2RCBA

Crystal structure of the nr3b ligand binding core complex with d-serine at 1.62 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
282
structure length
282
Chain Sequence
RPKLRVVTLVEHPFVFTRESDEDGQCPAGQLCLDPGTNDSARLDALFAALVNGSVPRTLRRCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRGTELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate [NMDA] receptor subunit 3B
publication title Molecular mechanism of ligand recognition by NR3 subtype glutamate receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 96
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2rcbA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2rcbA02
1MY4A 1JVYA 1R1NA 2H4IA 3EHSA 1YAEA 3IO4A 4GD5A 1Y1ZA 3VE1B 5AA2A 4RXLA 4U1OA 5CMMA 1B4ZA 2DVCA 5TU0A 2F7CA 3S9LC 1D4NA 5EHMA 3G3KA 4JSOA 1JNFA 4JWOA 1P1QA 5KCJA 1MXYA 3OELA 3TQWA 5JTYB 3ONMA 1B3FA 3MBPA 2UYEA 1RYXA 1B7HA 4JWYA 3U92A 1N3WA 1NNKA 4E0XA 3RPWA 3KBRA 4AB6A 3CSGA 3CR9A 4R72A 1B4HA 3RNNA 3ODBA 4KYEA 2VOZA 2RCBA 5I56B 5DVJA 2WKYA 1AIVA 2FYIA 4OYVA 2A5TA 1JW1A 4IY6A 2PT2A 2VGQA 1VFDA 1LB8A 1OVBA 3VLWA 1DTZA 3S2VA 3DM0A 2O1LA 3P7IA 1MS7A 3IB0A 3RUMA 2HAVA 1D9VA 4G68C 4NF4A 4DXBA 2G29A 1B7ZA 3FXQA 1MY0A 3K1MA 3C9HA 4YAHX 3FASA 5H8FB 4BDMA 2H98A 5FHOA 3TTNA 1B51A 2DP8A 1GTKA 3HPIA 1Y20A 2XD2A 2DE4A 4YKJA 3T9UA 1Y4TA 1T0KA 4GVOA 4IO7A 3VVFA 3RTWB 2O7UA 5AA1A 2F78A 1A8EA 4NWCA 3OD7A 1IXGA 4JWXA 4I8CA 2RINA 1B0HA 4IGRA 4FAJA 2REJA 3PPPA 3CSBA 4IY5A 3PMXA 1MDQA 5DVIA 2B3FA 4MFIA 3Q27A 3SEXA 2QS1A 1H3DA 1MG1A 3O2AA 1B3LA 2I49A 4QFKA 2V93A 4LVQA 1SYIA 1IXCA 1II5A 1ZTYA 3IOVA 5CRYA 1PC3A 2I3WA 4G8MA 4YKPA 4RY1A 5F1QA 2DS9A 4OEUA 4YU0A 4F3GA 1PEBA 3G7WA 5H8HB 1A99A 3MVWA 4NEDA 4F31B 2UVHA 1URGA 3JYRA 3FXRA 3IB1A 3PPRA 4IO2A 2CMOA 3W9VA 3ZS6A 2XXTA 3HHFA 5DT6A 4NTLA 1UTHA 4DXUA 3IR1A 4G4PA 1WVJA 5BWJA 3LSXA 3TAJA 3FATA 3OEMA 1ZU0A 4G68B 1M5BA 1SD3A 3Q25A 4X1DA 3CG1A 2V3QA 3C36A 3MPKA 2ALUA 2Q2CA 5I2NA 4KPTA 4KQPA 5CI5A 5KZTA 3TEPA 3FJGA 4HW8A 4QFNA 3MJNA 3FJMA 2DWJA 1JW4A 4YB6A 1EU8A 3RTFB 2O84X 3O29A 4U1ZA 1KWHA 5F7VA 4ECFA 4P11A 3E9XA 4KR5A 5JEIA 2DE3A 1B0LA 2Z23A 3LSWA 1B05A 2DQVA 3T22A 2UXAA 4QFLA 2AL5A 4Q30B 1MQJA 1BTJA 1JEVA 2ONRA 1TT1A 1GR2A 1IZ1A 2QRYA 1FTJA 3ZSFA 5AA2D 1P1NA 1POY1 1S9TA 5B7DA 5ICTA 3G3HA 3H7MA 4H5GA 2RCAA 3VLUA 2QMWA 3IORA 2XXQA 2HAUA 1MQGA 1EH3A 3MVZA 2HFBA 1LLSA 1M5FA 1PB8A 3QIMA 4XXUA 2OBGA 3Q29A 3PU5A 3CFLA 5JK4A 2F8DA 3N6TA 1PB7A 4GIZA 3IK6B 3GXAA 4HCYA 5A5XA 3BKIB 2Z8EA 1JEUA 4X1BA 4XKRA 4GWOA 4ZEBA 3D4GA 4PQJA 4LQ5A 1BP5A 4KFQA 2XXRA 1I6QA 2I48A 2ONSA 3S4UA 2P2AA 3PGFA 2ABHA 4C0RA 1DPPA 3MVXA 4DXCA 1S50A 3K6XA 5CMKA 3MUQA 3K01A 2HQ0A 4FE8A 2P0SA 4F2OA 5ITPA 2I4CA 2HEUA 2ESNA 3UGWA 1POTA 4G2ZA 5H8NB 2Y7IA 2O51A 3MZBA 1IUDA 1FTKA 4QHQA 3KJ7A 5ICQA 1L5TA 3HV1A 3N5LA 5K2YA 3LSLA 4M1VA 1ATGA 3K1NA 3BFUA 5DVFA 4F18A 3MWBA 4DCYA 1S7YA 1XVYA 1MY3A 4NF6B 4TLMB 2DSFA 2DXRA 4F22A 1BKAA 2NOOA 2XHDA 2F35A 3FZVA 3LSFB 1P1WA 3ILUB 2AYSA 1O64A 4GL0A 1A54A 1MXVA 4H5FA 3N94A 2F7AA 5H8QA 4AB5A 4R6YA 5I2KA 3U94A 4LATA 4G8HA 4OENA 3K4UA 4FORA 3O6GA 4R2FA 1XHYA 1SW5A 4EXLA 3FV2A 3PPNA 1UIUA 2V84A 1N04A 1MY1A 1WDNA 3VDFA 4YZZA 4KHZE 3RT8A 1M5EA 2QMXA 3FVOA 1LCTA 1R9LA 3OO6A 4DZ1A 3KSXA 4KYDA 1EZPA 1IIWA 2DE2A 1GGGA 4H0WA 4KCCA 3IL1B 4JSDA 1MPBA 3SETA 3JV9A 4WXJA 4MBPA 4NF8A 3OOAA 5LOMA 4RA1A 4ZEKA 3I3VA 1MPCA 2ZXTA 2F7BA 3ZKKA 2ANJA 1B1HA 3MZ9A 2F6GA 4N07A 2QPQA 1B58A 1ZLQA 2O69A 3C35A 4FATA 2NUVA 1SBPA 4YMAA 3OO7A 2XXWA 2RF1A 3AXFA 5CMCA 2H9BA 4Q8RA 4Q5TA 3PPQA 1LFGA 2CZLA 3LBSA 1BLFA 4ZEIA 4MLQA 1F9BA 5I59B 3K1PA 3PMWA 3PPOA 2QS4A 4ZDMA 5H8SA 3H3GA 4QSDA 1QJMA 1H44A 1LCFA 3L6HA 3V8XB 2UYFA 1N0TA 4QFOA 3TTRA 4ELPA 2P1SA 4DE8A 4IO3A 4O3BA 2GHBA 4GQOA 1NFTA 3CVGA 4GRKA 4ZS9A 4OMBA 1QKBA 5TPAB 4RYAA 4LA9A 2O1MA 3O9PA 2H99A 1B3EA 2PVUA 3CIJA 1R6ZA 1IEJA 4MF3A 3T9XB 2ZNSA 2UVIA 3EHUA 3SERA 4M4GA 2OLBA 2VHAA 1LFHA 1AMFA 4EDPA 4RK9A 4OTEA 1SI1A 1TFDA 5AA4B 3G3JA 3BFTA 3CRBA 3WAFA 3TFLA 2PMSA 5L9MA 3A3CA 4LZ8A 2B65A 1MXUA 3EHTA 5L8DA 1OLCA 3K6VA 4X48A 3PMVA 4OZ9A 2ZMBA 2DVZA 3O6HA 3I5OA 3IB2A 1N84A 3KG2A 2THIA 2DXYA 4H8JA 1O7TA 3K6WA 1SVXB 4PETA 4NF5A 1MQIA 3FUZA 2QS3A 4HS7A 4F2QA 3KN7A 4YKKA 2A5SA 5I58A 1LBBA 1FQCA 4G77A 1UTBB 4AQ4A 1I6AA 3LUYA 1QULA 1B5JA 1Y3NA 3R6UA 4U4XA 1LB9A 1J1NA 4ELRA 3MQ9A 3EPEA 1MH4A 5DEXB 4PFUA 1SW4A 3KZGA 4FEDA 4RJZA 2Q88A 4F1VA 3E3KA 4THIA 2VP1A 2X7QA 4ZE9A 3M8UA 1NNPA 5I57B 4KYSA 3S9NC 1ZKBA 1P1OA 5KDTA 3B6TA 4BLAA 1SQYA 1VFEA 4FECA 4KCDA 5AA2B 3SKPA 1PDAA 4XKQA 1MY2A 4WEPA 1N76A 3KJTA 1US4A 3U8QA 3HCQA 3A3UA 1H76A 3SESA 3HHGA 2V3UA 4QSCA 2F34A 4R2BA 2ZNUA 3B6QA 2QS2A 3V5AA 1MXWA 5KCJB 5L9SA 3V89B 3MW0A 1JETA 4TLLB 1P1UA 3UP9A 3EQ1A 4EF2A 1HSLA 3FJ7A 5TP9A 4BDLA 2YPNA 1USYE 1NMUA 1CE2A 3IJOB 2QL3A 4ZECA 3WAEA 3MZ1A 3UIFA 4YB7A 3KFMA 1TXFA 3THIA 1NL5A 1H45A 3HSTA 2R9JA 2VD3A 3KEIA 4Z7EA 3H6UA 2A5TB 3K02A 3K2DA 2NXOA 4BDOA 4DIGA 1Q35A 5HM4B 3IAZA 4R75A 4NF4B 4PFTA 3MC2A 1IITA 3SDFA 4C1TA 4I1DA 3TYHA 3HN0A 5M2VA 2XXUA 3GBAA 1Z7ME 4IO5A 2XX8A 1AH5A 4EQBA 4R6KA 1XC1A 4XIGQ 5JTYA 3G3FA 3IO6A 2M8CA 2B3BA 4R9GA 1ZIUA 4OFLA 4UACA 3QUFA 1MDP1 4XKPA 3KN3A 1BIYA 2XD3A 3MP6A 2RC8A 4HTGA 2V3TA 5B70A 3VV5A 3PUVE 2D5WA 5I56A 4H6DA 2GFEA 1AOVA 3RQTA 4ND9A 4U21A 4UA8A 3IX1A 3USDA 2OJTA 1JVXA 4GOTA 1CB6A 2DYXA 5EHSA 2IEEA 1MM7A 2FA7A 2I4BA 4E0WA 4ZZEA 1XS5A 3L6GA 4R73A 2PT1A 3I6VA 4PFWA 1B32A 1A40A 3IOTA 3PUZE 3M3FA 2XXYA 4EF1A 5H8FA 1Y3QA 1Y1MA 3OMBA 3TCFA 4TQUQ 1JQFA 3OO9A 1SI0A 3G3IA 3U93A 1MQHA 4C1UA 2Q8JA 5IKBA 4ZEFA 3EF7A 4JXIA 3O66A 1UQWA 1TWYA 1XVXA 3D4CA 4MH5A 3VLVA 5IAIA 1FQFA 3KGCA 3T9VA 3RY3A 5CC2A 1VE4A 3MAMA 2IA4A 4R9FA 1B52A 3QXMA 4BDRA 2O6AA 2REGA 4U4SA 2HXWA 1Q1KA 3BBRA 3GLBA 2OK2A 2ONKE 2AIXA 3FXUA 1B5IA 3IOWA 1NH7A 2XX7A 1RKMA 4H67A 2HZLA 2Z8DA 2XX9A 5CMBA 5EYFA 5K2XA 1D3KA 4JB7A 4R6HA 3O28A 3C4MA 5I2NB 4PE5B 4P0GA 3MP8A 1DSNA 5DYHA 1H43A 1N3XA 3PUWE 3H03A 1QUIA 5HBCA 3OEKA 3LR1A 3C31A 1ELJA 3EN3A 1FCKA 4QRZA 3H6VA 3E4RA 3KN8A 1MPDA 4YICA 4OERA 2Y7WA 4K3FA 5H8HA 2Y7KA 3TTKA 4QF9A 3SEUA 1OQGA 2DOJA 2I0BA 1MQDA 3FVKA 1IXHA 4GFRA 3C32A 3T96B 4LUBA 5FHNA 2PX1A 3LC8A 3M3LA 4OFJA 4FEBA 1A8FA 4LZ5A 3H06B 3PUYE 3RLFE 4U22A 2YLNA 2XXPA 3QUJA 3F11A 4KD5A 4G68A 3ECRA 2D21A 4L17A 4ISUA 3H4ZA 3ILTB 2KLFA 1QUKA 2GH9A 3SEWA 5FTIA 3TTMA 2X26A 1NKXA 4X9TA 4F19A 5L9OA 1OQHA 5A5XB 4F3PA 2VD2A 4O3CA 3UK4A 2NWJA 1B7UA 3ZKLA 1FQEA 2NVUB 3KSJA 1B2HA 1LAXA 2F5XA 3TELA 3T9HB 1IXIA 4F39A 1IQ7A 2GHAA 2RKMA 3K0VA 1URDA 2XXHA 1LSTA 3OSRA 3KOTA 4YKIA 2HZKA 4MLVA 3QK6A 1QKAA 2I3VA 2ZYKA 1B9JA 4U23A 3PD8A 1NNFA 2OWTA 3GZGA 2QJEA 1B6HA 4U2RA 4WKMA 4P0IA 2BJJX 3DP8A 1B46A 1JW5A 4H65A 3CFXA 1FQAA 3HO7A 2E1SA 2XXIA 1B40A 4Q0CA 1PBQA 4OWDA 1US5A 4PP0A 5CM6A 4JDFA 1ANFA 2GRVA 2F6PA 4POWA 3C34A 3UORA 4F3BA 1OIBA 1LAGE 1EZOA 4KI0E 1P99A 4I62A 1B5HA 5ELVA 1URSA 2RC7A 3RT6B 4ESWA 1LGBC 2OCUA 4RPNA 3TZAA 2OZZA 5H8QB 4GF8A 4FJPA 5I2KB 1DMBA 2I6EA 4OFOA 1UIVA 4GXAA 2LAOA 1M5CA 3OSQA 2E0SA 3FV1A 3TQLA 3JZJA 3H6TA 5H8NA 2R71A 3A09A 4EQ9A 1Z7NE 1DPEA 4WEDA 3VXBA 5AA3A 1MRPA 4GXSB 3W9WA 4DCXA 2H5YA 3PV0E 1PB9A 3Q28A 4H8IA 4GLIA 4N13A 2HCAA 3TMGA 2W7YA 2DWIA 3TUSA 3VFJA 1XT8A 3OENA 4IO6A 4F1YA 2D3IA 4NF8B 1HSJA 3FVGA 4OQOA 4EQ7A 2YJPA 4ELOA 4LQ2A 3U72A 4OHNA 4NF6A 4XTCQ 4IGTA 3RGYA 1LAFE 2QSXA 2O7IA 3VVEA 2DWAA 3IOUA 3KOSA 4BDQA 3TTLA 4NE4A 1ZJLA 2F36A 3H6WA 4I9DA 1QUJA 1HSEA 1SDXA 3IJXB 1Y9UA 3S9EA 2AL4A 5DTBA 4F1UA 3B6WA 2X7PA 3MP1A 3FGSA 1YCJA 3O6IA 4GL8A 5CBRA 3T93B 4QFPA 4G8NA 2Z8FA 2F97A 4JBZA 4XKNA 1LFIA 3QAXA 3DLNA 3DELB 4RPOA 1RYOA 4PFYA 4ZZAA 2PYYA 4TOZA 1YTVA 2Y84A 1N7WA 1XOCA 3E13X 4OETA 1NH8A 2O68A 4OXVA 3T66A 2I58A 2FNCA 1FTLA 4ZE8A 3DP4A 1QVSA 3Q26A 1D9YA 1AL3A 1OVTA 3FVNA 5ITOA 4ZEDA 4QSEA 3U1OA 4NMYA 2G93A 1USYH 3N26A 4H1XA 4EUOA 1LAHE 1MM6A 1QW0A 4RNSA 2ZYOA 4ESXA 3TPAA 3W15C 3M3KA 5I59A 4BDNA 1B1XA 5BUUA 1SW2A 3R26A 4ONYA 4Z0IA 2Q9TA 4ELQA 3TKDA 4R74A 3B7DA 1MXZA 2I0CA 4YB5A 1NNTA 3QYTA 1TFAA 4EXKA 2UVJA 1OLAA 4POXA 2H25A 5AE4A 2Q2AA 1A7LA 5I84A 2XXVA 3FIRA 1SYHA 1WODA 2Q89A 4DDDA 4NWDA 1MH3A 4F3SA 3MVYA 4NF5B 4F29A 3CFZA 5TPAA 3V83A 3PD9A 5I58B 2R6GE 1LBCA 2RC9A 3G3GA 1Y3PA 3K00A 4LONB 1YPNA 2Y7PA 3SEYA 1GVCA 4HCWA 3VVDA 1DTGA 3CG3A 3QSLA 2UVGA 3R7XA 4FIMA 2Y7RA 2Z22A 3MPLA 2XXXA 3DP6A 2DWHA 5AA4A 2V25A 3K6UA 3N6UA 1FQDA 5KDTB 1M5DA 3TCGA 3TCHA 5FTHA 1UTHB 1I69A 1PBPA 1N7XA 1ZMGA 4IO4A 1FW0A 3FD3A 5CBSA 3O97A 3UA8A 3SEVA 2ZYMA 5J1DA 3CI8A 1FQBA 1B3GA 4IB2A 1EZ9A 3C33A 1VR5A 4N6PA 5ISUA 1O63A 2ZYNA 1SW1A 1A55A 5FHMA 4OVJA 4DLDA 3OO8A 4OEVA 1Y4CA 5TP9B 1UTBA 4O3AA 4LZ7A 2OWSA 1GV8A 3PUXE 3S9MC 3TDJA 5DEXA 5HPQA 2PBWA 4LP2B 1ZBMA 1I6BA 1FTMA 3OXNA 1MXXA 1OMPA 2ZNTA 1B3HA 3UN6A 1VSOA 1DOTA 1R9QA 4OESA 3VXCA 4YMBA 5I57A 3GBBA 4RK2A 3TODA 1FTOA 3RN8A
