A 3LV0A 2REJA 1FPDA 1MG1A 4TOZA 5EHMA 3IAZA 3OENA 3RTWB 1IXHA 3TCHA 1M5BA 1KZ8A 4MJOA 2FIEA 2QPQA 1Q35A 5CI5A 3IOUA 4GWSA 1DPPA 3Q25A 4NN3A 3RPLB 4QFLA 3IJOB 5EYGA 2DQVA 2AL4A 4PQJA 4GBWA 3G3KA 1SW2A 1DSNA 4N8YA 4RPOA 4P47A 4H67A 2Z8DA 3HV1A 1ANFA 4P0IA 2O1LA 4NF5A 4YMAA 2ZYKA 5L9OA 2CZIA 4K3FA 2IA4A 2O84X 1QKBA 2ONRA 1FPEA 2Z8FA 2RC7A 1UTBA 4I3YA 2PCRA 3KGCA 4R6YA 1NV6A 5CM6A 1NNTA 4IR8A 1K9ZA 4NX1A 1BIYA 3W9WA 1TWYA 4F19A 1XVXA 4H5GA 3WAFA 4G61A 5H8FB 5ET8A 2NXOA 3OO9A 2YLNA 4QFKA 3CVGA 1R9QA 1H43A 2VPOA 1P1UA 1NNFA 2VP1A 3QIMA 1POY1 4F2QA 4NE4A 5KZTA 4OVTA 3TTRA 3G7WA 1ZIUA 1VR5A 4XKRA 5IAIA 2HZKA 3TELA 4U2RA 1D9YA 4PF8A 1FBGA 2DE3A 1A99A 4THIA 1MQGA 4MAGA 2AYSA 1O7TA 3HO7A 4PFBA 4UABA 2Q8MA 3B6QA 3MW0A 1NV1A 2QFLA 4PFIA 3T93B 3W15C 4JVDA 2XXKA 1RDZA 1IEJA 3S9EA 5AA2A 2VHAA 5AA4A 3ZKKA 1H45A 2JJKA 5H8NA 4LZ7A 1OLCA 3C9HA 4XEQA 1FPKA 3THIA 1QUIA 4H46A 3ROJA 2GHAA 1NV0A 1N0TA 2PT1A 5LOMA 4R74A 4ESWA 2ZZXA 3QK6A 5DVJA 1LFIA 3ONMA 4ZEIA 3T9XB 1EZPA 3RT6B 2Y5KA 4XKPA 3N94A 3HCQA 1FBFA 1NKXA 2HCAA 2I58A 4OVPA 4IY6A 5BWJA 5I84A 2OCUA 2OWSA 3G3HA 4F29A 4R2FA 2H25A 5IGAA 3N6UA 1Z7ME 3FXBA 2UVHA 4XXUA 1LFGA 3IL1B 3SDFA 3PPOA 4ZE8A 5TPAB 3VXCA 1FTLA 3N5LA 1P1WA 4NTLA 4ONYA 2OBGA 3WAEA 2HZLA 2HFBA 2PYYA 1MM7A 3ZKLA 3FJGA 3TFLA 2VOZA 2I4BA 3KJ7A 4M1VA 5EQ8A 2F34A 4PTKA 2HEUA 3O6HA 4KD5A 3LSFB 3VV5A 2QVUA 2ONKE 2CEYA 3O66A 1GVCA 4WXJA 3MPKA 4KYEA 1QGXA 5I7IA 4JVIA 2O68A 4OZ9A 4OYVA 2DWJA 4FJPA 3ODBA 4F3PA 3MSTA 3SEUA 4N8GA 2B3BA 5AA1A 5L9MA 4IO6A 4ZS9A 2ZNUA 3VLVA 4JBZA 3GLBA 2WEFA 4P9KA 1JVXA 2QL3A 2E1SA 2RC8A 5FTHA 4O3CA 3AXFA 3MC2A 2I0BA 4GWYA 3HFUA 4I9DA 1ZMGA 2DDKA 1TFDA 1USYH 2MKZA 1B58A 2NOOA 3FVKA 2REGA 3GBAA 1D4NA 4N6DA 1IMBA 4Q30B 4NMYA 2FIXA 4F1YA 5ITPA 5L9SA 5IKBA 1LAFE 2RKMA 1FBDA 4X9TA 3USDA 3VVEA 4H45A 1LBVA 3O2AA 4H65A 3T9VA 4KCCA 1JNFA 4HTGA 1GV8A 2XXHA 2DXRA 5JK4A 3VDFA 1B3FA 4MF3A 4MBPA 1UQWA 1OVBA 3I5OA 4DI4B 1IXCA 4LUBA 4DXUA 3TZAA 1BP5A 3R7XA 3CRBA 2D3IA 4GX6A 3RNNA 5I2NB 4P1LA 4LONB 3PD9A 4DIGA 4PAFA 2DWAA 4DE8A 3NOHA 4F31B 1KA0A 1EYKA 1N7XA 4KR5A 2R9JA 2QSXA 4F39A 3BFUA 3T1BA 2GQ1A 5L8DA 5FHOA 4BDQA 3VFJA 4GIZA 3PUZE 1IUDA 2Y84A 1B6HA 2YJPA 1B7HA 2CZHA 2V3UA 4U4SA 3RPWA 1L5TA 4OEVA 4ZEDA 5CRYA 2XXQA 3UK4A 3CG3A 1Y1ZA 1A8FA 4PBHA 3CFXA 2H9BA 2B4LA 5IZ3B 2XA5A 2RC9A 1URSA 1EZ9A 3TCGA 5I58B 4G2ZA 4PF6A 1DCUA 4G68B 4PC9A 4HCWA 3KN8A 2ZNSA 4N07A 1QUJA 1EH3A 4R6HA 3IOWA 4ESXA 3PUVE 4OFLA 2Y7WA 1UTBB 4ZEBA 3PGFA 4OWDA 4NHBA 4FATA 3IOVA 5B70A 4PGPA 2Q74A 3FVGA 2F35A 3T96B 2ZMBA 4AB6A 5H8SA 4KFQA 5JEIA 3A3CA 4X04A 1JEVA 2F8DA 2G29A 3OSQA 4EQ7A 4QSCA 3LUZA 3SERA 3MPLA 3IFAA 4GFRA 4NWDA 3U72A 3MAMA 4NQ8A 4WEPA 4GX4A 1B0LA 1GR2A 3IO4A 2Y5LA 2V3QA 3MVYA 4EUOA 3K0VA 3TKDA 4MNIA 4R72A 2CMOA 4FEBA 1SPIA 3FZVA 4YB6A 2RCBA 5F1QA 3RTFB 4G68A 4TLLB 3IK6B 3B7DA 1US5A 3KBZA 3T9UA 5M2VA 3U92A 1MY4A 2ZYNA 1SYIA 2XWKA
chains in the Genus database with same CATH topology
4C1UA 2DS9A 3V89B 3RY3A 1N04A 4OFOA 1FTKA 2Y7PA 3I6VA 3H6UA 4NE4A 3FJMA 3K2DA 5KZTA 2VD3A 2W7YA 4U1ZA 4KYSA 3TTRA 3G7WA 1FQAA 5AA2D 1ZIUA 5H8QA 3TODA 3MJNA 4Z7EA 1VR5A 3K1PA 1Y9UA 3PPPA 3U94A 5I2NA 2ZNTA 4FIMA 1TXFA 3VLUA 4LZ8A 1QW0A 4XKRA 5IAIA 1UIVA 2HZKA 1PB8A 3MUQA 4LP2B 4ZEKA 1B5JA 3Q29A 2D5WA 3TELA 4U2RA 1D9YA 4ELOA 3CI8A 1AH5A 4F1UA 3VVDA 2UVJA 1I69A 5AA2B 3V8XB 3U8QA 5H8FA 1B7ZA 3JYRA 2P2AA 2DE3A 3KOSA 3IB1A 1B7UA 2OZZA 2FA7A 4GRKA 3U1OA 1DMBA 5CC2A 1AOVA 1A99A 1WDNA 4THIA 1OIBA 1MQGA 4OVJA 1GTKA 4GQOA 4G8NA 3KBRA 1B3EA 1A55A 3TQWA 2AYSA 2XXVA 3ILTB 2F7CA 4GXAA 1O7TA 1URGA 1H44A 3HO7A 3PPRA 4C1TA 1B4HA 3JV9A 2DE2A 2PX1A 3B6QA 3O28A 2F5XA 3MW0A 4YB5A 1MXVA 4RYAA 5KDTA 3T93B 2O6AA 2Q2CA 4OENA 5H8HA 3EHTA 3VE1B 5H8QB 2ALUA 4YB7A 3W15C 2XXUA 3H06B 4DXCA 1B1XA 3DM0A 4R73A 3DELB 1FTOA 2I4CA 1IEJA 5CMMA 2THIA 3CG1A 2Y7IA 1LGBC 1MXZA 1USYE 2XX9A 3IJXB 3SEWA 4BDMA 3S9EA 4DCYA 4QRZA 5AA2A 2VHAA 5AA4A 3H03A 3ZKKA 1FQBA 4LATA 4QFOA 1H45A 5I2KB 4IO4A 4YZZA 5H8NA 4LZ7A 1OLCA 2FNCA 3C9HA 4NWCA 4ZDMA 1GGGA 2AL5A 1SW1A 2HQ0A 4FEDA 4JDFA 3TDJA 1N3XA 4F18A 5TPAA 1MH4A 1YTVA 2GHBA 4NF6A 5DVIA 3G3IA 3SEVA 3S4UA 3THIA 1XOCA 5TP9A 1LSTA 1QUIA 3FD3A 3K1NA 2QMWA 3MVXA 1Y1MA 4TQUQ 3G3FA 4OETA 2GHAA 4ECFA 4UA8A 3CFLA 3S9NC 1N0TA 3TQLA 3E13X 1Y20A 2PT1A 4OTEA 5LOMA 4R74A 2GFEA 3TYHA 3C33A 3K01A 4ELQA 4ESWA 3LSXA 4Z0IA 3FXUA 5JTYB 5I56A 3E4RA 3QK6A 5DVFA 5DVJA 1LFIA 2ESNA 3ONMA 1B05A 2I48A 4R2BA 1NNKA 1AMFA 4ZEIA 2OJTA 1FQCA 4I1DA 3T9XB 1B9JA 1J1NA 1DTGA 4ZE9A 2QS2A 3UGWA 5I59A 1O63A 4N6PA 1B4ZA 1POTA 3IR1A 1MDQA 2XXTA 2DVCA 5I59B 3LSLA 1EZPA 3Q27A 3RT6B 4XKPA 3N94A 5H8NB 3MZ9A 3HCQA 5ICQA 4AQ4A 3E3KA 3K02A 3TMGA 2CZLA 3OOAA 1I6AA 1IXGA 1NKXA 2KLFA 1FQEA 2HCAA 2I58A 2PMSA 3P7IA 2Y7RA 4MLQA 3FXRA 2DWHA 4GL0A 4IY6A 1P1QA 3HHFA 5HM4B 5KDTB 1Z7NE 2F7AA 1B51A 1FTJA 5BWJA 4G77A 4C0RA 5I57A 5I84A 2OCUA 2OWSA 3G3HA 4F29A 4L17A 4GXSB 4R2FA 3V5AA 3DLNA 4RY1A 2H25A 1NFTA 4JSDA 1SVXB 4HCYA 1MY0A 3N6UA 4TLMB 1Z7ME 5CMCA 2Z8EA 3FGSA 2DOJA 3O97A 3TTKA 2UVHA 4BDNA 5H8HB 3LBSA 4F3SA 3OO6A 1JQFA 3K1MA 1NH7A 1SDXA 2OK2A 4NF5B 4PFWA 4XXUA 1LFGA 1PBQA 3PD8A 3IL1B 3SDFA 1I6QA 3TPAA 2F97A 4H5FA 3PPOA 5AE4A 1PB9A 4ZE8A 3PMVA 3QUFA 3FIRA 5TPAB 3T66A 1FTLA 3N5LA 4JWXA 3VXCA 4DDDA 2P0SA 1P1WA 2XXYA 3F11A 3FUZA 4I62A 4NTLA 3C35A 4ONYA 2OBGA 2UYFA 3FJ7A 2HZLA 2RCAA 3WAEA 4EDPA 4HW8A 4GF8A 1NNPA 1MXYA 2UXAA 1OQHA 2HFBA 1LBBA 1XS5A 1B52A 4G8MA 3VXBA 2PYYA 1N7WA 1MM7A 4NF6B 2E0SA 1PDAA 2VD2A 1MPCA 3QUJA 2Q2AA 2B65A 3CSBA 4H8JA 4O3BA 4XTCQ 2FYIA 4ZZEA 3FJGA 3TFLA 3ZKLA 2VOZA 4FAJA 2I4BA 5JTYA 3FV1A 3KJ7A 4M1VA 2F34A 1AIVA 4QFNA 1MY2A 5ICTA 2F7BA 2A5TA 1MRPA 3MP6A 2HEUA 2O51A 2V25A 4H6DA 4NF4B 4PFUA 5HBCA 4RA1A 2OWTA 4KQPA 3UORA 4DZ1A 4GWOA 3D4CA 3O6HA 4KD5A 4IY5A 3LSFB 4OFJA 3VV5A 5J1DA 4UACA 2ONKE 4QHQA 4YMBA 1JW4A 1URDA 4G8HA 4YKKA 2HAUA 3R26A 1MXWA 1BKAA 3O66A 1GVCA 4WXJA 3H7MA 1Y3QA 2H99A 2HXWA 3MPKA 1B5HA 3V83A 1B3GA 1I6BA 4ZECA 1M5DA 1P1NA 2R6GE 3C4MA 1BTJA 1QJMA 4KYEA 4PETA 4IGRA 3GBBA 1FW0A 2B3FA 3L6GA 1B1HA 2O68A 3A09A 4OYVA 1PC3A 4OZ9A 2DE4A 4WEDA 4NEDA 2DWJA 1OLAA 4FJPA 3FASA 3KN3A 1B0HA 3ODBA 1M5FA 4Q0CA 4IO5A 1F9BA 1DTZA 4GL8A 3OSRA 5K2XA 1Q1KA 1Y4CA 1NH8A 4F3PA 2R71A 3SESA 3KOTA 4Q5TA 1R1NA 3IOTA 1LB9A 3PUYE 3FV2A 1VSOA 3FXQA 2B3BA 4MH5A 3SEXA 3PMXA 3SEUA 5AA1A 5CBRA 5I57B 5L9MA 1JEUA 1DPEA 2XX8A 2F6PA 3M3KA 4IO6A 4ZS9A 1VFDA 4LA9A 5FHNA 3SKPA 2ZNUA 4OESA 1HSJA 1CE2A 4R9FA 1ZU0A 4LQ5A 3IB0A 3TTNA 5A5XA 1II5A 2OLBA 2PBWA 3VLVA 3EHUA 4JBZA 1LB8A 2XXPA 3GLBA 3HN0A 4HS7A 1T0KA 3B6TA 2XXXA 3BFTA 5CBSA 1WODA 2ABHA 1JVXA 2QL3A 2WKYA 3FATA 1LAHE 4YU0A 4KHZE 1PB7A 4F22A 3N26A 3O6GA 1N84A 3H3GA 1CB6A 2E1SA 2I49A 2RC8A 2I3WA 3IB2A 3LC8A 4JWOA 1B3LA 4O3CA 4RPNA 5FTHA 1MS7A 4IO7A 2ZXTA 3AXFA 3MC2A 4RK2A 1JW5A 3FVOA 4JWYA 2I0BA 3LSWA 2X7QA 3LR1A 1SW5A 1B46A 1MPBA 4XKNA 5FTIA 2GH9A 4I9DA 1RYXA 1ZMGA 2A5TB 1XHYA 1PEBA 4NF4A 3RUMA 3C31A 2H98A 3O6IA 4POXA 3MZ1A 1LBCA 3PU5A 4DXBA 1SYHA 2ZYNA 3QXMA 1B3HA 1MQIA 1D3KA 5KCJB 3S9MC 1FCKA 3IORA 1TFDA 1H76A 1USYH 1ELJA 2QS1A 1YCJA 4X48A 1B58A 1XT8A 3EPEA 4RJZA 2NOOA 3FVKA 2XX7A 4Q8RA 2REGA 3MP1A 3GBAA 1JETA 1LAGE 1D4NA 3K6UA 2Q8JA 5DYHA 1B2HA 4H0WA 4Q30B 3MVWA 4NMYA 4F1YA 2HAVA 2XHDA 1NL5A 2XXWA 4U23A 5ITPA 1R9LA 4KI0E 5L9SA 5IKBA 1JW1A 4QF9A 1QULA 3MBPA 3ECRA 2NUVA 1LAFE 2RKMA 4MFIA 3KEIA 1S7YA 3DP6A 3KG2A 3OXNA 1ZJLA 2M8CA 2V84A 4U21A 3KZGA 4YKIA 4G4PA 4FORA 2ANJA 4JB7A 1OQGA 3PUXE 4X9TA 4ZEFA 1MM6A 1QVSA 1EU8A 3OELA 3M3LA 4YKJA 1VFEA 5TP9B 2LAOA 4LVQA 2DP8A 3USDA 3VVEA 2IEEA 3HPIA 4XKQA 4M4GA 1SQYA 3HSTA 3O2AA 4H65A 4QSEA 3MQ9A 4R6KA 3T9VA 2XXIA 3QSLA 4KCCA 4BDOA 5BUUA 1JNFA 4HTGA 1IZ1A 4PE5B 5EYFA 1GV8A 3M8UA 5CMKA 4QSDA 2XXHA 3H6TA 3OMBA 2DXRA 1R6ZA 2H4IA 2V93A 3PPQA 4R9GA 1M5CA 2QJEA 3VDFA 1B3FA 2QRYA 5I56B 5JK4A 2Z22A 4F2QA 4F1VA 3C36A 1ZTYA 4E0XA 2ZYOA 4DCXA 4O3AA 4MF3A 4EF2A 4H1XA 4BDLA 3TCFA 4MBPA 4FECA 4NF8B 1UQWA 3KSXA 5A5XB 4JXIA 4N13A 4F3GA 1OVBA 3C34A 1YPNA 3I5OA 5DEXA 3UA8A 3PV0E 4KPTA 3ILUB 4IGTA 4GLIA 4X1BA 1IXCA 4IO2A 3R6UA 1HSLA 2DYXA 4P0GA 4POWA 2NWJA 3QYTA 3KSJA 4LUBA 4GD5A 3TZAA 4OEUA 4DXUA 1BP5A 3R7XA 4PFYA 2F78A 5AA3A 3CRBA 3UP9A 3BKIB 2DSFA 2PT2A 2D3IA 3IX1A 1A8EA 4LZ5A 2O1MA 3Q28A 3RNNA 2P1SA 5I2NB 1ZBMA 2H5YA 4LONB 3PD9A 4DIGA 2DVZA 2XD2A 2ONSA 1SD3A 2DWAA 1Y3PA 4DE8A 4YKPA 5FHMA 4F31B 3LUYA 5KCJA 3EF7A 5HPQA 1Y3NA 1MQJA 2D21A 4ZZAA 1N7XA 2Q9TA 4ELPA 4RNSA 4FE8A 2VGQA 3N6TA 4KR5A 2Q88A 4OQOA 1VE4A 2I0CA 2R9JA 2QSXA 2O69A 3RT8A 4F39A 1MY3A 3BFUA 3EN3A 4BDRA 4DLDA 5L8DA 5FHOA 2A5SA 4BDQA 3VFJA 2V3TA 4GIZA 3H4ZA 3PUZE 1IUDA 3IO6A 4ELRA 2Z23A 2AIXA 2DWIA 1FTMA 1MXXA 4EQBA 2Y84A 2UVIA 5ISUA 1WVJA 1IIWA 1B6HA 1LLSA 2YJPA 2Q89A 4IB2A 3JZJA 3O9PA 1LCFA 1B7HA 2X26A 1NMUA 2GRVA 3OEKA 4GVOA 4KCDA 2O7UA 1N3WA 1UIUA 3G3GA 5ITOA 3K6WA 3RLFE 2V3UA 2ZYMA 3SETA 4U4SA 3M3FA 3RPWA 2QMXA 3PPNA 2Y7KA 1MQHA 3DP4A 3D4GA 4LQ2A 4OXVA 2O7IA 3E9XA 1L5TA 3HHGA 1P1OA 2RF1A 3T22A 4EXLA 1AL3A 3CR9A 3TEPA 1LAXA 4G68C 4OEVA 1LCTA 4RXLA 5CRYA 5EHSA 1US4A 4ZEDA 2G93A 4NF8A 2XD3A 4QFPA 3ZS6A 1MPDA 5AA4B 3QAXA 4JSOA 3FVNA 2XXQA 2F36A 4WKMA 5DEXB 3CG3A 4H8IA 3UK4A 1FQDA 2REJA 1HSEA 1Y1ZA 1XC1A 1TFAA 1A8FA 1UTHA 4F2OA 3O29A 1MG1A 3CFXA 3RGYA 4TOZA 5EHMA 3IAZA 3KN7A 1ZKBA 3OENA 1SI1A 3MP8A 4OMBA 3TTLA 3RTWB 3U93A 1IXHA 2H9BA 1S9TA 3TCHA 1M5BA 4MLVA 1QUKA 1D9VA 2UYEA 3G3JA 3S2VA 2QPQA 1Q35A 4P11A 4AB5A 5CI5A 1O64A 1URSA 2RC9A 3IOUA 4PP0A 3UIFA 3W9VA 1DPPA 1EZ9A 3Q25A 3CIJA 3CFZA 4G2ZA 3TCGA 5I58B 3L6HA 4G68B 2XXRA 4HCWA 4QFLA 3KN8A 2ZNSA 2X7PA 3PUWE 3IJOB 2UVGA 4R75A 1OVTA 3A3UA 5ELVA 3EHSA 4N07A 1ATGA 2DQVA 1QUJA 3OO8A 2AL4A 4F3BA 5K2YA 1EH3A 1P99A 4R6HA 4PQJA 3IOWA 1KWHA 3S9LC 3G3KA 2F6GA 1JVYA 2BJJX 1SW2A 3RQTA 3ZSFA 4ESXA 3PUVE 1DSNA 4OFLA 2Y7WA 1PBPA 1UTBB 3SEYA 4RPOA 4ZEBA 1TT1A 3PGFA 4OWDA 4PFTA 4FATA 4EXKA 3IOVA 5B70A 4H67A 3TTMA 3OO7A 1IQ7A 3FVGA 3GXAA 3CSGA 4U4XA 2Z8DA 3T96B 4U22A 1N76A 3K4UA 4XIGQ 2NVUB 2ZMBA 4AB6A 3TAJA 5H8SA 3HV1A 5CMBA 4ND9A 1MQDA 4EQ9A 4KFQA 1H3DA 5JEIA 3A3CA 3KJTA 1B5IA 3K6VA 3MZBA 1DOTA 1ANFA 1JEVA 3EQ1A 4P0IA 2O1LA 4NF5A 1B32A 2F8DA 4OERA 5DT6A 4YMAA 4OHNA 2QS3A 5TU0A 2QS4A 1Y4TA 2I3VA 2ZYKA 1MDP1 1SI0A 2G29A 3MWBA 3OSQA 4EQ7A 5L9OA 1A54A 1S50A 2RINA 3BBRA 4QSCA 4K3FA 2IA4A 4I8CA 3RN8A 2O84X 1QKBA 2ONRA 1A40A 1M5EA 2Z8FA 2RC7A 1XVYA 4E0WA 3SERA 1LFHA 1MH3A 4BLAA 3MPLA 1YAEA 4GFRA 1UTHB 4NWDA 3U72A 3MAMA 4EF1A 4IO3A 3OEMA 1UTBA 4YAHX 2I6EA 3KFMA 4WEPA 5B7DA 3MVZA 1B0LA 1IXIA 1GR2A 2PVUA 1SBPA 2YPNA 3DP8A 3IO4A 1BLFA 3KGCA 3K00A 4R6YA 4U1OA 5CM6A 1NNTA 2DXYA 5I58A 3T9HB 2V3QA 3H6VA 1FQFA 1BIYA 3MVYA 1B40A 3W9WA 1TWYA 3K6XA 3K0VA 3TKDA 3VLWA 4EUOA 4ISUA 4F19A 1XVXA 3GZGA 4H5GA 4R72A 2CMOA 4FEBA 5F7VA 3WAFA 3TUSA 3FZVA 4YB6A 2RCBA 5F1QA 3RTFB 5H8FB 1IITA 2NXOA 4G68A 5DTBA 1EZOA 3OO9A 4X1DA 2YLNA 4TLLB 5I2KA 4KYDA 4QFKA 1RYOA 4GOTA 1ZLQA 3IK6B 4YICA 1QKAA 3CVGA 1R9QA 1H43A 1SW4A 3B7DA 1US5A 3Q26A 3UN6A 1P1UA 3H6WA 1MY1A 3OD7A 1NNFA 3PMWA 1RKMA 3C32A 3I3VA 1A7LA 1OMPA 2VP1A 3T9UA 4RK9A 5M2VA 3B6WA 3U92A 1MY4A 3QIMA 2F35A 1SYIA 1POY1 1MXUA 3VVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1U A;  2DS9 A;  3V89 B;  3RY3 A;  1N04 A;  4OFO A;  1FTK A;  2Y7P A;  3I6V A;  3H6U A;  4NE4 A;  3FJM A;  3K2D A;  5KZT A;  2VD3 A;  2W7Y A;  4U1Z A;  4KYS A;  3TTR A;  3G7W A;  1FQA A;  5AA2 D;  1ZIU A;  5H8Q A;  3TOD A;  3MJN A;  4Z7E A;  1VR5 A;  3K1P A;  1Y9U A;  3PPP A;  3U94 A;  5I2N A;  2ZNT A;  4FIM A;  1TXF A;  3VLU A;  4LZ8 A;  1QW0 A;  4XKR A;  5IAI A;  1UIV A;  2HZK A;  1PB8 A;  3MUQ A;  4LP2 B;  4ZEK A;  1B5J A;  3Q29 A;  2D5W A;  3TEL A;  4U2R A;  1D9Y A;  4ELO A;  3CI8 A;  1AH5 A;  4F1U A;  3VVD A;  2UVJ A;  1I69 A;  5AA2 B;  3V8X B;  3U8Q A;  5H8F A;  1B7Z A;  3JYR A;  2P2A A;  2DE3 A;  3KOS A;  3IB1 A;  1B7U A;  2OZZ A;  2FA7 A;  4GRK A;  3U1O A;  1DMB A;  5CC2 A;  1AOV A;  1A99 A;  1WDN A;  4THI A;  1OIB A;  1MQG A;  4OVJ A;  1GTK A;  4GQO A;  4G8N A;  3KBR A;  1B3E A;  1A55 A;  3TQW A;  2AYS A;  2XXV A;  3ILT B;  2F7C A;  4GXA A;  1O7T A;  1URG A;  1H44 A;  3HO7 A;  3PPR A;  4C1T A;  1B4H A;  3JV9 A;  2DE2 A;  2PX1 A;  3B6Q A;  3O28 A;  2F5X A;  3MW0 A;  4YB5 A;  1MXV A;  4RYA A;  5KDT A;  3T93 B;  2O6A A;  2Q2C A;  4OEN A;  5H8H A;  3EHT A;  3VE1 B;  5H8Q B;  2ALU A;  4YB7 A;  3W15 C;  2XXU A;  3H06 B;  4DXC A;  1B1X A;  3DM0 A;  4R73 A;  3DEL B;  1FTO A;  2I4C A;  1IEJ A;  5CMM A;  2THI A;  3CG1 A;  2Y7I A;  1LGB C;  1MXZ A;  1USY E;  2XX9 A;  3IJX B;  3SEW A;  4BDM A;  3S9E A;  4DCY A;  4QRZ A;  5AA2 A;  2VHA A;  5AA4 A;  3H03 A;  3ZKK A;  1FQB A;  4LAT A;  4QFO A;  1H45 A;  5I2K B;  4IO4 A;  4YZZ A;  5H8N A;  4LZ7 