chains in the Genus database with same CATH superfamily
1MY4A 1JVYA 1R1NA 2H4IA 3EHSA 1YAEA 4GWWA 3IO4A 4GD5A 5F24A 3A29A 1Y1ZA 3VE1B 5AA2A 4RXLA 4U1OA 4P56A 5CMMA 1B4ZA 2DVCA 5TU0A 2F7CA 3S9LC 1FPDA 1D4NA 5EHMA 3G3KA 1FPGA 4JSOA 2V4CA 1JNFA 4JWOA 1P1QA 5KCJA 1MXYA 3OELA 3TQWA 5JTYB 3ONMA 1B3FA 3MBPA 2P3NA 2UYEA 1RYXA 5IZZA 1B7HA 4JWYA 3U92A 1N3WA 1NNKA 4E0XA 2XXKA 3RPWA 3KBRA 4AB6A 2MKZA 3CSGA 3CR9A 4R72A 1B4HA 3RNNA 3ODBA 4KYEA 2VOZA 2RCBA 5I56B 5DVJA 2WKYA 1AIVA 2FYIA 2WYPA 4OYVA 2A5TA 1JW1A 1LBZA 3E78A 4IY6A 4NN3A 2PT2A 2VGQA 1VFDA 1LB8A 3E79A 1OVBA 3VLWA 1DTZA 3S2VA 3SZPA 3DM0A 2O1LA 3P7IA 1MS7A 3IB0A 3RUMA 2HAVA 1D9VA 4G68C 4NF4A 4DXBA 2G29A 1B7ZA 3FXQA 1MY0A 3K1MA 3C9HA 4YAHX 1LEVA 3FASA 1D9QA 4P9KA 5H8FB 4BDMA 2H98A 5FHOA 3TTNA 1B51A 2DP8A 1GTKA 3HPIA 3NOHA 1Y20A 2XD2A 2DE4A 4YKJA 3T9UA 1K9YA 1Y4TA 1T0KA 4GVOA 4IO7A 3VVFA 3RTWB 2O7UA 5AA1A 2F78A 1A8EA 4NWCA 3OD7A 1IXGA 4JWXA 4I8CA 4XFEA 2RINA 1B0HA 4IGRA 4FAJA 2REJA 3PPPA 3CSBA 4IY5A 3QMFA 3PMXA 1FBGA 1MDQA 5DVIA 2B3FA 4MFIA 3Q27A 4N6KA 3SEXA 2QS1A 1H3DA 4GWZA 4AS5A 1MG1A 3O2AA 1B3LA 2I49A 4QFKA 2V93A 4GBVA 4LVQA 1SYIA 1IXCA 1II5A 1ZTYA 3IOVA 5CRYA 1PC3A 2I3WA 4G8MA 4YKPA 4RY1A 2XWKA 5F1QA 2DS9A 4OEUA 3IFAA 4YU0A 4OVRA 4F3GA 1PEBA 3G7WA 5H8HB 1A99A 3MVWA 4NEDA 4F31B 2UVHA 1URGA 3JYRA 3FXRA 1FBFA 3IB1A 3PPRA 4IO2A 2CMOA 3B8BA 3W9VA 3ZS6A 2XXTA 3HHFA 5DT6A 4NTLA 1UTHA 4DXUA 3IR1A 4G4PA 1WVJA 5BWJA 3LSXA 1IMFA 3TAJA 2WBDA 3FATA 3OEMA 1ZU0A 3RPLA 1NV1A 4G68B 4IR8A 1M5BA 1SD3A 3Q25A 4X1DA 3CG1A 2V3QA 3C36A 3MPKA 1NV5A 2ALUA 2Q2CA 5I2NA 5LTCA 4KPTA 4KQPA 5CI5A 5KZTA 3TEPA 3FJGA 1DBZA 5A5LA 4HW8A 4QFNA 1FJ6A 3MJNA 3FJMA 2DWJA 1JW4A 4YB6A 1EU8A 3RTFB 2O84X 3O29A 4U1ZA 1KWHA 5F7VA 4ECFA 4P11A 3E9XA 4KR5A 5JEIA 2DE3A 1B0LA 3LSWA 2Z23A 1B05A 2DQVA 3T22A 4MAGA 2UXAA 4QFLA 2AL5A 4Q30B 1MQJA 1BTJA 1JEVA 4HXVA 2ONRA 1TT1A 1GR2A 1IZ1A 5I5PA 2QRYA 1FTJA 3ZSFA 5AA2D 1P1NA 1POY1 1S9TA 5B7DA 5ICTA 1NV4A 3G3HA 4MNPA 3H7MA 4H5GA 1NV3A 2RCAA 3VLUA 2QMWA 3IORA 2XXQA 2HAUA 1MQGA 1EH3A 3MVZA 2HFBA 1LLSA 1M5FA 1PB8A 3QIMA 4XXUA 2OBGA 1INPA 3Q29A 3PU5A 2FIXA 5T3JA 4GX6A 3CFLA 5JK4A 1DCUA 2F8DA 3N6TA 1PB7A 4GIZA 3IK6B 3GXAA 4HCYA 5A5XA 3PTYA 3BKIB 2Z8EA 1JEUA 1NI9A 4X1BA 4XKRA 3B50A 4GWOA 4KXPA 1EYKA 4ZEBA 3D4GA 4PQJA 1FSAA 1FJ9A 4LQ5A 1G0IA 1BP5A 4KFQA 2XXRA 1I6QA 2I48A 2ONSA 1NV0A 3S4UA 2P2AA 3PGFA 2DDKA 2ABHA 4C0RA 1DPPA 3MVXA 4DXCA 1S50A 1FPFA 3K6XA 5CMKA 3MUQA 3K01A 2HQ0A 4FE8A 2P0SA 4MMPA 4F2OA 4GWSA 5ITPA 2I4CA 2HEUA 2ESNA 3UGWA 1POTA 4G2ZA 5H8NB 2Y7IA 4HE1A 1G0HA 2O51A 3MZBA 1YZ0A 1IUDA 1FTKA 4QHQA 3KJ7A 5ICQA 2QFLA 1L5TA 3HV1A 5IZ3B 3N5LA 5K2YA 3LSLA 4N6DA 5ESYA 4M1VA 1ATGA 5IGAA 3K1NA 2Y5LA 3BFUA 5DVFA 4F18A 3MWBA 4DCYA 1S7YA 1XVYA 1MY3A 4NF6B 4TLMB 2DSFA 2DXRA 4F22A 1BKAA 2NOOA 2XHDA 2F35A 3FZVA 1FBEA 3LSFB 1P1WA 3FBPA 3ILUB 2AYSA 1O64A 4GL0A 1A54A 1MXVA 4H5FA 3N94A 2F7AA 5H8QA 4AB5A 4R6YA 5I2KA 3U94A 4LATA 4G8HA 3KC0A 4OENA 3K4UA 4FORA 4P1LA 3O6GA 4R2FA 3MYUA 4QXDA 1XHYA 5J16A 1SW5A 4PTKA 4EXLA 1DK4A 3FV2A 3PPNA 2VPOA 1UIUA 2V84A 4O7MA 1N04A 1MY1A 2PCRA 1WDNA 3VDFA 4YZZA 4KHZE 3RT8A 1M5EA 2QMXA 3FVOA 1LCTA 1R9LA 3OO6A 4DZ1A 3KSXA 4KYDA 1EZPA 1IIWA 2DE2A 1GGGA 4H0WA 4KCCA 3IL1B 3RYDA 4JSDA 1MPBA 4GWUA 3SETA 3JV9A 4WXJA 4MBPA 1FTAA 4NF8A 3OOAA 5LOMA 4RA1A 4ZEKA 2QVVA 3I3VA 1MPCA 1IMEA 1K9ZA 2ZXTA 2F7BA 1IMBA 3ZKKA 2ANJA 1B1HA 3MZ9A 2F6GA 4N07A 2QPQA 1B58A 1ZLQA 2O69A 3C35A 3ISPA 4FATA 2NUVA 1SBPA 4YMAA 3OO7A 2XXWA 2RF1A 3AXFA 5CMCA 2H9BA 4Q8RA 4Q5TA 3PPQA 1LFGA 2CZLA 3LBSA 1BK4A 1BLFA 4ZEIA 4N8GA 4MLQA 5IM2A 1F9BA 5I59B 2XWIA 3K1PA 3PMWA 3PPOA 4NX1A 2QS4A 4ZDMA 5H8SA 3H3GA 4QSDA 1QJMA 1H44A 1LCFA 1FBDA 2XWOA 3L6HA 3V8XB 2UYFA 1N0TA 4QFOA 3TTRA 4ELPA 2P1SA 4P8BA 4DE8A 3KC1A 4IO3A 4O3BA 2GHBA 4GQOA 1NFTA 5ET8A 2KQZA 3CVGA 2FVZA 4GRKA 4I3EA 4ZS9A 4OMBA 2R8TA 1QKBA 2JJKA 5TPAB 4RYAA 4LA9A 2O1MA 3O9PA 2H99A 4H45A 1B3EA 2GQ1A 2PVUA 3CIJA 1R6ZA 1IEJA 2HXRA 4MF3A 3T9XB 2ZNSA 2UVIA 3EHUA 4I40A 3SERA 4M4GA 4MNCA 2OLBA 2VHAA 1LFHA 1AMFA 4EDPA 4RK9A 4OTEA 1SI1A 1TFDA 5AA4B 3G3JA 3BFTA 4FBPA 3CRBA 3WAFA 3TFLA 4NG7A 2PMSA 5L9MA 3A3CA 4LZ8A 2B65A 1MXUA 3EHTA 5L8DA 2VPNA 1OLCA 3K6VA 4OANA 4X48A 3PMVA 4OZ9A 1NV2A 2ZMBA 2DVZA 3O6HA 3I5OA 3IB2A 1N84A 3KG2A 1RDXA 2THIA 2DXYA 4H8JA 1O7TA 3K6WA 1SVXB 4PETA 4NF5A 1MQIA 3FUZA 2QS3A 4HS7A 4F2QA 3KN7A 4PF6A 4YKKA 2A5SA 5I58A 1LBBA 1FQCA 4G77A 1UTBB 4AQ4A 1I6AA 3LUYA 5EQ9A 1QULA 1B5JA 1Y3NA 3R6UA 2CZKA 4U4XA 1LB9A 1J1NA 4ELRA 4PDHA 3MQ9A 3EPEA 1MH4A 5DEXB 4PFUA 1SW4A 3KZGA 4FEDA 4OVQA 4RJZA 2Q88A 4F1VA 3E3KA 4THIA 1YYZA 5IZ3A 2VP1A 2X7QA 4ZE9A 3M8UA 1NNPA 5I57B 4KYSA 3S9NC 1ZKBA 1P1OA 5KDTA 3B6TA 4BLAA 1IMDA 1SQYA 5ET6A 1VFEA 4FECA 4PBHA 4KCDA 5AA2B 3SKPA 1PDAA 1EYIA 4XKQA 1MY2A 2F3BA 4WEPA 1N76A 3KJTA 1US4A 4NF0A 3U8QA 3HCQA 3A3UA 1H76A 3SESA 3HHGA 2V3UA 4QSCA 2F34A 4R2BA 2ZNUA 3B6QA 2QS2A 3V5AA 1MXWA 5EQ7A 5KCJB 5L9SA 3V89B 4GBWA 1LBXA 3MW0A 5EQ8A 2ZZWA 1JETA 3LUZA 4TLLB 1P1UA 3UP9A 3EQ1A 4EF2A 4MHFA 1HSLA 3FJ7A 4GWYA 5TP9A 4BDLA 2YPNA 1USYE 1NMUA 1CE2A 3IJOB 4NGUA 2QL3A 4JVCA 4ZECA 3WAEA 3MZ1A 3UIFA 4YB7A 2KR0A 4JVDA 3KFMA 1TXFA 1FPIA 3THIA 1NL5A 1H45A 3HSTA 2R9JA 2VD3A 3KEIA 4Z7EA 3H6UA 2A5TB 3K02A 3K2DA 2NXOA 2PFZA 4BDOA 4DIGA 1Q35A 5HM4B 3IAZA 4R75A 4GX4A 4NF4B 4PFTA 3MC2A 1IITA 4N8YA 3SDFA 4C1TA 4I1DA 3TYHA 3HN0A 5M2VA 2XXUA 3GBAA 1Z7ME 4IO5A 2XX8A 1AH5A 2FIEA 4EQBA 4R6KA 1XC1A 4PGNA 4XIGQ 5JTYA 3G3FA 3IO6A 2M8CA 4PDDA 2B3BA 4R9GA 1ZIUA 4OFLA 4UACA 3QUFA 4PFIA 1MDP1 4XKPA 3KN3A 1BIYA 2XD3A 3MP6A 3BIHA 2RC8A 4HTGA 2V3TA 5B70A 3VV5A 3PUVE 2D5WA 5I56A 4H6DA 2GFEA 1AOVA 3RQTA 4ND9A 3GYYA 4U21A 4UA8A 3IX1A 3USDA 4UABA 2OJTA 1JVXA 4GOTA 1CB6A 2DYXA 4HE2A 5EHSA 2IEEA 1MM7A 2FA7A 2I4BA 2L5VA 4E0WA 4ZZEA 1NUYA 1IMCA 1XS5A 3L6GA 4R73A 2PT1A 3I6VA 4PFWA 1B32A 1A40A 3IOTA 3PUZE 3M3FA 2ZZVA 2XXYA 4EF1A 1Q9DA 5H8FA 1Y3QA 1Y1MA 3OMBA 3TCFA 4TQUQ 1JQFA 3OO9A 1SI0A 3G3IA 3U93A 1MQHA 1NUXA 4C1UA 2Q8JA 5IKBA 2CEXA 4ZEFA 3EF7A 4JXIA 3O66A 4MCOA 1UQWA 4MNIA 1TWYA 1XVXA 3D4CA 4G61A 4MH5A 3VLVA 5IAIA 1FQFA 3KGCA 3D1RA 3T9VA 4PF8A 3RY3A 5CC2A 1VE4A 3MAMA 2IA4A 4R9FA 1B52A 3QXMA 4BDRA 2O6AA 2REGA 2CZIA 4U4SA 2HXWA 1Q1KA 3BBRA 3GLBA 2OK2A 2ONKE 2AIXA 3FXUA 5EYHA 1B5IA 3IOWA 3RPLB 1NH7A 2XX7A 1RKMA 4H67A 2HZLA 2Z8DA 2XX9A 5CMBA 1YXIA 2FHYA 5EYFA 2HPGA 5K2XA 5LDZA 1D3KA 4JB7A 4NAPA 4R6HA 4PFRA 3O28A 3C4MA 4MJOA 5I2NB 4PE5B 4P0GA 3MP8A 2OX3A 1DSNA 5DYHA 1H43A 1N3XA 3PUWE 3H03A 1JP4A 1QUIA 2F3DA 5HBCA 3OEKA 3LR1A 1CNQA 4AS4A 3C31A 2OWZA 1ELJA 3EN3A 1FCKA 4QRZA 3H6VA 3E4RA 3KN8A 1MPDA 4YICA 4OERA 2Y7WA 4K3FA 5H8HA 2Y7KA 3TTKA 4QF9A 3SEUA 1OQGA 2DOJA 2I0BA 2WYKA 1MQDA 3FVKA 1IXHA 4GFRA 3C32A 3T96B 4OVTA 4LUBA 5FHNA 2PX1A 3LC8A 3M3LA 1NUWA 4O7IA 4OFJA 4FEBA 1FBHA 1A8FA 4LZ5A 3H06B 3PUYE 3RLFE 2PFYA 4P3LA 4U22A 2YLNA 2XXPA 3QUJA 4XEQA 3F11A 4KD5A 4G68A 3ECRA 1FBCA 2D21A 4L17A 4ISUA 3H4ZA 3ILTB 2KLFA 1QUKA 2GH9A 3SEWA 4GX3A 5FTIA 3TTMA 2X26A 1NKXA 4X9TA 4F19A 5L9OA 1OQHA 5A5XB 4F3PA 2VD2A 4O3CA 3UK4A 3BIGA 2CEYA 2NWJA 1B7UA 1FQEA 3ZKLA 2QVRA 4NHBA 4P1EA 2NVUB 3KSJA 1B2HA 1LAXA 2F5XA 5ET5A 3TELA 3T9HB 1IXIA 4F39A 1IQ7A 2GHAA 4MIJA 3U65A 2RKMA 3K0VA 1URDA 1KZ8A 2XXHA 4I3YA 1FPBA 1LSTA 3OSRA 2Q74A 3KOTA 4YKIA 2HZKA 4MLVA 3QK6A 1QKAA 2WBBA 2I3VA 2ZYKA 1B9JA 4U23A 3PD8A 4OVPA 1NNFA 2OWTA 3GZGA 2QJEA 4PC9A 1B6HA 4U2RA 4WKMA 4P0IA 2BJJX 3DP8A 1B46A 1JW5A 4H65A 3CFXA 1FQAA 3HO7A 2E1SA 2XXIA 1B40A 2Q8MA 4Q0CA 1PBQA 4OWDA 1US5A 4PP0A 5IZ1A 5CM6A 4JDFA 1RDYA 1ANFA 2GRVA 4POWA 2F6PA 2FBPA 3C34A 3UORA 4F3BA 1OIBA 1LAGE 1EZOA 4KI0E 4N15A 1P99A 1NV6A 4I62A 1B5HA 5ELVA 1URSA 2P3VA 4QBAA 4X8RA 2RC7A 3RT6B 4ESWA 1LGBC 2OCUA 4RPNA 3TZAA 2VT5A 2OZZA 3T0JA 5H8QB 4GF8A 5I3SA 4FJPA 5I2KB 1DMBA 4N91A 2I6EA 4OFOA 1UIVA 3CHGA 4GXAA 2LAOA 1M5CA 3OSQA 2E0SA 3FV1A 3TQLA 3JZJA 3H6TA 5H8NA 2R71A 3A09A 4EQ9A 1Z7NE 