A;  1OLC A;  2FNC A;  3C9H A;  4NWC A;  4ZDM A;  1GGG A;  2AL5 A;  1SW1 A;  2HQ0 A;  4FED A;  4JDF A;  3TDJ A;  1N3X A;  4F18 A;  5TPA A;  1MH4 A;  1YTV A;  2GHB A;  4NF6 A;  5DVI A;  3G3I A;  3SEV A;  3S4U A;  3THI A;  1XOC A;  5TP9 A;  1LST A;  1QUI A;  3FD3 A;  3K1N A;  2QMW A;  3MVX A;  1Y1M A;  4TQU Q;  3G3F A;  4OET A;  2GHA A;  4ECF A;  4UA8 A;  3CFL A;  3S9N C;  1N0T A;  3TQL A;  3E13 X;  1Y20 A;  2PT1 A;  4OTE A;  5LOM A;  4R74 A;  2GFE A;  3TYH A;  3C33 A;  3K01 A;  4ELQ A;  4ESW A;  3LSX A;  4Z0I A;  3FXU A;  5JTY B;  5I56 A;  3E4R A;  3QK6 A;  5DVF A;  5DVJ A;  1LFI A;  2ESN A;  3ONM A;  1B05 A;  2I48 A;  4R2B A;  1NNK A;  1AMF A;  4ZEI A;  2OJT A;  1FQC A;  4I1D A;  3T9X B;  1B9J A;  1J1N A;  1DTG A;  4ZE9 A;  2QS2 A;  3UGW A;  5I59 A;  1O63 A;  4N6P A;  1B4Z A;  1POT A;  3IR1 A;  1MDQ A;  2XXT A;  2DVC A;  5I59 B;  3LSL A;  1EZP A;  3Q27 A;  3RT6 B;  4XKP A;  3N94 A;  5H8N B;  3MZ9 A;  3HCQ A;  5ICQ A;  4AQ4 A;  3E3K A;  3K02 A;  3TMG A;  2CZL A;  3OOA A;  1I6A A;  1IXG A;  1NKX A;  2KLF A;  1FQE A;  2HCA A;  2I58 A;  2PMS A;  3P7I A;  2Y7R A;  4MLQ A;  3FXR A;  2DWH A;  4GL0 A;  4IY6 A;  1P1Q A;  3HHF A;  5HM4 B;  5KDT B;  1Z7N E;  2F7A A;  1B51 A;  1FTJ A;  5BWJ A;  4G77 A;  4C0R A;  5I57 A;  5I84 A;  2OCU A;  2OWS A;  3G3H A;  4F29 A;  4L17 A;  4GXS B;  4R2F A;  3V5A A;  3DLN A;  4RY1 A;  2H25 A;  1NFT A;  4JSD A;  1SVX B;  4HCY A;  1MY0 A;  3N6U A;  4TLM B;  1Z7M E;  5CMC A;  2Z8E A;  3FGS A;  2DOJ A;  3O97 A;  3TTK A;  2UVH A;  4BDN A;  5H8H B;  3LBS A;  4F3S A;  3OO6 A;  1JQF A;  3K1M A;  1NH7 A;  1SDX A;  2OK2 A;  4NF5 B;  4PFW A;  4XXU A;  1LFG A;  1PBQ A;  3PD8 A;  3IL1 B;  3SDF A;  1I6Q A;  3TPA A;  2F97 A;  4H5F A;  3PPO A;  5AE4 A;  1PB9 A;  4ZE8 A;  3PMV A;  3QUF A;  3FIR A;  5TPA B;  3T66 A;  1FTL A;  3N5L A;  4JWX A;  3VXC A;  4DDD A;  2P0S A;  1P1W A;  2XXY A;  3F11 A;  3FUZ A;  4I62 A;  4NTL A;  3C35 A;  4ONY A;  2OBG A;  2UYF A;  3FJ7 A;  2HZL A;  2RCA A;  3WAE A;  4EDP A;  4HW8 A;  4GF8 A;  1NNP A;  1MXY A;  2UXA A;  1OQH A;  2HFB A;  1LBB A;  1XS5 A;  1B52 A;  4G8M A;  3VXB A;  2PYY A;  1N7W A;  1MM7 A;  4NF6 B;  2E0S A;  1PDA A;  2VD2 A;  1MPC A;  3QUJ A;  2Q2A A;  2B65 A;  3CSB A;  4H8J A;  4O3B A;  4XTC Q;  2FYI A;  4ZZE A;  3FJG A;  3TFL A;  3ZKL A;  2VOZ A;  4FAJ A;  2I4B A;  5JTY A;  3FV1 A;  3KJ7 A;  4M1V A;  2F34 A;  1AIV A;  4QFN A;  1MY2 A;  5ICT A;  2F7B A;  2A5T A;  1MRP A;  3MP6 A;  2HEU A;  2O51 A;  2V25 A;  4H6D A;  4NF4 B;  4PFU A;  5HBC A;  4RA1 A;  2OWT A;  4KQP A;  3UOR A;  4DZ1 A;  4GWO A;  3D4C A;  3O6H A;  4KD5 A;  4IY5 A;  3LSF B;  4OFJ A;  3VV5 A;  5J1D A;  4UAC A;  2ONK E;  4QHQ A;  4YMB A;  1JW4 A;  1URD A;  4G8H A;  4YKK A;  2HAU A;  3R26 A;  1MXW A;  1BKA A;  3O66 A;  1GVC A;  4WXJ A;  3H7M A;  1Y3Q A;  2H99 A;  2HXW A;  3MPK A;  1B5H A;  3V83 A;  1B3G A;  1I6B A;  4ZEC A;  1M5D A;  1P1N A;  2R6G E;  3C4M A;  1BTJ A;  1QJM A;  4KYE A;  4PET A;  4IGR A;  3GBB A;  1FW0 A;  2B3F A;  3L6G A;  1B1H A;  2O68 A;  3A09 A;  4OYV A;  1PC3 A;  4OZ9 A;  2DE4 A;  4WED A;  4NED A;  2DWJ A;  1OLA A;  4FJP A;  3FAS A;  3KN3 A;  1B0H A;  3ODB A;  1M5F A;  4Q0C A;  4IO5 A;  1F9B A;  1DTZ A;  4GL8 A;  3OSR A;  5K2X A;  1Q1K A;  1Y4C A;  1NH8 A;  4F3P A;  2R71 A;  3SES A;  3KOT A;  4Q5T A;  1R1N A;  3IOT A;  1LB9 A;  3PUY E;  3FV2 A;  1VSO A;  3FXQ A;  2B3B A;  4MH5 A;  3SEX A;  3PMX A;  3SEU A;  5AA1 A;  5CBR A;  5I57 B;  5L9M A;  1JEU A;  1DPE A;  2XX8 A;  2F6P A;  3M3K A;  4IO6 A;  4ZS9 A;  1VFD A;  4LA9 A;  5FHN A;  3SKP A;  2ZNU A;  4OES A;  1HSJ A;  1CE2 A;  4R9F A;  1ZU0 A;  4LQ5 A;  3IB0 A;  3TTN A;  5A5X A;  1II5 A;  2OLB A;  2PBW A;  3VLV A;  3EHU A;  4JBZ A;  1LB8 A;  2XXP A;  3GLB A;  3HN0 A;  4HS7 A;  1T0K A;  3B6T A;  2XXX A;  3BFT A;  5CBS A;  1WOD A;  2ABH A;  1JVX A;  2QL3 A;  2WKY A;  3FAT A;  1LAH E;  4YU0 A;  4KHZ E;  1PB7 A;  4F22 A;  3N26 A;  3O6G A;  1N84 A;  3H3G A;  1CB6 A;  2E1S A;  2I49 A;  2RC8 A;  2I3W A;  3IB2 A;  3LC8 A;  4JWO A;  1B3L A;  4O3C A;  4RPN A;  5FTH A;  1MS7 A;  4IO7 A;  2ZXT A;  3AXF A;  3MC2 A;  4RK2 A;  1JW5 A;  3FVO A;  4JWY A;  2I0B A;  3LSW A;  2X7Q A;  3LR1 A;  1SW5 A;  1B46 A;  1MPB A;  4XKN A;  5FTI A;  2GH9 A;  4I9D A;  1RYX A;  1ZMG A;  2A5T B;  1XHY A;  1PEB A;  4NF4 A;  3RUM A;  3C31 A;  2H98 A;  3O6I A;  4POX A;  3MZ1 A;  1LBC A;  3PU5 A;  4DXB A;  1SYH A;  2ZYN A;  3QXM A;  1B3H A;  1MQI A;  1D3K A;  5KCJ B;  3S9M C;  1FCK A;  3IOR A;  1TFD A;  1H76 A;  1USY H;  1ELJ A;  2QS1 A;  1YCJ A;  4X48 A;  1B58 A;  1XT8 A;  3EPE A;  4RJZ A;  2NOO A;  3FVK A;  2XX7 A;  4Q8R A;  2REG A;  3MP1 A;  3GBA A;  1JET A;  1LAG E;  1D4N A;  3K6U A;  2Q8J A;  5DYH A;  1B2H A;  4H0W A;  4Q30 B;  3MVW A;  4NMY A;  4F1Y A;  2HAV A;  2XHD A;  1NL5 A;  2XXW A;  4U23 A;  5ITP A;  1R9L A;  4KI0 E;  5L9S A;  5IKB A;  1JW1 A;  4QF9 A;  1QUL A;  3MBP A;  3ECR A;  2NUV A;  1LAF E;  2RKM A;  4MFI A;  3KEI A;  1S7Y A;  3DP6 A;  3KG2 A;  3OXN A;  1ZJL A;  2M8C A;  2V84 A;  4U21 A;  3KZG A;  4YKI A;  4G4P A;  4FOR A;  2ANJ A;  4JB7 A;  1OQG A;  3PUX E;  4X9T A;  4ZEF A;  1MM6 A;  1QVS A;  1EU8 A;  3OEL A;  3M3L A;  4YKJ A;  1VFE A;  5TP9 B;  2LAO A;  4LVQ A;  2DP8 A;  3USD A;  3VVE A;  2IEE A;  3HPI A;  4XKQ A;  4M4G A;  1SQY A;  3HST A;  3O2A A;  4H65 A;  4QSE A;  3MQ9 A;  4R6K A;  3T9V A;  2XXI A;  3QSL A;  4KCC A;  4BDO A;  5BUU A;  1JNF A;  4HTG A;  1IZ1 A;  4PE5 B;  5EYF A;  1GV8 A;  3M8U A;  5CMK A;  4QSD A;  2XXH A;  3H6T A;  3OMB A;  2DXR A;  1R6Z A;  2H4I A;  2V93 A;  3PPQ A;  4R9G A;  1M5C A;  2QJE A;  3VDF A;  1B3F A;  2QRY A;  5I56 B;  5JK4 A;  2Z22 A;  4F2Q A;  4F1V A;  3C36 A;  1ZTY A;  4E0X A;  2ZYO A;  4DCX A;  4O3A A;  4MF3 A;  4EF2 A;  4H1X A;  4BDL A;  3TCF A;  4MBP A;  4FEC A;  4NF8 B;  1UQW A;  3KSX A;  5A5X B;  4JXI A;  4N13 A;  4F3G A;  1OVB A;  3C34 A;  1YPN A;  3I5O A;  5DEX A;  3UA8 A;  3PV0 E;  4KPT A;  3ILU B;  4IGT A;  4GLI A;  4X1B A;  1IXC A;  4IO2 A;  3R6U A;  1HSL A;  2DYX A;  4P0G A;  4POW A;  2NWJ A;  3QYT A;  3KSJ A;  4LUB A;  4GD5 A;  3TZA A;  4OEU A;  4DXU A;  1BP5 A;  3R7X A;  4PFY A;  2F78 A;  5AA3 A;  3CRB A;  3UP9 A;  3BKI B;  2DSF A;  2PT2 A;  2D3I A;  3IX1 A;  1A8E A;  4LZ5 A;  2O1M A;  3Q28 A;  3RNN A;  2P1S A;  5I2N B;  1ZBM A;  2H5Y A;  4LON B;  3PD9 A;  4DIG A;  2DVZ A;  2XD2 A;  2ONS A;  1SD3 A;  2DWA A;  1Y3P A;  4DE8 A;  4YKP A;  5FHM A;  4F31 B;  3LUY A;  5KCJ A;  3EF7 A;  5HPQ A;  1Y3N A;  1MQJ A;  2D21 A;  4ZZA A;  1N7X A;  2Q9T A;  4ELP A;  4RNS A;  4FE8 A;  2VGQ A;  3N6T A;  4KR5 A;  2Q88 A;  4OQO A;  1VE4 A;  2I0C A;  2R9J A;  2QSX A;  2O69 A;  3RT8 A;  4F39 A;  1MY3 A;  3BFU A;  3EN3 A;  4BDR A;  4DLD A;  5L8D A;  5FHO A;  2A5S A;  4BDQ A;  3VFJ A;  2V3T A;  4GIZ A;  3H4Z A;  3PUZ E;  1IUD A;  3IO6 A;  4ELR A;  2Z23 A;  2AIX A;  2DWI A;  1FTM A;  1MXX A;  4EQB A;  2Y84 A;  2UVI A;  5ISU A;  1WVJ A;  1IIW A;  1B6H A;  1LLS A;  2YJP A;  2Q89 A;  4IB2 A;  3JZJ A;  3O9P A;  1LCF A;  1B7H A;  2X26 A;  1NMU A;  2GRV A;  3OEK A;  4GVO A;  4KCD A;  2O7U A;  1N3W A;  1UIU A;  3G3G A;  5ITO A;  3K6W A;  3RLF E;  2V3U A;  2ZYM A;  3SET A;  4U4S A;  3M3F A;  3RPW A;  2QMX A;  3PPN A;  2Y7K A;  1MQH A;  3DP4 A;  3D4G A;  4LQ2 A;  4OXV A;  2O7I A;  3E9X A;  1L5T A;  3HHG A;  1P1O A;  2RF1 A;  3T22 A;  4EXL A;  1AL3 A;  3CR9 A;  3TEP A;  1LAX A;  4G68 C;  4OEV A;  1LCT A;  4RXL A;  5CRY A;  5EHS A;  1US4 A;  4ZED A;  2G93 A;  4NF8 A;  2XD3 A;  4QFP A;  3ZS6 A;  1MPD A;  5AA4 B;  3QAX A;  4JSO A;  3FVN A;  2XXQ A;  2F36 A;  4WKM A;  5DEX B;  3CG3 A;  4H8I A;  3UK4 A;  1FQD A;  2REJ A;  1HSE A;  1Y1Z A;  1XC1 A;  1TFA A;  1A8F A;  1UTH A;  4F2O A;  3O29 A;  1MG1 A;  3CFX A;  3RGY A;  4TOZ A;  5EHM A;  3IAZ A;  3KN7 A;  1ZKB A;  3OEN A;  1SI1 A;  3MP8 A;  4OMB A;  3TTL A;  3RTW B;  3U93 A;  1IXH A;  2H9B A;  1S9T A;  3TCH A;  1M5B A;  4MLV A;  1QUK A;  1D9V A;  2UYE A;  3G3J A;  3S2V A;  2QPQ A;  1Q35 A;  4P11 A;  4AB5 A;  5CI5 A;  1O64 A;  1URS A;  2RC9 A;  3IOU A;  4PP0 A;  3UIF A;  3W9V A;  1DPP A;  1EZ9 A;  3Q25 A;  3CIJ A;  3CFZ A;  4G2Z A;  3TCG A;  5I58 B;  3L6H A;  4G68 B;  2XXR A;  4HCW A;  4QFL A;  3KN8 A;  2ZNS A;  2X7P A;  3PUW E;  3IJO B;  2UVG A;  4R75 A;  1OVT A;  3A3U A;  5ELV A;  3EHS A;  4N07 A;  1ATG A;  2DQV A;  1QUJ A;  3OO8 A;  2AL4 A;  4F3B A;  5K2Y A;  1EH3 A;  1P99 A;  4R6H A;  4PQJ A;  3IOW A;  1KWH A;  3S9L C;  3G3K A;  2F6G A;  1JVY A;  2BJJ X;  1SW2 A;  3RQT A;  3ZSF A;  4ESX A;  3PUV E;  1DSN A;  4OFL A;  2Y7W A;  1PBP A;  1UTB B;  3SEY A;  4RPO A;  4ZEB A;  1TT1 A;  3PGF A;  4OWD A;  4PFT A;  4FAT A;  4EXK A;  3IOV A;  5B70 A;  4H67 A;  3TTM A;  3OO7 A;  1IQ7 A;  3FVG A;  3GXA A;  3CSG A;  4U4X A;  2Z8D A;  3T96 B;  4U22 A;  1N76 A;  3K4U A;  4XIG Q;  2NVU B;  2ZMB A;  4AB6 A;  3TAJ A;  5H8S A;  3HV1 A;  5CMB A;  4ND9 A;  1MQD A;  4EQ9 A;  4KFQ A;  1H3D A;  5JEI A;  3A3C A;  3KJT A;  1B5I A;  3K6V A;  3MZB A;  1DOT A;  1ANF A;  1JEV A;  3EQ1 A;  4P0I A;  2O1L A;  4NF5 A;  1B32 A;  2F8D A;  4OER A;  5DT6 A;  4YMA A;  4OHN A;  2QS3 A;  5TU0 A;  2QS4 A;  1Y4T A;  2I3V A;  2ZYK A;  1MDP 1;  1SI0 A;  2G29 A;  3MWB A;  3OSQ A;  4EQ7 A;  5L9O A;  1A54 A;  1S50 A;  2RIN A;  3BBR A;  4QSC A;  4K3F A;  2IA4 A;  4I8C A;  3RN8 A;  2O84 X;  1QKB A;  2ONR A;  1A40 A;  1M5E A;  2Z8F A;  2RC7 A;  1XVY A;  4E0W A;  3SER A;  1LFH A;  1MH3 A;  4BLA A;  3MPL A;  1YAE A;  4GFR A;  1UTH B;  4NWD A;  3U72 A;  3MAM A;  4EF1 A;  4IO3 A;  3OEM A;  1UTB A;  4YAH X;  2I6E A;  3KFM A;  4WEP A;  5B7D A;  3MVZ A;  1B0L A;  1IXI A;  1GR2 A;  2PVU A;  1SBP A;  2YPN A;  3DP8 A;  3IO4 A;  1BLF A;  3KGC A;  3K00 A;  4R6Y A;  4U1O A;  5CM6 A;  1NNT A;  2DXY A;  5I58 A;  3T9H B;  2V3Q A;  3H6V A;  1FQF A;  1BIY A;  3MVY A;  1B40 A;  3W9W A;  1TWY A;  3K6X A;  3K0V A;  3TKD A;  3VLW A;  4EUO A;  4ISU A;  4F19 A;  1XVX A;  3GZG A;  4H5G A;  4R72 A;  2CMO A;  4FEB A;  5F7V A;  3WAF A;  3TUS A;  3FZV A;  4YB6 A;  2RCB A;  5F1Q A;  3RTF B;  5H8F B;  1IIT A;  2NXO A;  4G68 A;  5DTB A;  1EZO A;  3OO9 A;  4X1D A;  2YLN A;  4TLL B;  5I2K A;  4KYD A;  4QFK A;  1RYO A;  4GOT A;  1ZLQ A;  3IK6 B;  4YIC A;  1QKA A;  3CVG A;  1R9Q A;  1H43 A;  1SW4 A;  3B7D A;  1US5 A;  3Q26 A;  3UN6 A;  1P1U A;  3H6W A;  1MY1 A;  3OD7 A;  1NNF A;  3PMW A;  1RKM A;  3C32 A;  3I3V A;  1A7L A;  1OMP A;  2VP1 A;  3T9U A;  4RK9 A;  5M2V A;  3B6W A;  3U92 A;  1MY4 A;  3QIM A;  2F35 A;  1SYI A;  1POY 1;  1MXU A;  3VVF A; 
#chains in the Genus database with same CATH topology
 2DS9 A;  3RY3 A;  1N04 A;  4N17 A;  2Y7P A;  2VD3 A;  4U1Z A;  4KYS A;  5AA2 D;  3PPP A;  3K1P A;  1QW0 A;  3B8B A;  3MUQ A;  4ZEK A;  3Q29 A;  4ELO A;  2D5W A;  1AH5 A;  4HE1 A;  2UVJ A;  5AA2 B;  3U8Q A;  1LBX A;  3IB1 A;  2FA7 A;  3B50 A;  1B3E A;  1A55 A;  3TQW A;  3ILT B;  2F7C A;  1URG A;  1B4H A;  3JV9 A;  2PX1 A;  2F5X A;  4YB5 A;  5KDT A;  2O6A A;  4OEN A;  5H8H A;  5H8Q B;  2XXU A;  3H06 B;  1B1X A;  4R73 A;  1FTO A;  3SEW A;  1LGB C;  3IJX B;  4BDM A;  2WYK A;  3H03 A;  4NWC A;  4ZDM A;  1SW1 A;  2GHB A;  2HHM A;  1XOC A;  3K1N A;  1YZ0 A;  2OX3 A;  1Y1M A;  4OET A;  3CFL A;  3S9N C;  5J16 A;  5JTY B;  2ESN A;  1B05 A;  1NNK A;  1AMF A;  4I1D A;  4ZE9 A;  1POT A;  1MDQ A;  3LSL A;  3MZ9 A;  5ICQ A;  4AQ4 A;  3E3K A;  2PMS A;  2ZZV A;  2Y7R A;  3P7I A;  1P1Q A;  1IME A;  1B51 A;  4C0R A;  1SVX B;  4HCY A;  4TLM B;  2Z8E A;  3FGS A;  1LBY A;  4N4U A;  5H8H B;  3LBS A;  2B4M A;  4NF5 B;  3PD8 A;  1I6Q A;  3TPA A;  1RDX A;  4DDD A;  5IZ1 A;  4JWX A;  5I59 B;  2P0S A;  3F11 A;  3FUZ A;  3C35 A;  4EDP A;  4HW8 A;  1JP4 A;  1NNP A;  1MXY A;  1B52 A;  2PFZ A;  2VD2 A;  1MPC A;  3QUJ A;  2Q2A A;  4ZZE A;  1AIV A;  1MY2 A;  4NF4 B;  2O51 A;  4PFU A;  4P8B A;  5HBC A;  2OWT A;  4KQP A;  3QMF A;  4IY5 A;  5J1D A;  5LTC A;  4UAC A;  1URD A;  3R26 A;  2HXW A;  4PET A;  4IGR A;  3GBB A;  2B3F A;  3TYH A;  3L6G A;  1B1H A;  4NED A;  1OLA A;  1B0H A;  4Q0C A;  4IO5 A;  5K2X A;  3FBP A;  1LB9 A;  3PMX A;  5CBR A;  4PCD A;  2XX8 A;  3M3K A;  5FHN A;  2CEX A;  4R9F A;  3IB0 A;  5A5X A;  1FRP A;  2OLB A;  2PBW A;  3EHU A;  1LB8 A;  3HN0 A;  3B6T A;  2XXX A;  3BFT A;  2ABH A;  1NUW A;  1LAH E;  4YU0 A;  3N26 A;  3O6G A;  2I49 A;  3LC8 A;  4JWO A;  1B3L A;  4IO7 A;  3LR1 A;  1SW5 A;  1B46 A;  1RYX A;  2A5T B;  4F18 A;  1XHY A;  4DXB A;  2H98 A;  3PU5 A;  1B3H A;  5KCJ B;  3S9M C;  1YCJ A;  1XT8 A;  4RJZ A;  3K6U A;  2Q8J A;  5DYH A;  4H0W A;  2HAV A;  1R9L A;  