1DPEA 4WEDA 3VXBA 5AA3A 1MRPA 4GXSB 3W9WA 4DCXA 2H5YA 3PV0E 1PB9A 3Q28A 4H8IA 4GLIA 4N13A 2HCAA 3TMGA 2W7YA 2DWIA 3TUSA 3VFJA 1XT8A 3OENA 4IO6A 1VDWA 4F1YA 2D3IA 1FPKA 4NF8B 1RDZA 1HSJA 3FVGA 4OQOA 4EQ7A 3EKIA 2YJPA 4ELOA 4LQ2A 3U72A 5DW8A 4OHNA 4NF6A 4XTCQ 4IGTA 3RGYA 1FPLA 1LAFE 2QSXA 5I7IA 2O7IA 3VVEA 2DWAA 1SPIA 3IOUA 1KA0A 3KOSA 4BDQA 3TTLA 4NE4A 1LBWA 1ZJLA 4PBQA 2F36A 3H6WA 4I9DA 4DI3D 1QUJA 1HSEA 1SDXA 3IJXB 4PE3A 1Y9UA 3S9EA 2AL4A 4P47A 5DTBA 4F1UA 3B6WA 2X7PA 2CZHA 3MP1A 2HHMA 3FGSA 1YCJA 3O6IA 4GL8A 5CBRA 4PAFA 3T93B 4QFPA 1FBPA 4G8NA 2Z8FA 2F97A 4JBZA 4XKNA 1LFIA 3QAXA 3DLNA 4XF5A 3DELB 4RPOA 1RYOA 4PFYA 4ZZAA 2PYYA 4TOZA 1YTVA 2Y84A 1N7WA 1XOCA 3E13X 4OETA 1NH8A 2O68A 4OXVA 3T66A 1NUZA 4MX6A 2I58A 2FNCA 4JVIA 4LN5A 1FTLA 4ZE8A 3DP4A 1QVSA 3Q26A 1D9YA 1AL3A 1QGXA 1OVTA 4O94A 3FVNA 5ITOA 4ZEDA 4GWXA 4QSEA 3U1OA 4NMYA 2G93A 1FPJA 1USYH 3N26A 4H1XA 4EUOA 1LAHE 1MM6A 1QW0A 4RNSA 2QVUA 2ZYOA 4ESXA 3TPAA 3W15C 4OVSA 3M3KA 2BJIA 5I59A 4BDNA 2B4LA 1B1XA 5BUUA 1SW2A 3R26A 4ONYA 4Z0IA 2Q9TA 4ELQA 3TKDA 4R74A 3B7DA 1MXZA 2I0CA 4YB5A 1NNTA 3QYTA 1TFAA 3MSTA 4EXKA 4DI4B 2UVJA 3IFCA 1OLAA 4POXA 2H25A 5AE4A 1FRPA 2Q2AA 1A7LA 5I84A 1EYJA 2XXVA 3FIRA 1SYHA 4N81A 4PFBA 1WODA 2Q89A 4DDDA 4NWDA 1MH3A 4F3SA 3MVYA 4NF5B 4F29A 4PAIA 3CFZA 5TPAA 3V83A 3PD9A 5I58B 1LBVA 2R6GE 1LBCA 4X04A 1KA1A 2RC9A 3G3GA 1Y3PA 3K00A 4LONB 4PAKA 1YPNA 2Y7PA 3SEYA 1GVCA 4HCWA 3VVDA 1DTGA 3CG3A 2ZZXA 3QSLA 2UVGA 4H46A 5ET7A 3R7XA 4FIMA 2XWVA 2Y7RA 1NV7A 1IMAA 2Z22A 3MPLA 2XXXA 3DP6A 3KBZA 2DWHA 5AA4A 1XI6A 3LV0A 2V25A 3K6UA 3N6UA 1FQDA 5KDTB 1M5DA 4HE0A 3TCGA 3TCHA 5FTHA 1UTHB 1I69A 1PBPA 1N7XA 1ZMGA 4IO4A 1FW0A 3FD3A 5CBSA 3O97A 3UA8A 2B4MA 3SEVA 2ZYMA 5J1DA 3CI8A 1FQBA 4N4UA 1B3GA 4IB2A 2WX9A 3HFUA 1EZ9A 3C33A 4PGPA 1VR5A 3T1BA 4PCDA 4N6PA 5ISUA 1O63A 2XA5A 4O8MA 2ZYNA 1SW1A 1A55A 5FHMA 3ROJA 4OVJA 4DLDA 3OO8A 4OEVA 1Y4CA 5TP9B 1UTBA 4O3AA 4LZ7A 5FBPA 2OWSA 1GV8A 3PUXE 1FPEA 3S9MC 3TDJA 1LBYA 5DEXA 5HPQA 2PBWA 4LP2B 1ZBMA 1I6BA 4OA4A 5EQAA 2Y5KA 5EYGA 1FTMA 3OXNA 4N17A 1MXXA 1OMPA 2ZNTA 3FXBA 1AWBA 1B3HA 3UN6A 1VSOA 1DOTA 2WEFA 1R9QA 4OESA 3VXCA 4YMBA 5I57A 3GBBA 4RK2A 3TODA 1FTOA 3RN8A 4NQ8A 4MEVA
chains in the Genus database with same CATH topology
1MY4A 1JVYA 1R1NA 2H4IA 3EHSA 1YAEA 3IO4A 4GD5A 1Y1ZA 3VE1B 5AA2A 4RXLA 4U1OA 5CMMA 1B4ZA 2DVCA 5TU0A 2F7CA 3S9LC 1D4NA 5EHMA 3G3KA 4JSOA 1JNFA 4JWOA 1P1QA 5KCJA 1MXYA 3OELA 3TQWA 5JTYB 3ONMA 1B3FA 3MBPA 2UYEA 1RYXA 1B7HA 4JWYA 3U92A 1N3WA 1NNKA 4E0XA 3RPWA 3KBRA 4AB6A 3CSGA 3CR9A 4R72A 1B4HA 3RNNA 3ODBA 4KYEA 2VOZA 2RCBA 5I56B 5DVJA 2WKYA 1AIVA 2FYIA 4OYVA 2A5TA 1JW1A 4IY6A 2PT2A 2VGQA 1VFDA 1LB8A 1OVBA 3VLWA 1DTZA 3S2VA 3DM0A 2O1LA 3P7IA 1MS7A 3IB0A 3RUMA 2HAVA 1D9VA 4G68C 4NF4A 4DXBA 2G29A 1B7ZA 3FXQA 1MY0A 3K1MA 3C9HA 4YAHX 3FASA 5H8FB 4BDMA 2H98A 5FHOA 3TTNA 1B51A 2DP8A 1GTKA 3HPIA 1Y20A 2XD2A 2DE4A 4YKJA 3T9UA 1Y4TA 1T0KA 4GVOA 4IO7A 3VVFA 3RTWB 2O7UA 5AA1A 2F78A 1A8EA 4NWCA 3OD7A 1IXGA 4JWXA 4I8CA 2RINA 1B0HA 4IGRA 4FAJA 2REJA 3PPPA 3CSBA 4IY5A 3PMXA 1MDQA 5DVIA 2B3FA 4MFIA 3Q27A 3SEXA 2QS1A 1H3DA 1MG1A 3O2AA 1B3LA 2I49A 4QFKA 2V93A 4LVQA 1SYIA 1IXCA 1II5A 1ZTYA 3IOVA 5CRYA 1PC3A 2I3WA 4G8MA 4YKPA 4RY1A 5F1QA 2DS9A 4OEUA 4YU0A 4F3GA 1PEBA 3G7WA 5H8HB 1A99A 3MVWA 4NEDA 4F31B 2UVHA 1URGA 3JYRA 3FXRA 3IB1A 3PPRA 4IO2A 2CMOA 3W9VA 3ZS6A 2XXTA 3HHFA 5DT6A 4NTLA 1UTHA 4DXUA 3IR1A 4G4PA 1WVJA 5BWJA 3LSXA 3TAJA 3FATA 3OEMA 1ZU0A 4G68B 1M5BA 1SD3A 3Q25A 4X1DA 3CG1A 2V3QA 3C36A 3MPKA 2ALUA 2Q2CA 5I2NA 4KPTA 4KQPA 5CI5A 5KZTA 3TEPA 3FJGA 4HW8A 4QFNA 3MJNA 3FJMA 2DWJA 1JW4A 4YB6A 1EU8A 3RTFB 2O84X 3O29A 4U1ZA 1KWHA 5F7VA 4ECFA 4P11A 3E9XA 4KR5A 5JEIA 2DE3A 1B0LA 2Z23A 3LSWA 1B05A 2DQVA 3T22A 2UXAA 4QFLA 2AL5A 4Q30B 1MQJA 1BTJA 1JEVA 2ONRA 1TT1A 1GR2A 1IZ1A 2QRYA 1FTJA 3ZSFA 5AA2D 1P1NA 1POY1 1S9TA 5B7DA 5ICTA 3G3HA 3H7MA 4H5GA 2RCAA 3VLUA 2QMWA 3IORA 2XXQA 2HAUA 1MQGA 1EH3A 3MVZA 2HFBA 1LLSA 1M5FA 1PB8A 3QIMA 4XXUA 2OBGA 3Q29A 3PU5A 3CFLA 5JK4A 2F8DA 3N6TA 1PB7A 4GIZA 3IK6B 3GXAA 4HCYA 5A5XA 3BKIB 2Z8EA 1JEUA 4X1BA 4XKRA 4GWOA 4ZEBA 3D4GA 4PQJA 4LQ5A 1BP5A 4KFQA 2XXRA 1I6QA 2I48A 2ONSA 3S4UA 2P2AA 3PGFA 2ABHA 4C0RA 1DPPA 3MVXA 4DXCA 1S50A 3K6XA 5CMKA 3MUQA 3K01A 2HQ0A 4FE8A 2P0SA 4F2OA 5ITPA 2I4CA 2HEUA 2ESNA 3UGWA 1POTA 4G2ZA 5H8NB 2Y7IA 2O51A 3MZBA 1IUDA 1FTKA 4QHQA 3KJ7A 5ICQA 1L5TA 3HV1A 3N5LA 5K2YA 3LSLA 4M1VA 1ATGA 3K1NA 3BFUA 5DVFA 4F18A 3MWBA 4DCYA 1S7YA 1XVYA 1MY3A 4NF6B 4TLMB 2DSFA 2DXRA 4F22A 1BKAA 2NOOA 2XHDA 2F35A 3FZVA 3LSFB 1P1WA 3ILUB 2AYSA 1O64A 4GL0A 1A54A 1MXVA 4H5FA 3N94A 2F7AA 5H8QA 4AB5A 4R6YA 5I2KA 3U94A 4LATA 4G8HA 4OENA 3K4UA 4FORA 3O6GA 4R2FA 1XHYA 1SW5A 4EXLA 3FV2A 3PPNA 1UIUA 2V84A 1N04A 1MY1A 1WDNA 3VDFA 4YZZA 4KHZE 3RT8A 1M5EA 2QMXA 3FVOA 1LCTA 1R9LA 3OO6A 4DZ1A 3KSXA 4KYDA 1EZPA 1IIWA 2DE2A 1GGGA 4H0WA 4KCCA 3IL1B 4JSDA 1MPBA 3SETA 3JV9A 4WXJA 4MBPA 4NF8A 3OOAA 5LOMA 4RA1A 4ZEKA 3I3VA 1MPCA 2ZXTA 2F7BA 3ZKKA 2ANJA 1B1HA 3MZ9A 2F6GA 4N07A 2QPQA 1B58A 1ZLQA 2O69A 3C35A 4FATA 2NUVA 1SBPA 4YMAA 3OO7A 2XXWA 2RF1A 3AXFA 5CMCA 2H9BA 4Q8RA 4Q5TA 3PPQA 1LFGA 2CZLA 3LBSA 1BLFA 4ZEIA 4MLQA 1F9BA 5I59B 3K1PA 3PMWA 3PPOA 2QS4A 4ZDMA 5H8SA 3H3GA 4QSDA 1QJMA 1H44A 1LCFA 3L6HA 3V8XB 2UYFA 1N0TA 4QFOA 3TTRA 4ELPA 2P1SA 4DE8A 4IO3A 4O3BA 2GHBA 4GQOA 1NFTA 3CVGA 4GRKA 4ZS9A 4OMBA 1QKBA 5TPAB 4RYAA 4LA9A 2O1MA 3O9PA 2H99A 1B3EA 2PVUA 3CIJA 1R6ZA 1IEJA 4MF3A 3T9XB 2ZNSA 2UVIA 3EHUA 3SERA 4M4GA 2OLBA 2VHAA 1LFHA 1AMFA 4EDPA 4RK9A 4OTEA 1SI1A 1TFDA 5AA4B 3G3JA 3BFTA 3CRBA 3WAFA 3TFLA 2PMSA 5L9MA 3A3CA 4LZ8A 2B65A 1MXUA 3EHTA 5L8DA 1OLCA 3K6VA 4X48A 3PMVA 4OZ9A 2ZMBA 2DVZA 3O6HA 3I5OA 3IB2A 1N84A 3KG2A 2THIA 2DXYA 4H8JA 1O7TA 3K6WA 1SVXB 4PETA 4NF5A 1MQIA 3FUZA 2QS3A 4HS7A 4F2QA 3KN7A 4YKKA 2A5SA 5I58A 1LBBA 1FQCA 4G77A 1UTBB 4AQ4A 1I6AA 3LUYA 1QULA 1B5JA 1Y3NA 3R6UA 4U4XA 1LB9A 1J1NA 4ELRA 3MQ9A 3EPEA 1MH4A 5DEXB 4PFUA 1SW4A 3KZGA 4FEDA 4RJZA 2Q88A 4F1VA 3E3KA 4THIA 2VP1A 2X7QA 4ZE9A 3M8UA 1NNPA 5I57B 4KYSA 3S9NC 1ZKBA 1P1OA 5KDTA 3B6TA 4BLAA 1SQYA 1VFEA 4FECA 4KCDA 5AA2B 3SKPA 1PDAA 4XKQA 1MY2A 4WEPA 1N76A 3KJTA 1US4A 3U8QA 3HCQA 3A3UA 1H76A 3SESA 3HHGA 2V3UA 4QSCA 2F34A 4R2BA 2ZNUA 3B6QA 2QS2A 3V5AA 1MXWA 5KCJB 5L9SA 3V89B 3MW0A 1JETA 4TLLB 1P1UA 3UP9A 3EQ1A 4EF2A 1HSLA 3FJ7A 5TP9A 4BDLA 2YPNA 1USYE 1NMUA 1CE2A 3IJOB 2QL3A 4ZECA 3WAEA 3MZ1A 3UIFA 4YB7A 3KFMA 1TXFA 3THIA 1NL5A 1H45A 3HSTA 2R9JA 2VD3A 3KEIA 4Z7EA 3H6UA 2A5TB 3K02A 3K2DA 2NXOA 4BDOA 4DIGA 1Q35A 5HM4B 3IAZA 4R75A 4NF4B 4PFTA 3MC2A 1IITA 3SDFA 4C1TA 4I1DA 3TYHA 3HN0A 5M2VA 2XXUA 3GBAA 1Z7ME 4IO5A 2XX8A 1AH5A 4EQBA 4R6KA 1XC1A 4XIGQ 5JTYA 3G3FA 3IO6A 2M8CA 2B3BA 4R9GA 1ZIUA 4OFLA 4UACA 3QUFA 1MDP1 4XKPA 3KN3A 1BIYA 2XD3A 3MP6A 2RC8A 4HTGA 2V3TA 5B70A 3VV5A 3PUVE 2D5WA 5I56A 4H6DA 2GFEA 1AOVA 3RQTA 4ND9A 4U21A 4UA8A 3IX1A 3USDA 2OJTA 1JVXA 4GOTA 1CB6A 2DYXA 5EHSA 2IEEA 1MM7A 2FA7A 2I4BA 4E0WA 4ZZEA 1XS5A 3L6GA 4R73A 2PT1A 3I6VA 4PFWA 1B32A 1A40A 3IOTA 3PUZE 3M3FA 2XXYA 4EF1A 5H8FA 1Y3QA 1Y1MA 3OMBA 3TCFA 4TQUQ 1JQFA 3OO9A 1SI0A 3G3IA 3U93A 1MQHA 4C1UA 2Q8JA 5IKBA 4ZEFA 3EF7A 4JXIA 3O66A 1UQWA 1TWYA 1XVXA 3D4CA 4MH5A 3VLVA 5IAIA 1FQFA 3KGCA 3T9VA 3RY3A 5CC2A 1VE4A 3MAMA 2IA4A 4R9FA 1B52A 3QXMA 4BDRA 2O6AA 2REGA 4U4SA 2HXWA 1Q1KA 3BBRA 3GLBA 2OK2A 2ONKE 2AIXA 3FXUA 1B5IA 3IOWA 1NH7A 2XX7A 1RKMA 4H67A 2HZLA 2Z8DA 2XX9A 5CMBA 5EYFA 5K2XA 1D3KA 4JB7A 4R6HA 3O28A 3C4MA 5I2NB 4PE5B 4P0GA 3MP8A 1DSNA 5DYHA 1H43A 1N3XA 3PUWE 3H03A 1QUIA 5HBCA 3OEKA 3LR1A 3C31A 1ELJA 3EN3A 1FCKA 4QRZA 3H6VA 3E4RA 3KN8A 1MPDA 4YICA 4OERA 2Y7WA 4K3FA 5H8HA 2Y7KA 3TTKA 4QF9A 3SEUA 1OQGA 2DOJA 2I0BA 1MQDA 3FVKA 1IXHA 4GFRA 3C32A 3T96B 4LUBA 5FHNA 2PX1A 3LC8A 3M3LA 4OFJA 4FEBA 1A8FA 4LZ5A 3H06B 3PUYE 3RLFE 4U22A 2YLNA 2XXPA 3QUJA 3F11A 4KD5A 4G68A 3ECRA 2D21A 4L17A 4ISUA 3H4ZA 3ILTB 2KLFA 1QUKA 2GH9A 3SEWA 5FTIA 3TTMA 2X26A 1NKXA 4X9TA 4F19A 5L9OA 1OQHA 5A5XB 4F3PA 2VD2A 4O3CA 3UK4A 2NWJA 1B7UA 3ZKLA 1FQEA 2NVUB 3KSJA 1B2HA 1LAXA 2F5XA 3TELA 3T9HB 1IXIA 4F39A 1IQ7A 2GHAA 2RKMA 3K0VA 1URDA 2XXHA 1LSTA 3OSRA 3KOTA 4YKIA 2HZKA 4MLVA 3QK6A 1QKAA 2I3VA 2ZYKA 1B9JA 4U23A 3PD8A 1NNFA 2OWTA 3GZGA 2QJEA 1B6HA 4U2RA 4WKMA 4P0IA 2BJJX 3DP8A 1B46A 1JW5A 4H65A 3CFXA 1FQAA 3HO7A 2E1SA 2XXIA 1B40A 4Q0CA 1PBQA 4OWDA 1US5A 4PP0A 5CM6A 4JDFA 1ANFA 2GRVA 2F6PA 4POWA 3C34A 3UORA 4F3BA 1OIBA 1LAGE 1EZOA 4KI0E 1P99A 4I62A 1B5HA 5ELVA 1URSA 2RC7A 3RT6B 4ESWA 1LGBC 2OCUA 4RPNA 3TZAA 2OZZA 5H8QB 4GF8A 4FJPA 5I2KB 1DMBA 2I6EA 4OFOA 1UIVA 4GXAA 2LAOA 1M5CA 3OSQA 2E0SA 3FV1A 3TQLA 3JZJA 3H6TA 5H8NA 2R71A 3A09A 4EQ9A 1Z7NE 1DPEA 4WEDA 3VXBA 5AA3A 1MRPA 4GXSB 3W9WA 4DCXA 2H5YA 3PV0E 1PB9A 3Q28A 4H8IA 4GLIA 4N13A 2HCAA 3TMGA 2W7YA 2DWIA 3TUSA 3VFJA 1XT8A 3OENA 4IO6A 4F1YA 2D3IA 4NF8B 1HSJA 3FVGA 4OQOA 4EQ7A 2YJPA 4ELOA 4LQ2A 3U72A 4OHNA 4NF6A 4XTCQ 4IGTA 3RGYA 1LAFE 2QSXA 2O7IA 3VVEA 2DWAA 3IOUA 3KOSA 4BDQA 3TTLA 4NE4A 1ZJLA 2F36A 3H6WA 4I9DA 1QUJA 1HSEA 1SDXA 3IJXB 1Y9UA 3S9EA 2AL4A 5DTBA 4F1UA 3B6WA 2X7PA 3MP1A 3FGSA 1YCJA 3O6IA 4GL8A 5CBRA 3T93B 4QFPA 4G8NA 2Z8FA 2F97A 4JBZA 4XKNA 1LFIA 3QAXA 3DLNA 3DELB 4RPOA 1RYOA 4PFYA 4ZZAA 2PYYA 4TOZA 1YTVA 2Y84A 1N7WA 1XOCA 3E13X 4OETA 1NH8A 2O68A 4OXVA 3T66A 2I58A 2FNCA 1FTLA 4ZE8A 3DP4A 1QVSA 3Q26A 1D9YA 1AL3A 1OVTA 3FVNA 5ITOA 4ZEDA 4QSEA 3U1OA 4NMYA 2G93A 1USYH 3N26A 4H1XA 4EUOA 1LAHE 1MM6A 1QW0A 4RNSA 2ZYOA 4ESXA 3TPAA 3W15C 3M3KA 5I59A 4BDNA 1B1XA 5BUUA 1SW2A 3R26A 4ONYA 4Z0IA 2Q9TA 4ELQA 3TKDA 4R74A 3B7DA 1MXZA 2I0CA 4YB5A 1NNTA 3QYTA 1TFAA 4EXKA 2UVJA 1OLAA 4POXA 2H25A 5AE4A 2Q2AA 1A7LA 5I84A 2XXVA 3FIRA 1SYHA 1WODA 2Q89A 4DDDA 4NWDA 1MH3A 4F3SA 3MVYA 4NF5B 4F29A 3CFZA 5TPAA 3V83A 3PD9A 5I58B 2R6GE 1LBCA 2RC9A 3G3GA 1Y3PA 3K00A 4LONB 1YPNA 2Y7PA 3SEYA 1GVCA 4HCWA 3VVDA 1DTGA 3CG3A 3QSLA 2UVGA 3R7XA 4FIMA 2Y7RA 2Z22A 3MPLA 2XXXA 3DP6A 2DWHA 5AA4A 2V25A 3K6UA 3N6UA 1FQDA 5KDTB 1M5DA 3TCGA 3TCHA 5FTHA 1UTHB 1I69A 1PBPA 1N7XA 1ZMGA 4IO4A 1FW0A 3FD3A 5CBSA 3O97A 3UA8A 3SEVA 2ZYMA 5J1DA 3CI8A 1FQBA 1B3GA 4IB2A 1EZ9A 3C33A 1VR5A 4N6PA 5ISUA 1O63A 2ZYNA 1SW1A 1A55A 5FHMA 4OVJA 4DLDA 3OO8A 4OEVA 1Y4CA 5TP9B 1UTBA 4O3AA 4LZ7A 2OWSA 1GV8A 3PUXE 3S9MC 3TDJA 5DEXA 5HPQA 2PBWA 4LP2B 1ZBMA 1I6BA 1FTMA 3OXNA 1MXXA 1OMPA 2ZNTA 1B3HA 3UN6A 1VSOA 1DOTA 1R9QA 4OESA 3VXCA 4YMBA 5I57A 3GBBA 4RK2A 3TODA 1FTOA 3RN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MY4 A;  1JVY A;  1R1N A;  2H4I A;  3EHS A;  1YAE A;  3IO4 A;  4GD5 A;  1Y1Z A;  3VE1 B;  5AA2 A;  4RXL A;  4U1O A;  5CMM A;  1B4Z A;  2DVC A;  5TU0 A;  2F7C A;  3S9L C;  1D4N A;  5EHM A;  3G3K A;  4JSO A;  1JNF A;  4JWO A;  1P1Q A;  5KCJ A;  1MXY A;  3OEL A;  3TQW A;  5JTY B;  3ONM A;  1B3F A;  3MBP A;  2UYE A;  1RYX A;  1B7H A;  4JWY A;  3U92 A;  1N3W A;  1NNK A;  4E0X A;  3RPW A;  3KBR A;  4AB6 A;  3CSG A;  3CR9 A;  4R72 A;  1B4H A;  3RNN A;  3ODB A;  4KYE A;  2VOZ A;  2RCB A;  5I56 B;  5DVJ A;  2WKY A;  1AIV A;  2FYI A;  4OYV A;  2A5T A;  1JW1 A;  4IY6 A;  2PT2 A;  2VGQ A;  1VFD A;  1LB8 A;  1OVB A;  3VLW A;  1DTZ A;  3S2V A;  3DM0 A;  2O1L A;  3P7I A;  1MS7 A;  3IB0 A;  3RUM A;  2HAV A;  1D9V A;  4G68 C;  4NF4 A;  4DXB A;  2G29 A;  1B7Z A;  3FXQ A;  1MY0 A;  3K1M A;  3C9H A;  4YAH X;  3FAS A;  5H8F B;  4BDM A;  2H98 A;  5FHO A;  3TTN A;  1B51 A;  2DP8 A;  1GTK A;  3HPI A;  1Y20 A;  2XD2 A;  2DE4 A;  4YKJ A;  3T9U A;  1Y4T A;  1T0K A;  4GVO A;  4IO7 A;  3VVF A;  3RTW B;  2O7U A;  5AA1 A;  2F78 A;  1A8E A;  4NWC A;  3OD7 A;  1IXG A;  4JWX A;  4I8C A;  2RIN A;  1B0H A;  4IGR A;  4FAJ A;  2REJ A;  3PPP A;  3CSB A;  4IY5 A;  3PMX A;  1MDQ A;  5DVI A;  2B3F A;  4MFI A;  3Q27 A;  3SEX A;  2QS1 A;  1H3D A;  1MG1 A;  3O2A A;  1B3L A;  2I49 A;  4QFK A;  2V93 A;  4LVQ A;  1SYI A;  1IXC A;  1II5 A;  1ZTY A;  3IOV A;  5CRY A;  1PC3 A;  2I3W A;  4G8M A;  4YKP A;  4RY1 A;  5F1Q A;  2DS9 A;  4OEU A;  4YU0 A;  4F3G A;  1PEB A;  3G7W A;  5H8H B;  1A99 A;  3MVW A;  4NED A;  4F31 B;  2UVH A;  1URG A;  3JYR A;  3FXR A;  3IB1 A;  3PPR A;  4IO2 A;  2CMO A;  3W9V A;  3ZS6 A;  2XXT A;  3HHF A;  5DT6 A;  4NTL A;  1UTH A;  4DXU A;  3IR1 A;  4G4P A;  1WVJ A;  5BWJ A;  3LSX A;  3TAJ A;  3FAT A;  3OEM A;  1ZU0 A;  4G68 B;  1M5B A;  1SD3 A;  3Q25 A;  4X1D A;  3CG1 A;  2V3Q A;  3C36 A;  3MPK A;  2ALU A;  2Q2C A;  5I2N A;  4KPT A;  4KQP A;  5CI5 A;  5KZT A;  3TEP A;  3FJG A;  4HW8 A;  4QFN A;  3MJN A;  3FJM A;  2DWJ A;  1JW4 A;  4YB6 A;  1EU8 A;  3RTF B;  2O84 X;  3O29 A;  4U1Z A;  1KWH A;  5F7V A;  4ECF A;  4P11 A;  3E9X A;  4KR5 A;  5JEI A;  2DE3 A;  1B0L A;  2Z23 A;  3LSW A;  1B05 A;  2DQV A;  3T22 A;  2UXA A;  4QFL A;  2AL5 A;  4Q30 B;  1MQJ A;  1BTJ A;  1JEV A;  2ONR A;  1TT1 A;  1GR2 A;  1IZ1 A;  2QRY A;  1FTJ A;  3ZSF A;  5AA2 D;  1P1N A;  1POY 1;  1S9T A;  5B7D A;  5ICT A;  3G3H A;  3H7M A;  4H5G A;  2RCA A;  3VLU A;  2QMW A;  3IOR A;  2XXQ A;  2HAU A;  1MQG A;  1EH3 A;  3MVZ A;  2HFB A;  1LLS A;  1M5F A;  1PB8 A;  3QIM A;  4XXU A;  2OBG A;  3Q29 A;  3PU5 A;  3CFL A;  5JK4 A;  2F8D A;  3N6T A;  1PB7 A;  4GIZ A;  3IK6 B;  3GXA A;  4HCY A;  5A5X A;  3BKI B;  2Z8E A;  1JEU A;  4X1B A;  4XKR A;  4GWO A;  4ZEB A;  3D4G A;  4PQJ A;  4LQ5 A;  1BP5 A;  4KFQ A;  2XXR A;  1I6Q A;  2I48 A;  2ONS A;  3S4U A;  2P2A A;  3PGF A;  2ABH A;  4C0R A;  1DPP A;  3MVX A;  4DXC A;  1S50 A;  3K6X A;  5CMK A;  3MUQ A;  3K01 A;  2HQ0 A;  4FE8 A;  2P0S A;  4F2O A;  5ITP A;  2I4C A;  2HEU A;  2ESN A;  3UGW A;  1POT A;  4G2Z A;  5H8N B;  2Y7I A;  2O51 A;  3MZB A;  1IUD A;  1FTK A;  4QHQ A;  3KJ7 A;  5ICQ A;  1L5T A;  3HV1 A;  3N5L A;  5K2Y A;  3LSL A;  4M1V A;  1ATG A;  3K1N A;  3BFU A;  5DVF A;  4F18 A;  3MWB A;  4DCY A;  1S7Y A;  1XVY A;  1MY3 A;  4NF6 B;  4TLM B;  2DSF A;  2DXR A;  4F22 A;  1BKA A;  2NOO A;  2XHD A;  2F35 A;  3FZV A;  3LSF B;  1P1W A;  3ILU B;  2AYS A;  1O64 A;  4GL0 A;  1A54 A;  1MXV A;  4H5F A;  3N94 A;  2F7A A;  5H8Q A;  4AB5 A;  4R6Y A;  5I2K A;  3U94 A;  4LAT A;  4G8H A;  4OEN A;  3K4U A;  4FOR A;  3O6G A;  4R2F A;  1XHY A;  1SW5 A;  4EXL A;  3FV2 A;  3PPN A;  1UIU A;  2V84 A;  1N04 A;  1MY1 A;  1WDN A;  3VDF A;  4YZZ A;  4KHZ E;  3RT8 A;  1M5E A;  2QMX A;  3FVO A;  1LCT A;  1R9L A;  3OO6 A;  4DZ1 A;  3KSX A;  4KYD A;  1EZP A;  1IIW A;  2DE2 A;  1GGG A;  4H0W A;  4KCC A;  3IL1 B;  4JSD A;  1MPB A;  3SET A;  3JV9 A;  4WXJ A;  4MBP A;  4NF8 A;  3OOA A;  5LOM A;  4RA1 A;  4ZEK A;  3I3V A;  1MPC A;  2ZXT A;  2F7B A;  3ZKK A;  2ANJ A;  1B1H A;  3MZ9 A;  2F6G A;  4N07 A;  2QPQ A;  1B58 A;  1ZLQ A;  2O69 A;  3C35 A;  4FAT A;  2NUV A;  1SBP A;  4YMA A;  3OO7 A;  2XXW A;  2RF1 A;  3AXF A;  5CMC A;  2H9B A;  4Q8R A;  4Q5T A;  3PPQ A;  1LFG A;  2CZL A;  3LBS A;  1BLF A;  4ZEI A;  4MLQ A;  1F9B A;  5I59 B;  3K1P A;  3PMW A;  3PPO A;  2QS4 A;  4ZDM A;  5H8S A;  3H3G A;  4QSD A;  1QJM A;  1H44 A;  1LCF A;  3L6H A;  3V8X B;  2UYF A;  1N0T A;  4QFO A;  3TTR A;  4ELP A;  2P1S A;  4DE8 A;  4IO3 A;  4O3B A;  2GHB A;  4GQO A;  1NFT A;  3CVG A;  4GRK A;  4ZS9 A;  4OMB A;  1QKB A;  5TPA B;  4RYA A;  4LA9 A;  2O1M A;  3O9P A;  2H99 A;  1B3E A;  2PVU A;  3CIJ A;  1R6Z A;  1IEJ A;  4MF3 A;  3T9X B;  2ZNS A;  2UVI A;  3EHU A;  3SER A;  4M4G A;  2OLB A;  2VHA A;  1LFH A;  1AMF A;  4EDP A;  4RK9 A;  4OTE A;  1SI1 A;  1TFD A;  5AA4 B;  3G3J A;  3BFT A;  3CRB A;  3WAF A;  3TFL A;  2PMS A;  5L9M A;  3A3C A;  4LZ8 A;  2B65 A;  1MXU A;  3EHT A;  5L8D A;  1OLC A;  3K6V A;  4X48 A;  3PMV A;  4OZ9 A;  2ZMB A;  2DVZ A;  3O6H A;  3I5O A;  3IB2 A;  1N84 A;  3KG2 A;  2THI A;  2DXY A;  4H8J A;  1O7T A;  3K6W A;  1SVX B;  4PET A;  4NF5 A;  1MQI A;  3FUZ A;  2QS3 A;  4HS7 A;  4F2Q A;  3KN7 A;  4YKK A;  2A5S A;  5I58 A;  1LBB A;  1FQC A;  4G77 A;  1UTB B;  4AQ4 A;  1I6A A;  3LUY A;  1QUL A;  1B5J A;  1Y3N A;  3R6U A;  4U4X A;  1LB9 A;  1J1N A;  4ELR A;  3MQ9 A;  3EPE A;  1MH4 A;  5DEX B;  4PFU A;  1SW4 A;  3KZG A;  4FED A;  4RJZ A;  2Q88 A;  4F1V A;  3E3K A;  4THI A;  2VP1 A;  2X7Q A;  4ZE9 A;  3M8U A;  1NNP A;  5I57 B;  4KYS A;  3S9N C;  1ZKB A;  1P1O A;  5KDT A;  3B6T A;  4BLA A;  1SQY A;  1VFE A;  4FEC A;  4KCD A;  5AA2 B;  3SKP A;  1PDA A;  4XKQ A;  1MY2 A;  4WEP A;  1N76 A;  3KJT A;  1US4 A;  3U8Q A;  3HCQ A;  3A3U A;  1H76 A;  3SES A;  3HHG A;  2V3U A;  4QSC A;  2F34 A;  4R2B A;  2ZNU A;  3B6Q A;  2QS2 A;  3V5A A;  1MXW A;  5KCJ B;  5L9S A;  3V89 B;  3MW0 A;  1JET A;  4TLL B;  1P1U A;  3UP9 A;  3EQ1 A;  4EF2 A;  1HSL A;  3FJ7 A;  5TP9 A;  4BDL A;  2YPN A;  1USY E;  1NMU A;  1CE2 A;  3IJO B;  2QL3 A;  4ZEC A;  3WAE A;  3MZ1 A;  3UIF A;  4YB7 A;  3KFM