4AS4 A;  2NUV A;  1OQG A;  3OEL A;  3M3L A;  5A5L A;  5FBP A;  4LVQ A;  2DP8 A;  2IEE A;  4MCO A;  4XKQ A;  3QSL A;  3H6T A;  3RYD A;  1R6Z A;  2H4I A;  2V93 A;  3PPQ A;  4R9G A;  2QJE A;  4MEV A;  2ZYO A;  4O3A A;  4EF2 A;  2XWI A;  4H1X A;  4BDL A;  3TCF A;  5A5X B;  3C34 A;  1K9Y A;  3UA8 A;  3PV0 E;  4GLI A;  4X1B A;  5IM2 A;  1NV7 A;  1HSL A;  2DYX A;  4GD5 A;  4OEU A;  4PFY A;  5AA3 A;  3BKI B;  2PT2 A;  4LZ5 A;  2O1M A;  4O7I A;  2ONS A;  5DW8 A;  5FHM A;  5KCJ A;  3LUY A;  3EF7 A;  5HPQ A;  1VDW A;  2D21 A;  4ELP A;  1KA1 A;  2Q88 A;  2VPN A;  2I0C A;  4DLD A;  3IFC A;  3IO6 A;  4ELR A;  1FTM A;  1XI6 A;  2V4C A;  1LLS A;  4IB2 A;  5IZ3 A;  2Q89 A;  1FTA A;  1LCF A;  2X26 A;  1NMU A;  2GRV A;  3OEK A;  1UIU A;  3G3G A;  4GWW A;  3K6W A;  2QMX A;  2Y7K A;  3D4G A;  4OXV A;  2O7I A;  3E9X A;  3HHG A;  2HPG A;  4EXL A;  3T22 A;  1AL3 A;  2QVR A;  1DBZ A;  1LCT A;  5EHS A;  1NV4 A;  4RXL A;  1US4 A;  2G93 A;  4NF8 A;  2XD3 A;  4QFP A;  5DEX B;  1FQD A;  1XC1 A;  1TFA A;  1UTH A;  4F2O A;  3RGY A;  3KN7 A;  1FJ6 A;  1ZKB A;  4OMB A;  3MP8 A;  3U93 A;  1IMF A;  1D9V A;  3G3J A;  4P11 A;  4AB5 A;  1O64 A;  4PP0 A;  2P3N A;  2XXR A;  3PUW E;  3PTY A;  2UVG A;  3A3U A;  3EHS A;  1G0H A;  1ATG A;  2FVZ A;  1P99 A;  3GYY A;  1KWH A;  1JVY A;  2F6G A;  2BJJ X;  2F3B A;  3RQT A;  1TT1 A;  4PFT A;  3TTM A;  1IQ7 A;  3GXA A;  3CSG A;  4U4X A;  1N76 A;  3K4U A;  2NVU B;  3TAJ A;  1MQD A;  5EYH A;  3KJT A;  1B5I A;  3MZB A;  1DOT A;  5DT6 A;  2QS3 A;  2QS4 A;  1Y4T A;  2I3V A;  3KC1 A;  1MDP 1;  3MWB A;  3E79 A;  5I5P A;  3BBR A;  4I8C A;  4E0W A;  3ISP A;  1MH3 A;  4BLA A;  1UTH B;  4IO3 A;  3OEM A;  2I6E A;  5B7D A;  1IXI A;  2PVU A;  3DP8 A;  2YPN A;  2PFY A;  4PE3 A;  3K00 A;  4U1O A;  3T9H B;  3H6V A;  1B40 A;  3K6X A;  5EQ9 A;  5F7V A;  1IIT A;  1EZO A;  5I2K A;  1RYO A;  4GOT A;  4YIC A;  3Q26 A;  1SW4 A;  3UN6 A;  3H6W A;  1MY1 A;  3OD7 A;  3PMW A;  3C32 A;  3I3V A;  1OMP A;  2FBP A;  2OWZ A;  3B6W A;  4C1U A;  3H6U A;  5ET6 A;  3FJM A;  3K2D A;  1FQA A;  5H8Q A;  3MJN A;  4Z7E A;  1Y9U A;  3U94 A;  5I2N A;  2ZNT A;  1TXF A;  3VLU A;  4LZ8 A;  1UIV A;  4LP2 B;  3CI8 A;  1I69 A;  3V8X B;  3D1R A;  2P2A A;  3KOS A;  1B7U A;  1G0I A;  2OZZ A;  4GRK A;  5CC2 A;  1DMB A;  1WDN A;  5LDZ A;  1OIB A;  5T3J A;  2R8T A;  4G8N A;  3KBR A;  2WX9 A;  1H44 A;  2DE2 A;  3O28 A;  1MXV A;  4RYA A;  2Q2C A;  3VE1 B;  3EHT A;  2ALU A;  3DM0 A;  1DK4 A;  5CMM A;  2THI A;  3CG1 A;  1MXZ A;  2XX9 A;  1FPI A;  4QRZ A;  4OVQ A;  4LAT A;  5I2K B;  4IO4 A;  4O7M A;  2FNC A;  3A29 A;  1GGG A;  2AL5 A;  3TDJ A;  1N3X A;  5TPA A;  1MH4 A;  5DVI A;  1IMD A;  3S4U A;  5TP9 A;  1EYI A;  1LST A;  3FD3 A;  1NUY A;  3MVX A;  1LEV A;  4TQU Q;  2QVV A;  3TQL A;  1Y20 A;  4OTE A;  2GFE A;  4ELQ A;  3C33 A;  4Z0I A;  5I56 A;  3E4R A;  2L5V A;  4P1E A;  4R2B A;  2OJT A;  1FQC A;  4KXP A;  5I59 A;  1O63 A;  4N6P A;  1B4Z A;  2F3D A;  2XXT A;  2DVC A;  3K02 A;  2CZL A;  3OOA A;  2KLF A;  1FQE A;  4MLQ A;  3FXR A;  2DWH A;  5EQA A;  3HHF A;  4QXD A;  1Z7N E;  1FTJ A;  5I57 A;  4HXV A;  4L17 A;  2CZK A;  4GXS B;  3V5A A;  3TTK A;  3O97 A;  4BDN A;  3EKI A;  4F3S A;  4PFW A;  3K1M A;  1NH7 A;  2OK2 A;  1FPL A;  1PBQ A;  2F97 A;  1PB9 A;  4ZEC A;  2XXY A;  3FJ7 A;  4NGU A;  4GF8 A;  1OQH A;  3VXB A;  4PBQ A;  4H8J A;  4O3B A;  4XTC Q;  3SZP A;  4FAJ A;  4QFN A;  3UOR A;  4GWO A;  3D4C A;  4OFJ A;  4QHQ A;  4YMB A;  1JW4 A;  4G8H A;  4YKK A;  2HAU A;  1MXW A;  4N15 A;  2H99 A;  1B3G A;  1M5D A;  1P1N A;  2R6G E;  4PFR A;  1BTJ A;  3A09 A;  1PC3 A;  2DE4 A;  4WED A;  3FAS A;  1M5F A;  3MYU A;  1F9B A;  1DTZ A;  4GL8 A;  3OSR A;  1Q1K A;  1NH8 A;  1FBC A;  3SES A;  4Q5T A;  1R1N A;  3IOT A;  3PUY E;  3FV2 A;  4MH5 A;  3SEX A;  5I57 B;  2F6P A;  2ZZW A;  4LA9 A;  3SKP A;  1CE2 A;  1T0K A;  2XXP A;  5CBS A;  5EQ7 A;  2WKY A;  3FAT A;  4F22 A;  4P3L A;  1CB6 A;  4RPN A;  1NUX A;  2I3W A;  1MS7 A;  2ZXT A;  4RK2 A;  3FVO A;  3LSW A;  1MPB A;  4XKN A;  2GH9 A;  3RUM A;  1PEB A;  3C31 A;  3MZ1 A;  3IOR A;  4X48 A;  3BIH A;  3EPE A;  4Q8R A;  3MP1 A;  1B2H A;  2XWV A;  1NL5 A;  2XXW A;  1JW1 A;  1QUL A;  3MBP A;  1LBW A;  3ECR A;  1YYZ A;  3KEI A;  3KG2 A;  1NV2 A;  3OXN A;  2M8C A;  4U21 A;  4YKI A;  4G4P A;  4FOR A;  4JB7 A;  4P56 A;  1MM6 A;  1QVS A;  1EU8 A;  4YKJ A;  4O8M A;  2LAO A;  4PAI A;  2KR0 A;  4M4G A;  1SQY A;  1NUZ A;  2WBB A;  4QSE A;  4R6K A;  2XXI A;  4BDO A;  4PE5 B;  5CMK A;  3M8U A;  4QSD A;  1EYJ A;  2Z22 A;  1ZTY A;  4E0X A;  4DCX A;  1AWB A;  4JXI A;  4N13 A;  4F3G A;  1YPN A;  1NV5 A;  5ET7 A;  4IO2 A;  3QYT A;  3KSJ A;  4NF0 A;  3BIG A;  2DSF A;  1LBZ A;  1FBH A;  1ZBM A;  4MNP A;  5IZZ A;  1Y3P A;  1MQJ A;  4FE8 A;  3N6T A;  4OQO A;  1VE4 A;  1Q9D A;  4HE0 A;  3EN3 A;  2A5S A;  3H4Z A;  2Z23 A;  2DWI A;  1MXX A;  4EQB A;  2UVI A;  1WVJ A;  4ECF A;  3JZJ A;  3O9P A;  4KCD A;  2VT5 A;  1N3W A;  3RLF E;  2ZYM A;  3PPN A;  1MQH A;  2WBD A;  3DP4 A;  1P1O A;  3TEP A;  3CR9 A;  1LAX A;  3TUS A;  1MPD A;  5AA4 B;  3FVN A;  4WKM A;  4H8I A;  1HSE A;  3O29 A;  1BK4 A;  3TTL A;  1SI1 A;  4N6K A;  1S9T A;  4MLV A;  1QUK A;  4MX6 A;  2UYE A;  3S2V A;  1FPB A;  5F24 A;  3UIF A;  3W9V A;  3CIJ A;  3CFZ A;  3L6H A;  4R75 A;  5ELV A;  2X7P A;  1OVT A;  4GWU A;  2BJI A;  4I3E A;  3OO8 A;  4F3B A;  5K2Y A;  3S9L C;  3ZSF A;  1PBP A;  3SEY A;  4EXK A;  3OO7 A;  4U22 A;  4XIG Q;  5CMB A;  4ND9 A;  4EQ9 A;  1H3D A;  3K6V A;  3EQ1 A;  4OER A;  1B32 A;  4OHN A;  3RPL A;  1FJ9 A;  5TU0 A;  1SI0 A;  1A54 A;  1S50 A;  2RIN A;  3RN8 A;  1A40 A;  1M5E A;  1XVY A;  1LFH A;  1YAE A;  2HXR A;  4EF1 A;  4FBP A;  4YAH X;  3KFM A;  3MVZ A;  3T0J A;  1SBP A;  1BLF A;  2DXY A;  5I58 A;  4XF5 A;  1FQF A;  4MNC A;  3VLW A;  3GZG A;  5DTB A;  4X1D A;  4KYD A;  1FBP A;  1ZLQ A;  1QKA A;  2P3V A;  4DI3 D;  1RKM A;  1A7L A;  4RK9 A;  1MXU A;  3VVF A;  4OFO A;  3CHG A;  1FTK A;  3I6V A;  1YXI A;  2W7Y A;  3TOD A;  4FIM A;  1PB8 A;  1B5J A;  4OAN A;  3VVD A;  5H8F A;  1B7Z A;  3JYR A;  3U1O A;  1AOV A;  4PGN A;  4OVJ A;  1GTK A;  4GQO A;  1FPF A;  2XXV A;  1FPG A;  4GXA A;  3PPR A;  4C1T A;  2XWO A;  1RDY A;  4YB7 A;  4DXC A;  3DEL B;  4NAP A;  2I4C A;  4PDH A;  2Y7I