A;  1TXF A;  3THI A;  1NL5 A;  1H45 A;  3HST A;  2R9J A;  2VD3 A;  3KEI A;  4Z7E A;  3H6U A;  2A5T B;  3K02 A;  3K2D A;  2NXO A;  4BDO A;  4DIG A;  1Q35 A;  5HM4 B;  3IAZ A;  4R75 A;  4NF4 B;  4PFT A;  3MC2 A;  1IIT A;  3SDF A;  4C1T A;  4I1D A;  3TYH A;  3HN0 A;  5M2V A;  2XXU A;  3GBA A;  1Z7M E;  4IO5 A;  2XX8 A;  1AH5 A;  4EQB A;  4R6K A;  1XC1 A;  4XIG Q;  5JTY A;  3G3F A;  3IO6 A;  2M8C A;  2B3B A;  4R9G A;  1ZIU A;  4OFL A;  4UAC A;  3QUF A;  1MDP 1;  4XKP A;  3KN3 A;  1BIY A;  2XD3 A;  3MP6 A;  2RC8 A;  4HTG A;  2V3T A;  5B70 A;  3VV5 A;  3PUV E;  2D5W A;  5I56 A;  4H6D A;  2GFE A;  1AOV A;  3RQT A;  4ND9 A;  4U21 A;  4UA8 A;  3IX1 A;  3USD A;  2OJT A;  1JVX A;  4GOT A;  1CB6 A;  2DYX A;  5EHS A;  2IEE A;  1MM7 A;  2FA7 A;  2I4B A;  4E0W A;  4ZZE A;  1XS5 A;  3L6G A;  4R73 A;  2PT1 A;  3I6V A;  4PFW A;  1B32 A;  1A40 A;  3IOT A;  3PUZ E;  3M3F A;  2XXY A;  4EF1 A;  5H8F A;  1Y3Q A;  1Y1M A;  3OMB A;  3TCF A;  4TQU Q;  1JQF A;  3OO9 A;  1SI0 A;  3G3I A;  3U93 A;  1MQH A;  4C1U A;  2Q8J A;  5IKB A;  4ZEF A;  3EF7 A;  4JXI A;  3O66 A;  1UQW A;  1TWY A;  1XVX A;  3D4C A;  4MH5 A;  3VLV A;  5IAI A;  1FQF A;  3KGC A;  3T9V A;  3RY3 A;  5CC2 A;  1VE4 A;  3MAM A;  2IA4 A;  4R9F A;  1B52 A;  3QXM A;  4BDR A;  2O6A A;  2REG A;  4U4S A;  2HXW A;  1Q1K A;  3BBR A;  3GLB A;  2OK2 A;  2ONK E;  2AIX A;  3FXU A;  1B5I A;  3IOW A;  1NH7 A;  2XX7 A;  1RKM A;  4H67 A;  2HZL A;  2Z8D A;  2XX9 A;  5CMB A;  5EYF A;  5K2X A;  1D3K A;  4JB7 A;  4R6H A;  3O28 A;  3C4M A;  5I2N B;  4PE5 B;  4P0G A;  3MP8 A;  1DSN A;  5DYH A;  1H43 A;  1N3X A;  3PUW E;  3H03 A;  1QUI A;  5HBC A;  3OEK A;  3LR1 A;  3C31 A;  1ELJ A;  3EN3 A;  1FCK A;  4QRZ A;  3H6V A;  3E4R A;  3KN8 A;  1MPD A;  4YIC A;  4OER A;  2Y7W A;  4K3F A;  5H8H A;  2Y7K A;  3TTK A;  4QF9 A;  3SEU A;  1OQG A;  2DOJ A;  2I0B A;  1MQD A;  3FVK A;  1IXH A;  4GFR A;  3C32 A;  3T96 B;  4LUB A;  5FHN A;  2PX1 A;  3LC8 A;  3M3L A;  4OFJ A;  4FEB A;  1A8F A;  4LZ5 A;  3H06 B;  3PUY E;  3RLF E;  4U22 A;  2YLN A;  2XXP A;  3QUJ A;  3F11 A;  4KD5 A;  4G68 A;  3ECR A;  2D21 A;  4L17 A;  4ISU A;  3H4Z A;  3ILT B;  2KLF A;  1QUK A;  2GH9 A;  3SEW A;  5FTI A;  3TTM A;  2X26 A;  1NKX A;  4X9T A;  4F19 A;  5L9O A;  1OQH A;  5A5X B;  4F3P A;  2VD2 A;  4O3C A;  3UK4 A;  2NWJ A;  1B7U A;  3ZKL A;  1FQE A;  2NVU B;  3KSJ A;  1B2H A;  1LAX A;  2F5X A;  3TEL A;  3T9H B;  1IXI A;  4F39 A;  1IQ7 A;  2GHA A;  2RKM A;  3K0V A;  1URD A;  2XXH A;  1LST A;  3OSR A;  3KOT A;  4YKI A;  2HZK A;  4MLV A;  3QK6 A;  1QKA A;  2I3V A;  2ZYK A;  1B9J A;  4U23 A;  3PD8 A;  1NNF A;  2OWT A;  3GZG A;  2QJE A;  1B6H A;  4U2R A;  4WKM A;  4P0I A;  2BJJ X;  3DP8 A;  1B46 A;  1JW5 A;  4H65 A;  3CFX A;  1FQA A;  3HO7 A;  2E1S A;  2XXI A;  1B40 A;  4Q0C A;  1PBQ A;  4OWD A;  1US5 A;  4PP0 A;  5CM6 A;  4JDF A;  1ANF A;  2GRV A;  2F6P A;  4POW A;  3C34 A;  3UOR A;  4F3B A;  1OIB A;  1LAG E;  1EZO A;  4KI0 E;  1P99 A;  4I62 A;  1B5H A;  5ELV A;  1URS A;  2RC7 A;  3RT6 B;  4ESW A;  1LGB C;  2OCU A;  4RPN A;  3TZA A;  2OZZ A;  5H8Q B;  4GF8 A;  4FJP A;  5I2K B;  1DMB A;  2I6E A;  4OFO A;  1UIV A;  4GXA A;  2LAO A;  1M5C A;  3OSQ A;  2E0S A;  3FV1 A;  3TQL A;  3JZJ A;  3H6T A;  5H8N A;  2R71 A;  3A09 A;  4EQ9 A;  1Z7N E;  1DPE A;  4WED A;  3VXB A;  5AA3 A;  1MRP A;  4GXS B;  3W9W A;  4DCX A;  2H5Y A;  3PV0 E;  1PB9 A;  3Q28 A;  4H8I A;  4GLI A;  4N13 A;  2HCA A;  3TMG A;  2W7Y A;  2DWI A;  3TUS A;  3VFJ A;  1XT8 A;  3OEN A;  4IO6 A;  4F1Y A;  2D3I A;  4NF8 B;  1HSJ A;  3FVG A;  4OQO A;  4EQ7 A;  2YJP A;  4ELO A;  4LQ2 A;  3U72 A;  4OHN A;  4NF6 A;  4XTC Q;  4IGT A;  3RGY A;  1LAF E;  2QSX A;  2O7I A;  3VVE A;  2DWA A;  3IOU A;  3KOS A;  4BDQ A;  3TTL A;  4NE4 A;  1ZJL A;  2F36 A;  3H6W A;  4I9D A;  1QUJ A;  1HSE A;  1SDX A;  3IJX B;  1Y9U A;  3S9E A;  2AL4 A;  5DTB A;  4F1U A;  3B6W A;  2X7P A;  3MP1 A;  3FGS A;  1YCJ A;  3O6I A;  4GL8 A;  5CBR A;  3T93 B;  4QFP A;  4G8N A;  2Z8F A;  2F97 A;  4JBZ A;  4XKN A;  1LFI A;  3QAX A;  3DLN A;  3DEL B;  4RPO A;  1RYO A;  4PFY A;  4ZZA A;  2PYY A;  4TOZ A;  1YTV A;  2Y84 A;  1N7W A;  1XOC A;  3E13 X;  4OET A;  1NH8 A;  2O68 A;  4OXV A;  3T66 A;  2I58 A;  2FNC A;  1FTL A;  4ZE8 A;  3DP4 A;  1QVS A;  3Q26 A;  1D9Y A;  1AL3 A;  1OVT A;  3FVN A;  5ITO A;  4ZED A;  4QSE A;  3U1O A;  4NMY A;  2G93 A;  1USY H;  3N26 A;  4H1X A;  4EUO A;  1LAH E;  1MM6 A;  1QW0 A;  4RNS A;  2ZYO A;  4ESX A;  3TPA A;  3W15 C;  3M3K A;  5I59 A;  4BDN A;  1B1X A;  5BUU A;  1SW2 A;  3R26 A;  4ONY A;  4Z0I A;  2Q9T A;  4ELQ A;  3TKD A;  4R74 A;  3B7D A;  1MXZ A;  2I0C A;  4YB5 A;  1NNT A;  3QYT A;  1TFA A;  4EXK A;  2UVJ A;  1OLA A;  4POX A;  2H25 A;  5AE4 A;  2Q2A A;  1A7L A;  5I84 A;  2XXV A;  3FIR A;  1SYH A;  1WOD A;  2Q89 A;  4DDD A;  4NWD A;  1MH3 A;  4F3S A;  3MVY A;  4NF5 B;  4F29 A;  3CFZ A;  5TPA A;  3V83 A;  3PD9 A;  5I58 B;  2R6G E;  1LBC A;  2RC9 A;  3G3G A;  1Y3P A;  3K00 A;  4LON B;  1YPN A;  2Y7P A;  3SEY A;  1GVC A;  4HCW A;  3VVD A;  1DTG A;  3CG3 A;  3QSL A;  2UVG A;  3R7X A;  4FIM A;  2Y7R A;  2Z22 A;  3MPL A;  2XXX A;  3DP6 A;  2DWH A;  5AA4 A;  2V25 A;  3K6U A;  3N6U A;  1FQD A;  5KDT B;  1M5D A;  3TCG A;  3TCH A;  5FTH A;  1UTH B;  1I69 A;  1PBP A;  1N7X A;  1ZMG A;  4IO4 A;  1FW0 A;  3FD3 A;  5CBS A;  3O97 A;  3UA8 A;  3SEV A;  2ZYM A;  5J1D A;  3CI8 A;  1FQB A;  1B3G A;  4IB2 A;  1EZ9 A;  3C33 A;  1VR5 A;  4N6P A;  5ISU A;  1O63 A;  2ZYN A;  1SW1 A;  1A55 A;  5FHM A;  4OVJ A;  4DLD A;  3OO8 A;  4OEV A;  1Y4C A;  5TP9 B;  1UTB A;  4O3A A;  4LZ7 A;  2OWS A;  1GV8 A;  3PUX E;  3S9M C;  3TDJ A;  5DEX A;  5HPQ A;  2PBW A;  4LP2 B;  1ZBM A;  1I6B A;  1FTM A;  3OXN A;  1MXX A;  1OMP A;  2ZNT A;  1B3H A;  3UN6 A;  1VSO A;  1DOT A;  1R9Q A;  4OES A;  3VXC A;  4YMB A;  5I57 A;  3GBB A;  4RK2 A;  3TOD A;  1FTO A;  3RN8 A; 
#chains in the Genus database with same CATH topology
 1MY4 A;  1JVY A;  1R1N A;  2H4I A;  3EHS A;  1YAE A;  4GWW A;  3IO4 A;  4GD5 A;  5F24 A;  3A29 A;  1Y1Z A;  3VE1 B;  5AA2 A;  4RXL A;  4U1O A;  4P56 A;  5CMM A;  1B4Z A;  2DVC A;  5TU0 A;  2F7C A;  3S9L C;  1FPD A;  1D4N A;  5EHM A;  3G3K A;  1FPG A;  4JSO A;  2V4C A;  1JNF A;  4JWO A;  1P1Q A;  5KCJ A;  1MXY A;  3OEL A;  3TQW A;  5JTY B;  3ONM A;  1B3F A;  3MBP A;  2P3N A;  2UYE A;  1RYX A;  5IZZ A;  1B7H A;  4JWY A;  3U92 A;  1N3W A;  1NNK A;  4E0X A;  2XXK A;  3RPW A;  3KBR A;  4AB6 A;  2MKZ A;  3CSG A;  3CR9 A;  4R72 A;  1B4H A;  3RNN A;  3ODB A;  4KYE A;  2VOZ A;  2RCB A;  5I56 B;  5DVJ A;  2WKY A;  1AIV A;  2FYI A;  2WYP A;  4OYV A;  2A5T A;  1JW1 A;  1LBZ A;  3E78 A;  4IY6 A;  4NN3 A;  2PT2 A;  2VGQ A;  1VFD A;  1LB8 A;  3E79 A;  1OVB A;  3VLW A;  1DTZ A;  3S2V A;  3SZP A;  3DM0 A;  2O1L A;  3P7I A;  1MS7 A;  3IB0 A;  3RUM A;  2HAV A;  1D9V A;  4G68 C;  4NF4 A;  4DXB A;  2G29 A;  1B7Z A;  3FXQ A;  1MY0 A;  3K1M A;  3C9H A;  4YAH X;  1LEV A;  3FAS A;  1D9Q A;  4P9K A;  5H8F B;  4BDM A;  2H98 A;  5FHO A;  3TTN A;  1B51 A;  2DP8 A;  1GTK A;  3HPI A;  3NOH A;  1Y20 A;  2XD2 A;  2DE4 A;  4YKJ A;  3T9U A;  1K9Y A;  1Y4T A;  1T0K A;  4GVO A;  4IO7 A;  3VVF A;  3RTW B;  2O7U A;  5AA1 A;  2F78 A;  1A8E A;  4NWC A;  3OD7 A;  1IXG A;  4JWX A;  4I8C A;  4XFE A;  2RIN A;  1B0H A;  4IGR A;  4FAJ A;  2REJ A;  3PPP A;  3CSB A;  4IY5 A;  3QMF A;  3PMX A;  1FBG A;  1MDQ A;  5DVI A;  2B3F A;  4MFI A;  3Q27 A;  4N6K A;  3SEX A;  2QS1 A;  1H3D A;  4GWZ A;  4AS5 A;  1MG1 A;  3O2A A;  1B3L A;  2I49 A;  4QFK A;  2V93 A;  4GBV A;  4LVQ A;  1SYI A;  1IXC A;  1II5 A;  1ZTY A;  3IOV A;  5CRY A;  1PC3 A;  2I3W A;  4G8M A;  4YKP A;  4RY1 A;  2XWK A;  5F1Q A;  2DS9 A;  4OEU A;  3IFA A;  4YU0 A;  4OVR A;  4F3G A;  1PEB A;  3G7W A;  5H8H B;  1A99 A;  3MVW A;  4NED A;  4F31 B;  2UVH A;  1URG A;  3JYR A;  3FXR A;  1FBF A;  3IB1 A;  3PPR A;  4IO2 A;  2CMO A;  3B8B A;  3W9V A;  3ZS6 A;  2XXT A;  3HHF A;  5DT6 A;  4NTL A;  1UTH A;  4DXU A;  3IR1 A;  4G4P A;  1WVJ A;  5BWJ A;  3LSX A;  1IMF A;  3TAJ A;  2WBD A;  3FAT A;  3OEM A;  1ZU0 A;  3RPL A;  1NV1 A;  4G68 B;  4IR8 A;  1M5B A;  1SD3 A;  3Q25 A;  4X1D A;  3CG1 A;  2V3Q A;  3C36 A;  3MPK A;  1NV5 A;  2ALU A;  2Q2C A;  5I2N A;  5LTC A;  4KPT A;  