A;  1USY E;  4DCY A;  1FQB A;  4QFO A;  4YZZ A;  4OA4 A;  2HQ0 A;  4JDF A;  4FED A;  1YTV A;  4NF6 A;  3G3I A;  3SEV A;  4HE2 A;  2QMW A;  4MIJ A;  3G3F A;  4QBA A;  4UA8 A;  1D9Q A;  3E13 X;  3K01 A;  3LSX A;  3FXU A;  5DVF A;  2I48 A;  1B9J A;  1J1N A;  1DTG A;  4O94 A;  1FPJ A;  2QS2 A;  3UGW A;  3IR1 A;  3Q27 A;  5H8N B;  3TMG A;  1I6A A;  1IXG A;  4JVC A;  4GL0 A;  3E78 A;  5HM4 B;  5KDT B;  4PAK A;  2F7A A;  4G77 A;  4XFE A;  3DLN A;  4RY1 A;  1NFT A;  4JSD A;  1MY0 A;  5CMC A;  2DOJ A;  1IMC A;  3OO6 A;  1JQF A;  1SDX A;  4H5F A;  5AE4 A;  3PMV A;  3QUF A;  3FIR A;  4N91 A;  3T66 A;  4I62 A;  4OVS A;  3KC0 A;  2UYF A;  2RCA A;  2UXA A;  2FHY A;  1LBB A;  1XS5 A;  4G8M A;  1N7W A;  5ET5 A;  4NF6 B;  2E0S A;  1PDA A;  2B65 A;  3CSB A;  2FYI A;  5JTY A;  3FV1 A;  5ICT A;  2F7B A;  2A5T A;  1MRP A;  3MP6 A;  2V25 A;  4H6D A;  1FSA A;  3U65 A;  4RA1 A;  4DZ1 A;  4LN5 A;  1BKA A;  3H7M A;  1Y3Q A;  1B5H A;  3V83 A;  1I6B A;  3C4M A;  1QJM A;  1FW0 A;  4GBV A;  3V89 B;  3KN3 A;  4F1U A;  1Y4C A;  2KQZ A;  2R71 A;  3KOT A;  3FXQ A;  1VSO A;  1JEU A;  1DPE A;  1VFD A;  4OES A;  1HSJ A;  1ZU0 A;  4LQ5 A;  3TTN A;  1II5 A;  4HS7 A;  1WOD A;  4KHZ E;  1PB7 A;  1N84 A;  1NV3 A;  3H3G A;  3IB2 A;  1JW5 A;  4JWY A;  2X7Q A;  5FTI A;  4NF4 A;  4POX A;  3O6I A;  1LBC A;  1SYH A;  3QXM A;  4X8R A;  1MQI A;  1D3K A;  1FCK A;  5I3S A;  1H76 A;  2QS1 A;  1ELJ A;  5ESY A;  2XX7 A;  1JET A;  1LAG E;  3MVW A;  2XHD A;  4U23 A;  4KI0 E;  4QF9 A;  4MFI A;  1S7Y A;  3DP6 A;  1ZJL A;  2V84 A;  3KZG A;  2ANJ A;  1NI9 A;  3PUX E;  4ZEF A;  1VFE A;  5TP9 B;  3HPI A;  3HST A;  3MQ9 A;  5BUU A;  1IZ1 A;  5EYF A;  3OMB A;  4GX3 A;  1M5C A;  5I56 B;  2QRY A;  2WYP A;  4F1V A;  3C36 A;  4NF8 B;  4FEC A;  3KSX A;  5DEX A;  4KPT A;  3ILU B;  4IGT A;  2NWJ A;  3R6U A;  4P0G A;  4POW A;  1CNQ A;  4OVR A;  2F78 A;  3UP9 A;  3IX1 A;  1A8E A;  3Q28 A;  2P1S A;  2H5Y A;  1IMA A;  2DVZ A;  2XD2 A;  1SD3 A;  4YKP A;  4MMP A;  1INP A;  1Y3N A;  4ZZA A;  2Q9T A;  4RNS A;  2VGQ A;  4AS5 A;  1FBE A;  2O69 A;  3RT8 A;  1MY3 A;  4BDR A;  4I40 A;  4GWX A;  2V3T A;  2AIX A;  4N81 A;  5ISU A;  1IIW A;  4ISU A;  4GVO A;  5ITO A;  2O7U A;  4GWZ A;  3SET A;  3M3F A;  4LQ2 A;  2RF1 A;  4NG7 A;  4G68 C;  3ZS6 A;  4PDD A;  4MHF A;  3QAX A;  4JSO A;  2F36 A;  3LV0 A;  2REJ A;  1FPD A;  1MG1 A;  4TOZ A;  5EHM A;  3IAZ A;  3OEN A;  3RTW B;  1IXH A;  3TCH A;  1M5B A;  1KZ8 A;  4MJO A;  2FIE A;  2QPQ A;  1Q35 A;  5CI5 A;  3IOU A;  4GWS A;  1DPP A;  3Q25 A;  4NN3 A;  3RPL B;  4QFL A;  3IJO B;  5EYG A;  2DQV A;  2AL4 A;  4PQJ A;  4GBW A;  3G3K A;  1SW2 A;  1DSN A;  4N8Y A;  4RPO A;  4P47 A;  4H67 A;  2Z8D A;  3HV1 A;  1ANF A;  4P0I A;  2O1L A;  4NF5 A;  4YMA A;  2ZYK A;  5L9O A;  2CZI A;  4K3F A;  2IA4 A;  2O84 X;  1QKB A;  2ONR A;  1FPE A;  2Z8F A;  2RC7 A;  1UTB A;  4I3Y A;  2PCR A;  3KGC A;  4R6Y A;  1NV6 A;  5CM6 A;  1NNT A;  4IR8 A;  1K9Z A;  4NX1 A;  1BIY A;  3W9W A;  1TWY A;  4F19 A;  1XVX A;  4H5G A;  3WAF A;  4G61 A;  5H8F B;  5ET8 A;  2NXO A;  3OO9 A;  2YLN A;  4QFK A;  3CVG A;  1R9Q A;  1H43 A;  2VPO A;  1P1U A;  1NNF A;  2VP1 A;  3QIM A;  1POY 1;  4F2Q A;  4NE4 A;  5KZT A;  4OVT A;  3TTR A;  3G7W A;  1ZIU A;  1VR5 A;  4XKR A;  5IAI A;  2HZK A;  3TEL A;  4U2R A;  1D9Y A;  4PF8 A;  1FBG A;  2DE3 A;  1A99 A;  4THI A;  1MQG A;  4MAG A;  2AYS A;  1O7T A;  3HO7 A;  4PFB A;  4UAB A;  2Q8M A;  3B6Q A;  3MW0 A;  1NV1 A;  2QFL A;  4PFI A;  3T93 B;  3W15 C;  4JVD A;  2XXK A;  1RDZ A;  1IEJ A;  3S9E A;  5AA2 A;  2VHA A;  5AA4 A;  3ZKK A;  1H45 A;  2JJK A;  5H8N A;  4LZ7 A;  1OLC A;  3C9H A;  4XEQ A;  1FPK A;  3THI A;  1QUI A;  4H46 A;  3ROJ A;  2GHA A;  1NV0 A;  1N0T A;  2PT1 A;  5LOM A;  4R74 A;  4ESW A;  2ZZX A;  3QK6 A;  5DVJ A;  1LFI A;  3ONM A;  4ZEI A;  3T9X B;  1EZP A;  3RT6 B;  2Y5K A;  4XKP A;  3N94 A;  3HCQ A;  1FBF A;  1NKX A;  2HCA A;  2I58 A;  4OVP A;  4IY6 A;  5BWJ A;  5I84 A;  2OCU A;  2OWS A;  3G3H A;  4F29 A;  4R2F A;  2H25 A;  5IGA A;  3N6U A;  1Z7M E;  3FXB A;  2UVH A;  4XXU A;  1LFG A;  3IL1 B;  3SDF A;  3PPO A;  4ZE8 A;  5TPA B;  3VXC A;  1FTL A;  3N5L A;  1P1W A;  4NTL A;  4ONY A;  2OBG A;  3WAE A;  2HZL A;  2HFB A;  2PYY A;  1MM7 A;  3ZKL A;  3FJG A;  3TFL A;  2VOZ A;  2I4B A;  3KJ7 A;  4M1V A;  5EQ8 A;  2F34 A;  4PTK A;  2HEU A;  3O6H A;  4KD5 A;  3LSF B;  3VV5 A;  2QVU A;  2ONK E;  2CEY A;  3O66 A;  1GVC A;  4WXJ A;  3MPK A;  4KYE A;  1QGX A;  5I7I A;  4JVI A;  2O68 A;  4OZ9 A;  4OYV A;  2DWJ A;  4FJP A;  3ODB A;  4F3P A;  3MST A;  3SEU A;  4N8G A;  2B3B A;  5AA1 A;  5L9M A;  4IO6 A;  4ZS9 A;  2ZNU A;  3VLV A;  4JBZ A;  3GLB A;  2WEF A;  4P9K A;  1JVX A;  2QL3 A;  2E1S A;  2RC8 A;  5FTH A;  4O3C A;  3AXF A;  3MC2 A;  2I0B A;  4GWY A;  3HFU A;  4I9D A;  1ZMG A;  2DDK A;  1TFD A;  1USY H;  2MKZ A;  1B58 A;  2NOO A;  3FVK A;  2REG A;  3GBA A;  1D4N A;  4N6D A;  1IMB A;  4Q30 B;  4NMY A;  2FIX A;  4F1Y A;  5ITP A;  5L9S A;  5IKB A;  1LAF E;  2RKM A;  1FBD A;  4X9T A;  3USD A;  3VVE A;  4H45 A;  1LBV A;  3O2A A;  4H65 A;  3T9V A;  4KCC A;  1JNF A;  4HTG A;  1GV8 A;  2XXH A;  2DXR A;  5JK4 A;  3VDF A;  1B3F A;  4MF3 A;  4MBP A;  1UQW A;  1OVB A;  3I5O A;  4DI4 B;  1IXC A;  4LUB A;  4DXU A;  3TZA A;  1BP5 A;  3R7X A;  3CRB A;  2D3I A;  4GX6 A;  3RNN A;  5I2N B;  4P1L A;  4LON B;  3PD9 A;  4DIG A;  4PAF A;  2DWA A;  4DE8 A;  3NOH A;  4F31 B;  1KA0 A;  1EYK A;  1N7X A;  4KR5 A;  2R9J A;  2QSX A;  4F39 A;  3BFU A;  3T1B A;  2GQ1 A;  5L8D A;  5FHO A;  4BDQ A;  3VFJ A;  4GIZ A;  3PUZ E;  1IUD A;  2Y84 A;  1B6H A;  2YJP A;  1B7H A;  2CZH A;  2V3U A;  4U4S A;  3RPW A;  1L5T A;  4OEV A;  4ZED A;  5CRY A;  2XXQ A;  3UK4 A;  3CG3 A;  1Y1Z A;  1A8F A;  4PBH A;  3CFX A;  2H9B A;  2B4L A;  5IZ3 B;  2XA5 A;  2RC9 A;  1URS A;  1EZ9 A;  3TCG A;  5I58 B;  4G2Z A;  4PF6 A;  1DCU A;  4G68 B;  4PC9 A;  4HCW A;  3KN8 A;  2ZNS A;  4N07 A;  1QUJ A;  1EH3 A;  4R6H A;  3IOW A;  4ESX A;  3PUV E;  4OFL A;  2Y7W A;  1UTB B;  4ZEB A;  3PGF A;  4OWD A;  4NHB A;  4FAT A;  3IOV A;  5B70 A;  4PGP A;  2Q74 A;  3FVG A;  2F35 A;  3T96 B;  2ZMB A;  4AB6 A;  5H8S A;  4KFQ A;  5JEI A;  3A3C A;  4X04 A;  1JEV A;  2F8D A;  2G29 A;  3OSQ A;  4EQ7 A;  4QSC A;  3LUZ A;  3SER A;  3MPL A;  3IFA A;  4GFR A;  4NWD A;  3U72 A;  3MAM A;  4NQ8 A;  4WEP A;  4GX4 A;  1B0L A;  1GR2 A;  3IO4 A;  2Y5L A;  2V3Q A;  3MVY A;  4EUO A;  3K0V A;  3TKD A;  4MNI A;  4R72 A;  2CMO A;  4FEB A;  1SPI A;  3FZV A;  4YB6 A;  2RCB A;  5F1Q A;  3RTF B;  4G68 A;  4TLL B;  3IK6 B;  3B7D A;  1US5 A;  3KBZ A;  3T9U A;  5M2V A;  3U92 A;  1MY4 A;  2ZYN A;  1SYI A;  2XWK A; 