4KQP A;  5CI5 A;  5KZT A;  3TEP A;  3FJG A;  1DBZ A;  5A5L A;  4HW8 A;  4QFN A;  1FJ6 A;  3MJN A;  3FJM A;  2DWJ A;  1JW4 A;  4YB6 A;  1EU8 A;  3RTF B;  2O84 X;  3O29 A;  4U1Z A;  1KWH A;  5F7V A;  4ECF A;  4P11 A;  3E9X A;  4KR5 A;  5JEI A;  2DE3 A;  1B0L A;  3LSW A;  2Z23 A;  1B05 A;  2DQV A;  3T22 A;  4MAG A;  2UXA A;  4QFL A;  2AL5 A;  4Q30 B;  1MQJ A;  1BTJ A;  1JEV A;  4HXV A;  2ONR A;  1TT1 A;  1GR2 A;  1IZ1 A;  5I5P A;  2QRY A;  1FTJ A;  3ZSF A;  5AA2 D;  1P1N A;  1POY 1;  1S9T A;  5B7D A;  5ICT A;  1NV4 A;  3G3H A;  4MNP A;  3H7M A;  4H5G A;  1NV3 A;  2RCA A;  3VLU A;  2QMW A;  3IOR A;  2XXQ A;  2HAU A;  1MQG A;  1EH3 A;  3MVZ A;  2HFB A;  1LLS A;  1M5F A;  1PB8 A;  3QIM A;  4XXU A;  2OBG A;  1INP A;  3Q29 A;  3PU5 A;  2FIX A;  5T3J A;  4GX6 A;  3CFL A;  5JK4 A;  1DCU A;  2F8D A;  3N6T A;  1PB7 A;  4GIZ A;  3IK6 B;  3GXA A;  4HCY A;  5A5X A;  3PTY A;  3BKI B;  2Z8E A;  1JEU A;  1NI9 A;  4X1B A;  4XKR A;  3B50 A;  4GWO A;  4KXP A;  1EYK A;  4ZEB A;  3D4G A;  4PQJ A;  1FSA A;  1FJ9 A;  4LQ5 A;  1G0I A;  1BP5 A;  4KFQ A;  2XXR A;  1I6Q A;  2I48 A;  2ONS A;  1NV0 A;  3S4U A;  2P2A A;  3PGF A;  2DDK A;  2ABH A;  4C0R A;  1DPP A;  3MVX A;  4DXC A;  1S50 A;  1FPF A;  3K6X A;  5CMK A;  3MUQ A;  3K01 A;  2HQ0 A;  4FE8 A;  2P0S A;  4MMP A;  4F2O A;  4GWS A;  5ITP A;  2I4C A;  2HEU A;  2ESN A;  3UGW A;  1POT A;  4G2Z A;  5H8N B;  2Y7I A;  4HE1 A;  1G0H A;  2O51 A;  3MZB A;  1YZ0 A;  1IUD A;  1FTK A;  4QHQ A;  3KJ7 A;  5ICQ A;  2QFL A;  1L5T A;  3HV1 A;  5IZ3 B;  3N5L A;  5K2Y A;  3LSL A;  4N6D A;  5ESY A;  4M1V A;  1ATG A;  5IGA A;  3K1N A;  2Y5L A;  3BFU A;  5DVF A;  4F18 A;  3MWB A;  4DCY A;  1S7Y A;  1XVY A;  1MY3 A;  4NF6 B;  4TLM B;  2DSF A;  2DXR A;  4F22 A;  1BKA A;  2NOO A;  2XHD A;  2F35 A;  3FZV A;  1FBE A;  3LSF B;  1P1W A;  3FBP A;  3ILU B;  2AYS A;  1O64 A;  4GL0 A;  1A54 A;  1MXV A;  4H5F A;  3N94 A;  2F7A A;  5H8Q A;  4AB5 A;  4R6Y A;  5I2K A;  3U94 A;  4LAT A;  4G8H A;  3KC0 A;  4OEN A;  3K4U A;  4FOR A;  4P1L A;  3O6G A;  4R2F A;  3MYU A;  4QXD A;  1XHY A;  5J16 A;  1SW5 A;  4PTK A;  4EXL A;  1DK4 A;  3FV2 A;  3PPN A;  2VPO A;  1UIU A;  2V84 A;  4O7M A;  1N04 A;  1MY1 A;  2PCR A;  1WDN A;  3VDF A;  4YZZ A;  4KHZ E;  3RT8 A;  1M5E A;  2QMX A;  3FVO A;  1LCT A;  1R9L A;  3OO6 A;  4DZ1 A;  3KSX A;  4KYD A;  1EZP A;  1IIW A;  2DE2 A;  1GGG A;  4H0W A;  4KCC A;  3IL1 B;  3RYD A;  4JSD A;  1MPB A;  4GWU A;  3SET A;  3JV9 A;  4WXJ A;  4MBP A;  1FTA A;  4NF8 A;  3OOA A;  5LOM A;  4RA1 A;  4ZEK A;  2QVV A;  3I3V A;  1MPC A;  1IME A;  1K9Z A;  2ZXT A;  2F7B A;  1IMB A;  3ZKK A;  2ANJ A;  1B1H A;  3MZ9 A;  2F6G A;  4N07 A;  2QPQ A;  1B58 A;  1ZLQ A;  2O69 A;  3C35 A;  3ISP A;  4FAT A;  2NUV A;  1SBP A;  4YMA A;  3OO7 A;  2XXW A;  2RF1 A;  3AXF A;  5CMC A;  2H9B A;  4Q8R A;  4Q5T A;  3PPQ A;  1LFG A;  2CZL A;  3LBS A;  1BK4 A;  1BLF A;  4ZEI A;  4N8G A;  4MLQ A;  5IM2 A;  1F9B A;  5I59 B;  2XWI A;  3K1P A;  3PMW A;  3PPO A;  4NX1 A;  2QS4 A;  4ZDM A;  5H8S A;  3H3G A;  4QSD A;  1QJM A;  1H44 A;  1LCF A;  1FBD A;  2XWO A;  3L6H A;  3V8X B;  2UYF A;  1N0T A;  4QFO A;  3TTR A;  4ELP A;  2P1S A;  4P8B A;  4DE8 A;  3KC1 A;  4IO3 A;  4O3B A;  2GHB A;  4GQO A;  1NFT A;  5ET8 A;  2KQZ A;  3CVG A;  2FVZ A;  4GRK A;  4I3E A;  4ZS9 A;  4OMB A;  2R8T A;  1QKB A;  2JJK A;  5TPA B;  4RYA A;  4LA9 A;  2O1M A;  3O9P A;  2H99 A;  4H45 A;  1B3E A;  2GQ1 A;  2PVU A;  3CIJ A;  1R6Z A;  1IEJ A;  2HXR A;  4MF3 A;  3T9X B;  2ZNS A;  2UVI A;  3EHU A;  4I40 A;  3SER A;  4M4G A;  4MNC A;  2OLB A;  2VHA A;  1LFH A;  1AMF A;  4EDP A;  4RK9 A;  4OTE A;  1SI1 A;  1TFD A;  5AA4 B;  3G3J A;  3BFT A;  4FBP A;  3CRB A;  3WAF A;  3TFL A;  4NG7 A;  2PMS A;  5L9M A;  3A3C A;  4LZ8 A;  2B65 A;  1MXU A;  3EHT A;  5L8D A;  2VPN A;  1OLC A;  3K6V A;  4OAN A;  4X48 A;  3PMV A;  4OZ9 A;  1NV2 A;  2ZMB A;  2DVZ A;  3O6H A;  3I5O A;  3IB2 A;  1N84 A;  3KG2 A;  1RDX A;  2THI A;  2DXY A;  4H8J A;  1O7T A;  3K6W A;  1SVX B;  4PET A;  4NF5 A;  1MQI A;  3FUZ A;  2QS3 A;  4HS7 A;  4F2Q A;  3KN7 A;  4PF6 A;  4YKK A;  2A5S A;  5I58 A;  1LBB A;  1FQC A;  4G77 A;  1UTB B;  4AQ4 A;  1I6A A;  3LUY A;  5EQ9 A;  1QUL A;  1B5J A;  1Y3N A;  3R6U A;  2CZK A;  4U4X A;  1LB9 A;  1J1N A;  4ELR A;  4PDH A;  3MQ9 A;  3EPE A;  1MH4 A;  5DEX B;  4PFU A;  1SW4 A;  3KZG A;  4FED A;  4OVQ A;  4RJZ A;  2Q88 A;  4F1V A;  3E3K A;  4THI A;  1YYZ A;  5IZ3 A;  2VP1 A;  2X7Q A;  4ZE9 A;  3M8U A;  1NNP A;  5I57 B;  4KYS A;  3S9N C;  1ZKB A;  1P1O A;  5KDT A;  3B6T A;  4BLA A;  1IMD A;  1SQY A;  5ET6 A;  1VFE A;  4FEC A;  4PBH A;  4KCD A;  5AA2 B;  3SKP A;  1PDA A;  1EYI A;  4XKQ A;  1MY2 A;  2F3B A;  4WEP A;  1N76 A;  3KJT A;  1US4 A;  4NF0 A;  3U8Q A;  3HCQ A;  3A3U A;  1H76 A;  3SES A;  3HHG A;  2V3U A;  4QSC A;  2F34 A;  4R2B A;  2ZNU A;  3B6Q A;  2QS2 A;  3V5A A;  1MXW A;  5EQ7 A;  5KCJ B;  5L9S A;  3V89 B;  4GBW A;  1LBX A;  3MW0 A;  5EQ8 A;  2ZZW A;  1JET A;  3LUZ A;  4TLL B;  1P1U A;  3UP9 A;  3EQ1 A;  4EF2 A;  4MHF A;  1HSL A;  3FJ7 A;  4GWY A;  5TP9 A;  4BDL A;  2YPN A;  1USY E;  1NMU A;  1CE2 A;  3IJO B;  4NGU A;  2QL3 A;  4JVC A;  4ZEC A;  3WAE A;  3MZ1 A;  3UIF A;  4YB7 A;  2KR0 A;  4JVD A;  3KFM A;  1TXF A;  1FPI A;  3THI A;  1NL5 A;  1H45 A;  3HST A;  2R9J A;  2VD3 A;  3KEI A;  4Z7E A;  3H6U A;  2A5T B;  3K02 A;  3K2D A;  2NXO A;  2PFZ A;  4BDO A;  4DIG A;  1Q35 A;  5HM4 B;  3IAZ A;  4R75 A;  4GX4 A;  4NF4 B;  4PFT A;  3MC2 A;  1IIT A;  4N8Y A;  3SDF A;  4C1T A;  4I1D A;  3TYH A;  3HN0 A;  5M2V A;  2XXU A;  3GBA A;  1Z7M E;  4IO5 A;  2XX8 A;  1AH5 A;  2FIE A;  4EQB A;  4R6K A;  1XC1 A;  4PGN A;  4XIG Q;  5JTY A;  3G3F A;  3IO6 A;  2M8C A;  4PDD A;  2B3B A;  4R9G A;  1ZIU A;  4OFL A;  4UAC A;  3QUF A;  4PFI A;  1MDP 1;  4XKP A;  3KN3 A;  1BIY A;  2XD3 A;  3MP6 A;  3BIH A;  2RC8 A;  4HTG A;  2V3T A;  5B70 A;  3VV5 A;  3PUV E;  2D5W A;  5I56 A;  4H6D A;  2GFE A;  1AOV A;  3RQT A;  4ND9 A;  3GYY A;  4U21 A;  4UA8 A;  3IX1 A;  3USD A;  4UAB A;  2OJT A;  1JVX A;  4GOT A;  1CB6 A;  2DYX A;  4HE2 A;  5EHS A;  2IEE A;  1MM7 A;  2FA7 A;  2I4B A;  2L5V A;  4E0W A;  4ZZE A;  1NUY A;  1IMC A;  1XS5 A;  3L6G A;  4R73 A;  2PT1 A;  3I6V A;  4PFW A;  1B32 A;  1A40 A;  3IOT A;  3PUZ E;  3M3F A;  2ZZV A;  2XXY A;  4EF1 A;  1Q9D A;  5H8F A;  1Y3Q A;  1Y1M A;  3OMB A;  3TCF A;  4TQU Q;  1JQF A;  3OO9 A;  1SI0 A;  3G3I A;  3U93 A;  1MQH A;  1NUX A;  4C1U A;  2Q8J A;  5IKB A;  2CEX A;  4ZEF A;  3EF7 A;  4JXI A;  3O66 A;  4MCO A;  1UQW A;  4MNI A;  1TWY A;  1XVX A;  3D4C A;  4G61 A;  4MH5 A;  3VLV A;  5IAI A;  1FQF A;  3KGC A;  3D1R A;  3T9V A;  4PF8 A;  3RY3 A;  5CC2 A;  1VE4 A;  3MAM A;  2IA4 A;  4R9F A;  1B52 A;  3QXM A;  4BDR A;  2O6A A;  2REG A;  2CZI A;  4U4S A;  2HXW A;  1Q1K A;  3BBR A;  3GLB A;  2OK2 A;  2ONK E;  2AIX A;  3FXU A;  5EYH A;  1B5I A;  3IOW A;  3RPL B;  1NH7 A;  2XX7 A;  1RKM A;  4H67 A;  2HZL A;  2Z8D A;  2XX9 A;  5CMB A;  1YXI A;  2FHY A;  5EYF A;  2HPG A;  5K2X A;  5LDZ A;  1D3K A;  4JB7 A;  4NAP A;  4R6H A;  4PFR A;  3O28 A;  3C4M A;  4MJO A;  5I2N B;  4PE5 B;  4P0G A;  3MP8 A;  2OX3 A;  1DSN A;  5DYH A;  1H43 A;  1N3X A;  3PUW E;  3H03 A;  1JP4 A;  1QUI A;  2F3D A;  5HBC A;  3OEK A;  3LR1 A;  1CNQ A;  4AS4 A;  3C31 A;  2OWZ A;  1ELJ A;  3EN3 A;  1FCK A;  4QRZ A;  3H6V A;  3E4R A;  3KN8 A;  1MPD A;  4YIC A;  4OER A;  2Y7W A;  4K3F A;  5H8H A;  2Y7K A;  3TTK A;  4QF9 A;  3SEU A;  1OQG A;  2DOJ A;  2I0B A;  2WYK A;  1MQD A;  3FVK A;  1IXH A;  4GFR A;  3C32 A;  3T96 B;  4OVT A;  4LUB A;  5FHN A;  2PX1 A;  3LC8 A;  3M3L A;  1NUW A;  4O7I A;  4OFJ A;  4FEB A;  1FBH A;  1A8F A;  4LZ5 A;  3H06 B;  3PUY E;  3RLF E;  2PFY A;  4P3L A;  4U22 A;  2YLN A;  2XXP A;  3QUJ A;  4XEQ A;  3F11 A;  4KD5 A;  4G68 A;  3ECR A;  1FBC A;  2D21 A;  4L17 A;  4ISU A;  3H4Z A;  3ILT B;  2KLF A;  1QUK A;  2GH9 A;  3SEW A;  4GX3 A;  5FTI A;  3TTM A;  2X26 A;  1NKX A;  4X9T A;  4F19 A;  5L9O A;  1OQH A;  5A5X B;  4F3P A;  2VD2 A;  4O3C A;  3UK4 A;  3BIG A;  2CEY A;  2NWJ A;  1B7U A;  1FQE A;  3ZKL A;  2QVR A;  4NHB A;  4P1E A;  2NVU B;  3KSJ A;  1B2H A;  1LAX A;  2F5X A;  5ET5 A;  3TEL A;  3T9H B;  1IXI A;  4F39 A;  1IQ7 A;  2GHA A;  4MIJ A;  3U65 A;  2RKM A;  3K0V A;  1URD A;  1KZ8 A;  2XXH A;  4I3Y A;  1FPB A;  1LST A;  3OSR A;  2Q74 A;  3KOT A;  4YKI A;  2HZK A;  4MLV A;  3QK6 A;  1QKA A;  2WBB A;  2I3V A;  2ZYK A;  1B9J A;  4U23 A;  3PD8 A;  4OVP A;  1NNF A;  2OWT A;  3GZG A;  2QJE A;  4PC9 A;  1B6H A;  4U2R A;  4WKM A;  4P0I A;  2BJJ X;  3DP8 A;  1B46 A;  1JW5 A;  4H65 A;  3CFX A;  1FQA A;  3HO7 A;  2E1S A;  2XXI A;  1B40 A;  2Q8M A;  4Q0C A;  1PBQ A;  4OWD A;  1US5 A;  4PP0 A;  5IZ1 A;  5CM6 A;  4JDF A;  1RDY A;  1ANF A;  2GRV A;  4POW A;  2F6P A;  2FBP A;  3C34 A;  3UOR A;  4F3B A;  1OIB A;  1LAG E;  1EZO A;  4KI0 E;  4N15 A;  1P99 A;  1NV6 A;  4I62 A;  1B5H A;  5ELV A;  1URS A;  2P3V A;  4QBA A;  4X8R A;  2RC7 A;  3RT6 B;  4ESW A;  1LGB C;  2OCU A;  4RPN A;  3TZA A;  2VT5 A;  2OZZ A;  3T0J A;  5H8Q B;  4GF8 A;  5I3S A;  4FJP A;  5I2K B;  1DMB A;  4N91 A;  2I6E A;  4OFO A;  1UIV A;  3CHG A;  4GXA A;  2LAO A;  1M5C A;  3OSQ A;  2E0S A;  3FV1 A;  3TQL A;  3JZJ A;  3H6T A;  5H8N A;  2R71 A;  3A09 A;  4EQ9 A;  1Z7N E;  1DPE A;  4WED A;  3VXB A;  5AA3 A;  1MRP A;  4GXS B;  3W9W A;  4DCX A;  2H5Y A;  3PV0 E;  1PB9 A;  3Q28 A;  4H8I A;  4GLI A;  4N13 A;  2HCA A;  3TMG A;  2W7Y A;  2DWI A;  3TUS A;  3VFJ A;  1XT8 A;  3OEN A;  4IO6 A;  1VDW A;  4F1Y A;  2D3I A;  1FPK A;  4NF8 B;  1RDZ A;  1HSJ A;  3FVG A;  4OQO A;  4EQ7 A;  3EKI A;  2YJP A;  4ELO A;  4LQ2 A;  3U72 A;  5DW8 A;  4OHN A;  4NF6 A;  4XTC Q;  4IGT A;  3RGY A;  1FPL A;  1LAF E;  2QSX A;  5I7I A;  2O7I A;  3VVE A;  2DWA A;  1SPI A;  3IOU A;  1KA0 A;  3KOS A;  4BDQ A;  3TTL A;  4NE4 A;  1LBW A;  1ZJL A;  4PBQ A;  2F36 A;  3H6W A;  4I9D A;  4DI3 D;  1QUJ A;  1HSE A;  1SDX A;  3IJX B;  4PE3 A;  1Y9U A;  3S9E A;  2AL4 A;  4P47 A;  5DTB A;  4F1U A;  3B6W A;  2X7P A;  2CZH A;  3MP1 A;  2HHM A;  3FGS A;  1YCJ A;  3O6I A;  4GL8 A;  5CBR A;  4PAF A;  3T93 B;  4QFP A;  1FBP A;  4G8N A;  2Z8F A;  2F97 A;  4JBZ A;  4XKN A;  1LFI A;  3QAX A;  3DLN A;  4XF5 A;  3DEL B;  4RPO A;  1RYO A;  4PFY A;  4ZZA A;  2PYY A;  4TOZ A;  1YTV A;  2Y84 A;  1N7W A;  1XOC A;  3E13 X;  4OET A;  1NH8 A;  2O68 A;  4OXV A;  3T66 A;  1NUZ A;  4MX6 A;  2I58 A;  2FNC A;  4JVI A;  4LN5 A;  1FTL A;  4ZE8 A;  3DP4 A;  1QVS A;  3Q26 A;  1D9Y A;  1AL3 A;  1QGX A;  1OVT A;  4O94 A;  3FVN A;  5ITO A;  4ZED A;  4GWX A;  4QSE A;  3U1O A;  4NMY A;  2G93 A;  1FPJ A;  1USY H;  3N26 A;  4H1X A;  4EUO A;  1LAH E;  1MM6 A;  1QW0 A;  4RNS A;  2QVU A;  2ZYO A;  4ESX A;  3TPA A;  3W15 C;  4OVS A;  3M3K A;  2BJI A;  5I59 A;  4BDN A;  2B4L A;  1B1X A;  5BUU A;  1SW2 A;  3R26 A;  4ONY A;  4Z0I A;  2Q9T A;  4ELQ A;  3TKD A;  4R74 A;  3B7D A;  1MXZ A;  2I0C A;  4YB5 A;  1NNT A;  3QYT A;  1TFA A;  3MST A;  4EXK A;  4DI4 B;  2UVJ A;  3IFC A;  1OLA A;  4POX A;  2H25 A;  5AE4 A;  1FRP A;  2Q2A A;  1A7L A;  5I84 A;  1EYJ A;  2XXV A;  3FIR A;  1SYH A;  4N81 A;  4PFB A;  1WOD A;  2Q89 A;  4DDD A;  4NWD A;  1MH3 A;  4F3S A;  3MVY A;  4NF5 B;  4F29 A;  4PAI A;  3CFZ A;  5TPA A;  3V83 A;  3PD9 A;  5I58 B;  1LBV A;  2R6G E;  1LBC A;  4X04 A;  1KA1 A;  2RC9 A;  3G3G A;  1Y3P A;  3K00 A;  4LON B;  4PAK A;  1YPN A;  2Y7P A;  3SEY A;  1GVC A;  4HCW A;  3VVD A;  1DTG A;  3CG3 A;  2ZZX A;  3QSL A;  2UVG A;  4H46 A;  5ET7 A;  3R7X A;  4FIM A;  2XWV A;  2Y7R A;  1NV7 A;  1IMA A;  2Z22 A;  3MPL A;  2XXX A;  3DP6 A;  3KBZ A;  2DWH A;  5AA4 A;  1XI6 A;  3LV0 A;  2V25 A;  3K6U A;  3N6U A;  1FQD A;  5KDT B;  1M5D A;  4HE0 A;  3TCG A;  3TCH A;  5FTH A;  1UTH B;  1I69 A;  1PBP A;  1N7X A;  1ZMG A;  4IO4 A;  1FW0 A;  3FD3 A;  5CBS A;  3O97 A;  3UA8 A;  2B4M A;  3SEV A;  2ZYM A;  5J1D A;  3CI8 A;  1FQB A;  4N4U A;  1B3G A;  4IB2 A;  2WX9 A;  3HFU A;  1EZ9 A;  3C33 A;  4PGP A;  1VR5 A;  3T1B A;  4PCD A;  4N6P A;  5ISU A;  1O63 A;  2XA5 A;  4O8M A;  2ZYN A;  1SW1 A;  1A55 A;  5FHM A;  3ROJ A;  4OVJ A;  4DLD A;  3OO8 A;  4OEV A;  1Y4C A;  5TP9 B;  1UTB A;  4O3A A;  4LZ7 A;  5FBP A;  2OWS A;  1GV8 A;  3PUX E;  1FPE A;  3S9M C;  3TDJ A;  1LBY A;  5DEX A;  5HPQ A;  2PBW A;  4LP2 B;  1ZBM A;  1I6B A;  4OA4 A;  5EQA A;  2Y5K A;  5EYG A;  1FTM A;  3OXN A;  4N17 A;  1MXX A;  1OMP A;  2ZNT A;  3FXB A;  1AWB A;  1B3H A;  3UN6 A;  1VSO A;  1DOT A;  2WEF A;  1R9Q A;  4OES A;  3VXC A;  4YMB A;  5I57 A;  3GBB A;  4RK2 A;  3TOD A;  1FTO A;  3RN8 A;  4NQ8 A;  4MEV A; 
#chains in the Genus database with same CATH homology
 1MY4 A;  1JVY A;  1R1N A;  2H4I A;  3EHS A;  1YAE A;  3IO4 A;  4GD5 A;  1Y1Z A;  3VE1 B;  5AA2 A;  4RXL A;  4U1O A;  5CMM A;  1B4Z A;  2DVC A;  5TU0 A;  2F7C A;  3S9L C;  1D4N A;  5EHM A;  3G3K A;  4JSO A;  1JNF A;  4JWO A;  1P1Q A;  5KCJ A;  1MXY A;  3OEL A;  3TQW A;  5JTY B;  3ONM A;  1B3F A;  3MBP A;  2UYE A;  1RYX A;  1B7H A;  4JWY A;  3U92 A;  1N3W A;  1NNK A;  4E0X A;  3RPW A;  3KBR A;  4AB6 A;  3CSG A;  3CR9 A;  4R72 A;  1B4H A;  3RNN A;  3ODB A;  4KYE A;  2VOZ A;  2RCB A;  5I56 B;  5DVJ A;  2WKY A;  1AIV A;  2FYI A;  4OYV A;  2A5T A;  1JW1 A;  4IY6 A;  2PT2 A;  2VGQ A;  1VFD A;  1LB8 A;  1OVB A;  3VLW A;  1DTZ A;  3S2V A;  3DM0 A;  2O1L A;  3P7I A;  1MS7 A;  3IB0 A;  3RUM A;  2HAV A;  1D9V A;  4G68 C;  4NF4 A;  4DXB A;  2G29 A;  1B7Z A;  3FXQ A;  1MY0 A;  3K1M A;  3C9H A;  4YAH X;  3FAS A;  5H8F B;  4BDM A;  2H98 A;  5FHO A;  3TTN A;  1B51 A;  2DP8 A;  1GTK A;  3HPI A;  1Y20 A;  2XD2 A;  2DE4 A;  4YKJ A;  3T9U A;  1Y4T A;  1T0K A;  4GVO A;  4IO7 A;  3VVF A;  3RTW B;  2O7U A;  5AA1 A;  2F78 A;  1A8E A;  4NWC A;  3OD7 A;  1IXG A;  4JWX A;  4I8C A;  2RIN A;  1B0H A;  4IGR A;  4FAJ A;  2REJ A;  3PPP A;  3CSB A;  4IY5 A;  3PMX A;  1MDQ A;  5DVI A;  2B3F A;  4MFI A;  3Q27 A;  3SEX A;  2QS1 A;  1H3D A;  1MG1 A;  3O2A A;  1B3L A;  2I49 A;  4QFK A;  2V93 A;  4LVQ A;  1SYI A;  1IXC A;  1II5 A;  1ZTY A;  3IOV A;  5CRY A;  1PC3 A;  2I3W A;  4G8M A;  4YKP A;  4RY1 A;  5F1Q A;  2DS9 A;  4OEU A;  4YU0 A;  4F3G A;  1PEB A;  3G7W A;  5H8H B;  1A99 A;  3MVW A;  4NED A;  4F31 B;  2UVH A;  1URG A;  3JYR A;  3FXR A;  3IB1 A;  3PPR A;  4IO2 A;  2CMO A;  3W9V A;  3ZS6 A;  2XXT A;  3HHF A;  5DT6 A;  4NTL A;  1UTH A;  4DXU A;  3IR1 A;  4G4P A;  1WVJ A;  5BWJ A;  3LSX A;  3TAJ A;  3FAT A;  3OEM A;  1ZU0 A;  4G68 B;  1M5B A;  1SD3 A;  3Q25 A;  4X1D A;  3CG1 A;  2V3Q A;  3C36 A;  3MPK A;  2ALU A;  2Q2C A;  5I2N A;  4KPT A;  4KQP A;  5CI5 A;  5KZT A;  3TEP A;  3FJG A;  4HW8 A;  4QFN A;  3MJN A;  3FJM A;  2DWJ A;  1JW4 A;  4YB6 A;  1EU8 A;  3RTF B;  2O84 X;  3O29 A;  4U1Z A;  1KWH A;  5F7V A;  4ECF A;  4P11 A;  3E9X A;  4KR5 A;  5JEI A;  2DE3 A;  1B0L A;  2Z23 A;  3LSW A;  1B05 A;  2DQV A;  3T22 A;  2UXA A;  4QFL A;  2AL5 A;  4Q30 B;  1MQJ A;  1BTJ A;  1JEV A;  2ONR A;  1TT1 A;  1GR2 A;  1IZ1 A;  2QRY A;  1FTJ A;  3ZSF A;  5AA2 D;  1P1N A;  1POY 1;  1S9T A;  5B7D A;  5ICT A;  3G3H A;  3H7M A;  4H5G A;  2RCA A;  3VLU A;  2QMW A;  3IOR A;  2XXQ A;  2HAU A;  1MQG A;  1EH3 A;  3MVZ A;  2HFB A;  1LLS A;  1M5F A;  1PB8 A;  3QIM A;  4XXU A;  2OBG A;  3Q29 A;  3PU5 A;  3CFL A;  5JK4 A;  2F8D A;  3N6T A;  1PB7 A;  4GIZ A;  3IK6 B;  3GXA A;  4HCY A;  5A5X A;  3BKI B;  2Z8E A;  1JEU A;  4X1B A;  4XKR A;  4GWO A;  4ZEB A;  3D4G A;  4PQJ A;  4LQ5 A;  1BP5 A;  4KFQ A;  2XXR A;  1I6Q A;  2I48 A;  2ONS A;  3S4U A;  2P2A A;  3PGF A;  2ABH A;  4C0R A;  1DPP A;  3MVX A;  4DXC A;  1S50 A;  3K6X A;  5CMK A;  3MUQ A;  3K01 A;  2HQ0 A;  4FE8 A;  2P0S A;  4F2O A;  5ITP A;  2I4C A;  2HEU A;  2ESN A;  3UGW A;  1POT A;  4G2Z A;  5H8N B;  2Y7I A;  2O51 A;  3MZB A;  1IUD A;  1FTK A;  4QHQ A;  3KJ7 A;  5ICQ A;  1L5T A;  3HV1 A;  3N5L A;  5K2Y A;  3LSL A;  4M1V A;  1ATG A;  3K1N A;  3BFU A;  5DVF A;  4F18 A;  3MWB A;  4DCY A;  1S7Y A;  1XVY A;  1MY3 A;  4NF6 B;  4TLM B;  2DSF A;  2DXR A;  4F22 A;  1BKA A;  2NOO A;  2XHD A;  2F35 A;  3FZV A;  3LSF B;  1P1W A;  3ILU B;  2AYS A;  1O64 A;  4GL0 A;  1A54 A;  1MXV A;  4H5F A;  3N94 A;  2F7A A;  5H8Q A;  4AB5 A;  4R6Y A;  5I2K A;  3U94 A;  4LAT A;  4G8H A;  4OEN A;  3K4U A;  4FOR A;  3O6G A;  4R2F A;  1XHY A;  1SW5 A;  4EXL A;  3FV2 A;  3PPN A;  1UIU A;  2V84 A;  1N04 A;  1MY1 A;  1WDN A;  3VDF A;  4YZZ A;  4KHZ E;  3RT8 A;  1M5E A;  2QMX A;  3FVO A;  1LCT A;  1R9L A;  3OO6 A;  4DZ1 A;  3KSX A;  4KYD A;  1EZP A;  1IIW A;  2DE2 