#chains in the Genus database with same CATH homology
 4C1U A;  2DS9 A;  3V89 B;  3RY3 A;  1N04 A;  4OFO A;  1FTK A;  2Y7P A;  3I6V A;  3H6U A;  4NE4 A;  3FJM A;  3K2D A;  5KZT A;  2VD3 A;  2W7Y A;  4U1Z A;  4KYS A;  3TTR A;  3G7W A;  1FQA A;  5AA2 D;  1ZIU A;  5H8Q A;  3TOD A;  3MJN A;  4Z7E A;  1VR5 A;  3K1P A;  1Y9U A;  3PPP A;  3U94 A;  5I2N A;  2ZNT A;  4FIM A;  1TXF A;  3VLU A;  4LZ8 A;  1QW0 A;  4XKR A;  5IAI A;  1UIV A;  2HZK A;  1PB8 A;  3MUQ A;  4LP2 B;  4ZEK A;  1B5J A;  3Q29 A;  2D5W A;  3TEL A;  4U2R A;  1D9Y A;  4ELO A;  3CI8 A;  1AH5 A;  4F1U A;  3VVD A;  2UVJ A;  1I69 A;  5AA2 B;  3V8X B;  3U8Q A;  5H8F A;  1B7Z A;  3JYR A;  2P2A A;  2DE3 A;  3KOS A;  3IB1 A;  1B7U A;  2OZZ A;  2FA7 A;  4GRK A;  3U1O A;  1DMB A;  5CC2 A;  1AOV A;  1A99 A;  1WDN A;  4THI A;  1OIB A;  1MQG A;  4OVJ A;  1GTK A;  4GQO A;  4G8N A;  3KBR A;  1B3E A;  1A55 A;  3TQW A;  2AYS A;  2XXV A;  3ILT B;  2F7C A;  4GXA A;  1O7T A;  1URG A;  1H44 A;  3HO7 A;  3PPR A;  4C1T A;  1B4H A;  3JV9 A;  2DE2 A;  2PX1 A;  3B6Q A;  3O28 A;  2F5X A;  3MW0 A;  4YB5 A;  1MXV A;  4RYA A;  5KDT A;  3T93 B;  2O6A A;  2Q2C A;  4OEN A;  5H8H A;  3EHT A;  3VE1 B;  5H8Q B;  2ALU A;  4YB7 A;  3W15 C;  2XXU A;  3H06 B;  4DXC A;  1B1X A;  3DM0 A;  4R73 A;  3DEL B;  1FTO A;  2I4C A;  1IEJ A;  5CMM A;  2THI A;  3CG1 A;  2Y7I A;  1LGB C;  1MXZ A;  1USY E;  2XX9 A;  3IJX B;  3SEW A;  4BDM A;  3S9E A;  4DCY A;  4QRZ A;  5AA2 A;  2VHA A;  5AA4 A;  3H03 A;  3ZKK A;  1FQB A;  4LAT A;  4QFO A;  1H45 A;  5I2K B;  4IO4 A;  4YZZ A;  5H8N A;  4LZ7 A;  1OLC A;  2FNC A;  3C9H A;  4NWC A;  4ZDM A;  1GGG A;  2AL5 A;  1SW1 A;  2HQ0 A;  4FED A;  4JDF A;  3TDJ A;  1N3X A;  4F18 A;  5TPA A;  1MH4 A;  1YTV A;  2GHB A;  4NF6 A;  5DVI A;  3G3I A;  3SEV A;  3S4U A;  3THI A;  1XOC A;  5TP9 A;  1LST A;  1QUI A;  3FD3 A;  3K1N A;  2QMW A;  3MVX A;  1Y1M A;  4TQU Q;  3G3F A;  4OET A;  2GHA A;  4ECF A;  4UA8 A;  3CFL A;  3S9N C;  1N0T A;  3TQL A;  3E13 X;  1Y20 A;  2PT1 A;  4OTE A;  5LOM A;  4R74 A;  2GFE A;  3TYH A;  3C33 A;  3K01 A;  4ELQ A;  4ESW A;  3LSX A;  4Z0I A;  3FXU A;  5JTY B;  5I56 A;  3E4R A;  3QK6 A;  5DVF A;  5DVJ A;  1LFI A;  2ESN A;  3ONM A;  1B05 A;  2I48 A;  4R2B A;  1NNK A;  1AMF A;  4ZEI A;  2OJT A;  1FQC A;  4I1D A;  3T9X B;  1B9J A;  1J1N A;  1DTG A;  4ZE9 A;  2QS2 A;  3UGW A;  5I59 A;  1O63 A;  4N6P A;  1B4Z A;  1POT A;  3IR1 A;  1MDQ A;  2XXT A;  2DVC A;  5I59 B;  3LSL A;  1EZP A;  3Q27 A;  3RT6 B;  4XKP A;  3N94 A;  5H8N B;  3MZ9 A;  3HCQ A;  5ICQ A;  4AQ4 A;  3E3K A;  3K02 A;  3TMG A;  2CZL A;  3OOA A;  1I6A A;  1IXG A;  1NKX A;  2KLF A;  1FQE A;  2HCA A;  2I58 A;  2PMS A;  3P7I A;  2Y7R A;  4MLQ A;  3FXR A;  2DWH A;  4GL0 A;  4IY6 A;  1P1Q A;  3HHF A;  5HM4 B;  5KDT B;  1Z7N E;  2F7A A;  1B51 A;  1FTJ A;  5BWJ A;  4G77 A;  4C0R A;  5I57 A;  5I84 A;  2OCU A;  2OWS A;  3G3H A;  4F29 A;  4L17 A;  4GXS B;  4R2F A;  3V5A A;  3DLN A;  4RY1 A;  2H25 A;  1NFT A;  4JSD A;  1SVX B;  4HCY A;  1MY0 A;  3N6U A;  4TLM B;  1Z7M E;  5CMC A;  2Z8E A;  3FGS A;  2DOJ A;  3O97 A;  3TTK A;  2UVH A;  4BDN A;  5H8H B;  3LBS A;  4F3S A;  3OO6 A;  1JQF A;  3K1M A;  1NH7 A;  1SDX A;  2OK2 A;  4NF5 B;  4PFW A;  4XXU A;  1LFG A;  1PBQ A;  3PD8 A;  3IL1 B;  3SDF A;  1I6Q A;  3TPA A;  2F97 A;  4H5F A;  3PPO A;  5AE4 A;  1PB9 A;  4ZE8 A;  3PMV A;  3QUF A;  3FIR A;  5TPA B;  3T66 A;  1FTL A;  3N5L A;  4JWX A;  3VXC A;  4DDD A;  2P0S A;  1P1W A;  2XXY A;  3F11 A;  3FUZ A;  4I62 A;  4NTL A;  3C35 A;  4ONY A;  2OBG A;  2UYF A;  3FJ7 A;  2HZL A;  2RCA A;  3WAE A;  4EDP A;  4HW8 A;  4GF8 A;  1NNP A;  1MXY A;  2UXA A;  1OQH A;  2HFB A;  1LBB A;  1XS5 A;  1B52 A;  4G8M A;  3VXB A;  2PYY A;  1N7W A;  1MM7 A;  4NF6 B;  2E0S A;  1PDA A;  2VD2 A;  1MPC A;  3QUJ A;  2Q2A A;  2B65 A;  3CSB A;  4H8J A;  4O3B A;  4XTC Q;  2FYI A;  4ZZE A;  3FJG A;  3TFL A;  3ZKL A;  2VOZ A;  4FAJ A;  2I4B A;  5JTY A;  3FV1 A;  3KJ7 A;  4M1V A;  2F34 A;  1AIV A;  4QFN A;  1MY2 A;  5ICT A;  2F7B A;  2A5T A;  1MRP A;  3MP6 A;  2HEU A;  2O51 A;  2V25 A;  4H6D A;  4NF4 B;  4PFU A;  5HBC A;  4RA1 A;  2OWT A;  4KQP A;  3UOR A;  4DZ1 A;  4GWO A;  3D4C A;  3O6H A;  4KD5 A;  4IY5 A;  3LSF B;  4OFJ A;  3VV5 A;  5J1D A;  4UAC A;  2ONK E;  4QHQ A;  4YMB A;  1JW4 A;  1URD A;  4G8H A;  4YKK A;  2HAU A;  3R26 A;  1MXW A;  1BKA A;  3O66 A;  1GVC A;  4WXJ A;  3H7M A;  1Y3Q A;  2H99 A;  2HXW A;  3MPK A;  1B5H A;  3V83 A;  1B3G A;  1I6B A;  4ZEC A;  1M5D A;  1P1N A;  2R6G E;  3C4M A;  1BTJ A;  1QJM A;  4KYE A;  4PET A;  4IGR A;  3GBB A;  1FW0 A;  2B3F A;  3L6G A;  1B1H A;  2O68 A;  3A09 A;  4OYV A;  1PC3 A;  4OZ9 A;  2DE4 A;  4WED A;  4NED A;  2DWJ A;  1OLA A;  4FJP A;  3FAS A;  3KN3 A;  1B0H A;  3ODB A;  1M5F A;  4Q0C A;  4IO5 A;  1F9B A;  1DTZ A;  4GL8 A;  3OSR A;  5K2X A;  1Q1K A;  1Y4C A;  1NH8 A;  4F3P A;  2R71 A;  3SES A;  3KOT A;  4Q5T A;  1R1N A;  3IOT A;  1LB9 A;  3PUY E;  3FV2 A;  1VSO A;  3FXQ A;  2B3B A;  4MH5 A;  3SEX A;  3PMX A;  3SEU A;  5AA1 A;  5CBR A;  5I57 B;  5L9M A;  1JEU A;  1DPE A;  2XX8 A;  2F6P A;  3M3K A;  4IO6 A;  4ZS9 A;  1VFD A;  4LA9 A;  5FHN A;  3SKP A;  2ZNU A;  4OES A;  1HSJ A;  1CE2 A;  4R9F A;  1ZU0 A;  4LQ5 A;  3IB0 A;  3TTN A;  5A5X A;  1II5 A;  2OLB A;  2PBW A;  3VLV A;  3EHU A;  4JBZ A;  1LB8 A;  2XXP A;  3GLB A;  3HN0 A;  4HS7 A;  1T0K A;  3B6T A;  2XXX A;  3BFT A;  5CBS A;  1WOD A;  2ABH A;  1JVX A;  2QL3 A;  2WKY A;  3FAT A;  1LAH E;  4YU0 A;  4KHZ E;  1PB7 A;  4F22 A;  3N26 A;  3O6G A;  1N84 A;  3H3G A;  1CB6 A;  2E1S A;  2I49 A;  2RC8 A;  2I3W A;  3IB2 A;  3LC8 A;  4JWO A;  1B3L A;  4O3C A;  4RPN A;  5FTH A;  1MS7 A;  4IO7 A;  2ZXT A;  3AXF A;  3MC2 A;  4RK2 A;  1JW5 A;  3FVO A;  4JWY A;  2I0B A;  3LSW A;  2X7Q A;  3LR1 A;  1SW5 A;  1B46 A;  1MPB A;  4XKN A;  5FTI A;  2GH9 A;  4I9D A;  1RYX A;  1ZMG A;  2A5T B;  