A;  1GGG A;  4H0W A;  4KCC A;  3IL1 B;  4JSD A;  1MPB A;  3SET A;  3JV9 A;  4WXJ A;  4MBP A;  4NF8 A;  3OOA A;  5LOM A;  4RA1 A;  4ZEK A;  3I3V A;  1MPC A;  2ZXT A;  2F7B A;  3ZKK A;  2ANJ A;  1B1H A;  3MZ9 A;  2F6G A;  4N07 A;  2QPQ A;  1B58 A;  1ZLQ A;  2O69 A;  3C35 A;  4FAT A;  2NUV A;  1SBP A;  4YMA A;  3OO7 A;  2XXW A;  2RF1 A;  3AXF A;  5CMC A;  2H9B A;  4Q8R A;  4Q5T A;  3PPQ A;  1LFG A;  2CZL A;  3LBS A;  1BLF A;  4ZEI A;  4MLQ A;  1F9B A;  5I59 B;  3K1P A;  3PMW A;  3PPO A;  2QS4 A;  4ZDM A;  5H8S A;  3H3G A;  4QSD A;  1QJM A;  1H44 A;  1LCF A;  3L6H A;  3V8X B;  2UYF A;  1N0T A;  4QFO A;  3TTR A;  4ELP A;  2P1S A;  4DE8 A;  4IO3 A;  4O3B A;  2GHB A;  4GQO A;  1NFT A;  3CVG A;  4GRK A;  4ZS9 A;  4OMB A;  1QKB A;  5TPA B;  4RYA A;  4LA9 A;  2O1M A;  3O9P A;  2H99 A;  1B3E A;  2PVU A;  3CIJ A;  1R6Z A;  1IEJ A;  4MF3 A;  3T9X B;  2ZNS A;  2UVI A;  3EHU A;  3SER A;  4M4G A;  2OLB A;  2VHA A;  1LFH A;  1AMF A;  4EDP A;  4RK9 A;  4OTE A;  1SI1 A;  1TFD A;  5AA4 B;  3G3J A;  3BFT A;  3CRB A;  3WAF A;  3TFL A;  2PMS A;  5L9M A;  3A3C A;  4LZ8 A;  2B65 A;  1MXU A;  3EHT A;  5L8D A;  1OLC A;  3K6V A;  4X48 A;  3PMV A;  4OZ9 A;  2ZMB A;  2DVZ A;  3O6H A;  3I5O A;  3IB2 A;  1N84 A;  3KG2 A;  2THI A;  2DXY A;  4H8J A;  1O7T A;  3K6W A;  1SVX B;  4PET A;  4NF5 A;  1MQI A;  3FUZ A;  2QS3 A;  4HS7 A;  4F2Q A;  3KN7 A;  4YKK A;  2A5S A;  5I58 A;  1LBB A;  1FQC A;  4G77 A;  1UTB B;  4AQ4 A;  1I6A A;  3LUY A;  1QUL A;  1B5J A;  1Y3N A;  3R6U A;  4U4X A;  1LB9 A;  1J1N A;  4ELR A;  3MQ9 A;  3EPE A;  1MH4 A;  5DEX B;  4PFU A;  1SW4 A;  3KZG A;  4FED A;  4RJZ A;  2Q88 A;  4F1V A;  3E3K A;  4THI A;  2VP1 A;  2X7Q A;  4ZE9 A;  3M8U A;  1NNP A;  5I57 B;  4KYS A;  3S9N C;  1ZKB A;  1P1O A;  5KDT A;  3B6T A;  4BLA A;  1SQY A;  1VFE A;  4FEC A;  4KCD A;  5AA2 B;  3SKP A;  1PDA A;  4XKQ A;  1MY2 A;  4WEP A;  1N76 A;  3KJT A;  1US4 A;  3U8Q A;  3HCQ A;  3A3U A;  1H76 A;  3SES A;  3HHG A;  2V3U A;  4QSC A;  2F34 A;  4R2B A;  2ZNU A;  3B6Q A;  2QS2 A;  3V5A A;  1MXW A;  5KCJ B;  5L9S A;  3V89 B;  3MW0 A;  1JET A;  4TLL B;  1P1U A;  3UP9 A;  3EQ1 A;  4EF2 A;  1HSL A;  3FJ7 A;  5TP9 A;  4BDL A;  2YPN A;  1USY E;  1NMU A;  1CE2 A;  3IJO B;  2QL3 A;  4ZEC A;  3WAE A;  3MZ1 A;  3UIF A;  4YB7 A;  3KFM A;  1TXF A;  3THI A;  1NL5 A;  1H45 A;  3HST A;  2R9J A;  2VD3 A;  3KEI A;  4Z7E A;  3H6U A;  2A5T B;  3K02 A;  3K2D A;  2NXO A;  4BDO A;  4DIG A;  1Q35 A;  5HM4 B;  3IAZ A;  4R75 A;  4NF4 B;  4PFT A;  3MC2 A;  1IIT A;  3SDF A;  4C1T A;  4I1D A;  3TYH A;  3HN0 A;  5M2V A;  2XXU A;  3GBA A;  1Z7M E;  4IO5 A;  2XX8 A;  1AH5 A;  4EQB A;  4R6K A;  1XC1 A;  4XIG Q;  5JTY A;  3G3F A;  3IO6 A;  2M8C A;  2B3B A;  4R9G A;  1ZIU A;  4OFL A;  4UAC A;  3QUF A;  1MDP 1;  4XKP A;  3KN3 A;  1BIY A;  2XD3 A;  3MP6 A;  2RC8 A;  4HTG A;  2V3T A;  5B70 A;  3VV5 A;  3PUV E;  2D5W A;  5I56 A;  4H6D A;  2GFE A;  1AOV A;  3RQT A;  4ND9 A;  4U21 A;  4UA8 A;  3IX1 A;  3USD A;  2OJT A;  1JVX A;  4GOT A;  1CB6 A;  2DYX A;  5EHS A;  2IEE A;  1MM7 A;  2FA7 A;  2I4B A;  4E0W A;  4ZZE A;  1XS5 A;  3L6G A;  4R73 A;  2PT1 A;  3I6V A;  4PFW A;  1B32 A;  1A40 A;  3IOT A;  3PUZ E;  3M3F A;  2XXY A;  4EF1 A;  5H8F A;  1Y3Q A;  1Y1M A;  3OMB A;  3TCF A;  4TQU Q;  1JQF A;  3OO9 A;  1SI0 A;  3G3I A;  3U93 A;  1MQH A;  4C1U A;  2Q8J A;  5IKB A;  4ZEF A;  3EF7 A;  4JXI A;  3O66 A;  1UQW A;  1TWY A;  1XVX A;  3D4C A;  4MH5 A;  3VLV A;  5IAI A;  1FQF A;  3KGC A;  3T9V A;  3RY3 A;  5CC2 A;  1VE4 A;  3MAM A;  2IA4 A;  4R9F A;  1B52 A;  3QXM A;  4BDR A;  2O6A A;  2REG A;  4U4S A;  2HXW A;  1Q1K A;  3BBR A;  3GLB A;  2OK2 A;  2ONK E;  2AIX A;  3FXU A;  1B5I A;  3IOW A;  1NH7 A;  2XX7 A;  1RKM A;  4H67 A;  2HZL A;  2Z8D A;  2XX9 A;  5CMB A;  5EYF A;  5K2X A;  1D3K A;  4JB7 A;  4R6H A;  3O28 A;  3C4M A;  5I2N B;  4PE5 B;  4P0G A;  3MP8 A;  1DSN A;  5DYH A;  1H43 A;  1N3X A;  3PUW E;  3H03 A;  1QUI A;  5HBC A;  3OEK A;  3LR1 A;  3C31 A;  1ELJ A;  3EN3 A;  1FCK A;  4QRZ A;  3H6V A;  3E4R A;  3KN8 A;  1MPD A;  4YIC A;  4OER A;  2Y7W A;  4K3F A;  5H8H A;  2Y7K A;  3TTK A;  4QF9 A;  3SEU A;  1OQG A;  2DOJ A;  2I0B A;  1MQD A;  3FVK A;  1IXH A;  4GFR A;  3C32 A;  3T96 B;  4LUB A;  5FHN A;  2PX1 A;  3LC8 A;  3M3L A;  4OFJ A;  4FEB A;  1A8F A;  4LZ5 A;  3H06 B;  3PUY E;  3RLF E;  4U22 A;  2YLN A;  2XXP A;  3QUJ A;  3F11 A;  4KD5 A;  4G68 A;  3ECR A;  2D21 A;  4L17 A;  4ISU A;  3H4Z A;  3ILT B;  2KLF A;  1QUK A;  2GH9 A;  3SEW A;  5FTI A;  3TTM A;  2X26 A;  1NKX A;  4X9T A;  4F19 A;  5L9O A;  1OQH A;  5A5X B;  4F3P A;  2VD2 A;  4O3C A;  3UK4 A;  2NWJ A;  1B7U A;  3ZKL A;  1FQE A;  2NVU B;  3KSJ A;  1B2H A;  1LAX A;  2F5X A;  3TEL A;  3T9H B;  1IXI A;  4F39 A;  1IQ7 A;  2GHA A;  2RKM A;  3K0V A;  1URD A;  2XXH A;  1LST A;  3OSR A;  3KOT A;  4YKI A;  2HZK A;  4MLV A;  3QK6 A;  1QKA A;  2I3V A;  2ZYK A;  1B9J A;  4U23 A;  3PD8 A;  1NNF A;  2OWT A;  3GZG A;  2QJE A;  1B6H A;  4U2R A;  4WKM A;  4P0I A;  2BJJ X;  3DP8 A;  1B46 A;  1JW5 A;  4H65 A;  3CFX A;  1FQA A;  3HO7 A;  2E1S A;  2XXI A;  1B40 A;  4Q0C A;  1PBQ A;  4OWD A;  1US5 A;  4PP0 A;  5CM6 A;  4JDF A;  1ANF A;  2GRV A;  2F6P A;  4POW A;  3C34 A;  3UOR A;  4F3B A;  1OIB A;  1LAG E;  1EZO A;  4KI0 E;  1P99 A;  4I62 A;  1B5H A;  5ELV A;  1URS A;  2RC7 A;  3RT6 B;  4ESW A;  1LGB C;  2OCU A;  4RPN A;  3TZA A;  2OZZ A;  5H8Q B;  4GF8 A;  4FJP A;  5I2K B;  1DMB A;  2I6E A;  4OFO A;  1UIV A;  4GXA A;  2LAO A;  1M5C A;  3OSQ A;  2E0S A;  3FV1 A;  3TQL A;  3JZJ A;  3H6T A;  5H8N A;  2R71 A;  3A09 A;  4EQ9 A;  1Z7N E;  1DPE A;  4WED A;  3VXB A;  5AA3 A;  1MRP A;  4GXS B;  3W9W A;  4DCX A;  2H5Y A;  3PV0 E;  1PB9 A;  3Q28 A;  4H8I A;  4GLI A;  4N13 A;  2HCA A;  3TMG A;  2W7Y A;  2DWI A;  3TUS A;  3VFJ A;  1XT8 A;  3OEN A;  4IO6 A;  4F1Y A;  2D3I A;  4NF8 B;  1HSJ A;  3FVG A;  4OQO A;  4EQ7 A;  2YJP A;  4ELO A;  4LQ2 A;  3U72 A;  4OHN A;  4NF6 A;  4XTC Q;  4IGT A;  3RGY A;  1LAF E;  2QSX A;  2O7I A;  3VVE A;  2DWA A;  3IOU A;  3KOS A;  4BDQ A;  3TTL A;  4NE4 A;  1ZJL A;  2F36 A;  3H6W A;  4I9D A;  1QUJ A;  1HSE A;  1SDX A;  3IJX B;  1Y9U A;  3S9E A;  2AL4 A;  5DTB A;  4F1U A;  3B6W A;  2X7P A;  3MP1 A;  3FGS A;  1YCJ A;  3O6I A;  4GL8 A;  5CBR A;  3T93 B;  4QFP A;  4G8N A;  2Z8F A;  2F97 A;  4JBZ A;  4XKN A;  1LFI A;  3QAX A;  3DLN A;  3DEL B;  4RPO A;  1RYO A;  4PFY A;  4ZZA A;  2PYY A;  4TOZ A;  1YTV A;  2Y84 A;  1N7W A;  1XOC A;  3E13 X;  4OET A;  1NH8 A;  2O68 A;  4OXV A;  3T66 A;  2I58 A;  2FNC A;  1FTL A;  4ZE8 A;  3DP4 A;  1QVS A;  3Q26 A;  1D9Y A;  1AL3 A;  1OVT A;  3FVN A;  5ITO A;  4ZED A;  4QSE A;  3U1O A;  4NMY A;  2G93 A;  1USY H;  3N26 A;  4H1X A;  4EUO A;  1LAH E;  1MM6 A;  1QW0 A;  4RNS A;  2ZYO A;  4ESX A;  3TPA A;  3W15 C;  3M3K A;  5I59 A;  4BDN A;  1B1X A;  5BUU A;  1SW2 A;  3R26 A;  4ONY A;  4Z0I A;  2Q9T A;  4ELQ A;  3TKD A;  4R74 A;  3B7D A;  1MXZ A;  2I0C A;  4YB5 A;  1NNT A;  3QYT A;  1TFA A;  4EXK A;  2UVJ A;  1OLA A;  4POX A;  2H25 A;  5AE4 A;  2Q2A A;  1A7L A;  5I84 A;  2XXV A;  3FIR A;  1SYH A;  1WOD A;  2Q89 A;  4DDD A;  4NWD A;  1MH3 A;  4F3S A;  3MVY A;  4NF5 B;  4F29 A;  3CFZ A;  5TPA A;  3V83 A;  3PD9 A;  5I58 B;  2R6G E;  1LBC A;  2RC9 A;  3G3G A;  1Y3P A;  3K00 A;  4LON B;  1YPN A;  2Y7P A;  3SEY A;  1GVC A;  4HCW A;  3VVD A;  1DTG A;  3CG3 A;  3QSL A;  2UVG A;  3R7X A;  4FIM A;  2Y7R A;  2Z22 A;  3MPL A;  2XXX A;  3DP6 A;  2DWH A;  5AA4 A;  2V25 A;  3K6U A;  3N6U A;  1FQD A;  5KDT B;  1M5D A;  3TCG A;  3TCH A;  5FTH A;  1UTH B;  1I69 A;  1PBP A;  1N7X A;  1ZMG A;  4IO4 A;  1FW0 A;  3FD3 A;  5CBS A;  3O97 A;  3UA8 A;  3SEV A;  2ZYM A;  5J1D A;  3CI8 A;  1FQB A;  1B3G A;  4IB2 A;  1EZ9 A;  3C33 A;  1VR5 A;  4N6P A;  5ISU A;  1O63 A;  2ZYN A;  1SW1 A;  1A55 A;  5FHM A;  4OVJ A;  4DLD A;  3OO8 A;  4OEV A;  1Y4C A;  5TP9 B;  1UTB A;  4O3A A;  4LZ7 A;  2OWS A;  1GV8 A;  3PUX E;  3S9M C;  3TDJ A;  5DEX A;  5HPQ A;  2PBW A;  4LP2 B;  1ZBM A;  1I6B A;  1FTM A;  3OXN A;  1MXX A;  1OMP A;  2ZNT A;  1B3H A;  3UN6 A;  1VSO A;  1DOT A;  1R9Q A;  4OES A;  3VXC A;  4YMB A;  5I57 A;  3GBB A;  4RK2 A;  3TOD A;  1FTO A;  3RN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...