1XHY A;  1PEB A;  4NF4 A;  3RUM A;  3C31 A;  2H98 A;  3O6I A;  4POX A;  3MZ1 A;  1LBC A;  3PU5 A;  4DXB A;  1SYH A;  2ZYN A;  3QXM A;  1B3H A;  1MQI A;  1D3K A;  5KCJ B;  3S9M C;  1FCK A;  3IOR A;  1TFD A;  1H76 A;  1USY H;  1ELJ A;  2QS1 A;  1YCJ A;  4X48 A;  1B58 A;  1XT8 A;  3EPE A;  4RJZ A;  2NOO A;  3FVK A;  2XX7 A;  4Q8R A;  2REG A;  3MP1 A;  3GBA A;  1JET A;  1LAG E;  1D4N A;  3K6U A;  2Q8J A;  5DYH A;  1B2H A;  4H0W A;  4Q30 B;  3MVW A;  4NMY A;  4F1Y A;  2HAV A;  2XHD A;  1NL5 A;  2XXW A;  4U23 A;  5ITP A;  1R9L A;  4KI0 E;  5L9S A;  5IKB A;  1JW1 A;  4QF9 A;  1QUL A;  3MBP A;  3ECR A;  2NUV A;  1LAF E;  2RKM A;  4MFI A;  3KEI A;  1S7Y A;  3DP6 A;  3KG2 A;  3OXN A;  1ZJL A;  2M8C A;  2V84 A;  4U21 A;  3KZG A;  4YKI A;  4G4P A;  4FOR A;  2ANJ A;  4JB7 A;  1OQG A;  3PUX E;  4X9T A;  4ZEF A;  1MM6 A;  1QVS A;  1EU8 A;  3OEL A;  3M3L A;  4YKJ A;  1VFE A;  5TP9 B;  2LAO A;  4LVQ A;  2DP8 A;  3USD A;  3VVE A;  2IEE A;  3HPI A;  4XKQ A;  4M4G A;  1SQY A;  3HST A;  3O2A A;  4H65 A;  4QSE A;  3MQ9 A;  4R6K A;  3T9V A;  2XXI A;  3QSL A;  4KCC A;  4BDO A;  5BUU A;  1JNF A;  4HTG A;  1IZ1 A;  4PE5 B;  5EYF A;  1GV8 A;  3M8U A;  5CMK A;  4QSD A;  2XXH A;  3H6T A;  3OMB A;  2DXR A;  1R6Z A;  2H4I A;  2V93 A;  3PPQ A;  4R9G A;  1M5C A;  2QJE A;  3VDF A;  1B3F A;  2QRY A;  5I56 B;  5JK4 A;  2Z22 A;  4F2Q A;  4F1V A;  3C36 A;  1ZTY A;  4E0X A;  2ZYO A;  4DCX A;  4O3A A;  4MF3 A;  4EF2 A;  4H1X A;  4BDL A;  3TCF A;  4MBP A;  4FEC A;  4NF8 B;  1UQW A;  3KSX A;  5A5X B;  4JXI A;  4N13 A;  4F3G A;  1OVB A;  3C34 A;  1YPN A;  3I5O A;  5DEX A;  3UA8 A;  3PV0 E;  4KPT A;  3ILU B;  4IGT A;  4GLI A;  4X1B A;  1IXC A;  4IO2 A;  3R6U A;  1HSL A;  2DYX A;  4P0G A;  4POW A;  2NWJ A;  3QYT A;  3KSJ A;  4LUB A;  4GD5 A;  3TZA A;  4OEU A;  4DXU A;  1BP5 A;  3R7X A;  4PFY A;  2F78 A;  5AA3 A;  3CRB A;  3UP9 A;  3BKI B;  2DSF A;  2PT2 A;  2D3I A;  3IX1 A;  1A8E A;  4LZ5 A;  2O1M A;  3Q28 A;  3RNN A;  2P1S A;  5I2N B;  1ZBM A;  2H5Y A;  4LON B;  3PD9 A;  4DIG A;  2DVZ A;  2XD2 A;  2ONS A;  1SD3 A;  2DWA A;  1Y3P A;  4DE8 A;  4YKP A;  5FHM A;  4F31 B;  3LUY A;  5KCJ A;  3EF7 A;  5HPQ A;  1Y3N A;  1MQJ A;  2D21 A;  4ZZA A;  1N7X A;  2Q9T A;  4ELP A;  4RNS A;  4FE8 A;  2VGQ A;  3N6T A;  4KR5 A;  2Q88 A;  4OQO A;  1VE4 A;  2I0C A;  2R9J A;  2QSX A;  2O69 A;  3RT8 A;  4F39 A;  1MY3 A;  3BFU A;  3EN3 A;  4BDR A;  4DLD A;  5L8D A;  5FHO A;  2A5S A;  4BDQ A;  3VFJ A;  2V3T A;  4GIZ A;  3H4Z A;  3PUZ E;  1IUD A;  3IO6 A;  4ELR A;  2Z23 A;  2AIX A;  2DWI A;  1FTM A;  1MXX A;  4EQB A;  2Y84 A;  2UVI A;  5ISU A;  1WVJ A;  1IIW A;  1B6H A;  1LLS A;  2YJP A;  2Q89 A;  4IB2 A;  3JZJ A;  3O9P A;  1LCF A;  1B7H A;  2X26 A;  1NMU A;  2GRV A;  3OEK A;  4GVO A;  4KCD A;  2O7U A;  1N3W A;  1UIU A;  3G3G A;  5ITO A;  3K6W A;  3RLF E;  2V3U A;  2ZYM A;  3SET A;  4U4S A;  3M3F A;  3RPW A;  2QMX A;  3PPN A;  2Y7K A;  1MQH A;  3DP4 A;  3D4G A;  4LQ2 A;  4OXV A;  2O7I A;  3E9X A;  1L5T A;  3HHG A;  1P1O A;  2RF1 A;  3T22 A;  4EXL A;  1AL3 A;  3CR9 A;  3TEP A;  1LAX A;  4G68 C;  4OEV A;  1LCT A;  4RXL A;  5CRY A;  5EHS A;  1US4 A;  4ZED A;  2G93 A;  4NF8 A;  2XD3 A;  4QFP A;  3ZS6 A;  1MPD A;  5AA4 B;  3QAX A;  4JSO A;  3FVN A;  2XXQ A;  2F36 A;  4WKM A;  5DEX B;  3CG3 A;  4H8I A;  3UK4 A;  1FQD A;  2REJ A;  1HSE A;  1Y1Z A;  1XC1 A;  1TFA A;  1A8F A;  1UTH A;  4F2O A;  3O29 A;  1MG1 A;  3CFX A;  3RGY A;  4TOZ A;  5EHM A;  3IAZ A;  3KN7 A;  1ZKB A;  3OEN A;  1SI1 A;  3MP8 A;  4OMB A;  3TTL A;  3RTW B;  3U93 A;  1IXH A;  2H9B A;  1S9T A;  3TCH A;  1M5B A;  4MLV A;  1QUK A;  1D9V A;  2UYE A;  3G3J A;  3S2V A;  2QPQ A;  1Q35 A;  4P11 A;  4AB5 A;  5CI5 A;  1O64 A;  1URS A;  2RC9 A;  3IOU A;  4PP0 A;  3UIF A;  3W9V A;  1DPP A;  1EZ9 A;  3Q25 A;  3CIJ A;  3CFZ A;  4G2Z A;  3TCG A;  5I58 B;  3L6H A;  4G68 B;  2XXR A;  4HCW A;  4QFL A;  3KN8 A;  2ZNS A;  2X7P A;  3PUW E;  3IJO B;  2UVG A;  4R75 A;  1OVT A;  3A3U A;  5ELV A;  3EHS A;  4N07 A;  1ATG A;  2DQV A;  1QUJ A;  3OO8 A;  2AL4 A;  4F3B A;  5K2Y A;  1EH3 A;  1P99 A;  4R6H A;  4PQJ A;  3IOW A;  1KWH A;  3S9L C;  3G3K A;  2F6G A;  1JVY A;  2BJJ X;  1SW2 A;  3RQT A;  3ZSF A;  4ESX A;  3PUV E;  1DSN A;  4OFL A;  2Y7W A;  1PBP A;  1UTB B;  3SEY A;  4RPO A;  4ZEB A;  1TT1 A;  3PGF A;  4OWD A;  4PFT A;  4FAT A;  4EXK A;  3IOV A;  5B70 A;  4H67 A;  3TTM A;  3OO7 A;  1IQ7 A;  3FVG A;  3GXA A;  3CSG A;  4U4X A;  2Z8D A;  3T96 B;  4U22 A;  1N76 A;  3K4U A;  4XIG Q;  2NVU B;  2ZMB A;  4AB6 A;  3TAJ A;  5H8S A;  3HV1 A;  5CMB A;  4ND9 A;  1MQD A;  4EQ9 A;  4KFQ A;  1H3D A;  5JEI A;  3A3C A;  3KJT A;  1B5I A;  3K6V A;  3MZB A;  1DOT A;  1ANF A;  1JEV A;  3EQ1 A;  4P0I A;  2O1L A;  4NF5 A;  1B32 A;  2F8D A;  4OER A;  5DT6 A;  4YMA A;  4OHN A;  2QS3 A;  5TU0 A;  2QS4 A;  1Y4T A;  2I3V A;  2ZYK A;  1MDP 1;  1SI0 A;  2G29 A;  3MWB A;  3OSQ A;  4EQ7 A;  5L9O A;  1A54 A;  1S50 A;  2RIN A;  3BBR A;  4QSC A;  4K3F A;  2IA4 A;  4I8C A;  3RN8 A;  2O84 X;  1QKB A;  2ONR A;  1A40 A;  1M5E A;  2Z8F A;  2RC7 A;  1XVY A;  4E0W A;  3SER A;  1LFH A;  1MH3 A;  4BLA A;  3MPL A;  1YAE A;  4GFR A;  1UTH B;  4NWD A;  3U72 A;  3MAM A;  4EF1 A;  4IO3 A;  3OEM A;  1UTB A;  4YAH X;  2I6E A;  3KFM A;  4WEP A;  5B7D A;  3MVZ A;  1B0L A;  1IXI A;  1GR2 A;  2PVU A;  1SBP A;  2YPN A;  3DP8 A;  3IO4 A;  1BLF A;  3KGC A;  3K00 A;  4R6Y A;  4U1O A;  5CM6 A;  1NNT A;  2DXY A;  5I58 A;  3T9H B;  2V3Q A;  3H6V A;  1FQF A;  1BIY A;  3MVY A;  1B40 A;  3W9W A;  1TWY A;  3K6X A;  3K0V A;  3TKD A;  3VLW A;  4EUO A;  4ISU A;  4F19 A;  1XVX A;  3GZG A;  4H5G A;  4R72 A;  2CMO A;  4FEB A;  5F7V A;  3WAF A;  3TUS A;  3FZV A;  4YB6 A;  2RCB A;  5F1Q A;  3RTF B;  5H8F B;  1IIT A;  2NXO A;  4G68 A;  5DTB A;  1EZO A;  3OO9 A;  4X1D A;  2YLN A;  4TLL B;  5I2K A;  4KYD A;  4QFK A;  1RYO A;  4GOT A;  1ZLQ A;  3IK6 B;  4YIC A;  1QKA A;  3CVG A;  1R9Q A;  1H43 A;  1SW4 A;  3B7D A;  1US5 A;  3Q26 A;  3UN6 A;  1P1U A;  3H6W A;  1MY1 A;  3OD7 A;  1NNF A;  3PMW A;  1RKM A;  3C32 A;  3I3V A;  1A7L A;  1OMP A;  2VP1 A;  3T9U A;  4RK9 A;  5M2V A;  3B6W A;  3U92 A;  1MY4 A;  3QIM A;  2F35 A;  1SYI A;  1POY 1;  1MXU A;  3VVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...