2RCEA

Dfp modified degs delta pdz
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
215
structure length
204
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRTGRQNFLQTDASINHGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title DFP modified DegS delta PDZ
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 43
structure length 204
sequence length 215
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rceA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rceA02
3LJJA 1O2GH 2AMQA 1ANBA 3VFEA 3P6ZB 1G3DA 2PSXA 4MNYA 1P2OA 2FOBA 3ITIA 5AFYH 3RMLH 1C1VH 1V2RT 2WPLS 3E8LA 5FXLA 3VPKA 1O3MA 1NO9H 2SGPE 4ZKRU 2GGVB 1J16A 2AIQA 3QGNB 1DPOA 1FY4A 1QRZA 1KLIH 3KF2A 4Y8XA 1SFQB 1D3QB 3AW1A 3VB7A 3NZIA 2HRVA 1UCYH 3E3TA 3SGQE 1TX6A 1K2I1 1WTHD 3ZVDA 5C67A 1SGDE 2BLWA 3T25A 2AFQB 1P2IA 1DANH 1SQAA 1TNKA 1QL8A 1GMDG 3A7ZA 5DPAA 1QBOA 2FOMB 1GVLA 1O2HA 2OC8A 5JBTA 1THSH 1KXEA 1GCTB 4WVPE 3QGJA 2FO9A 1HIAA 3UPEA 4YZUA 2FM2A 1SLVB 2OD3B 3GDSA 4X1RU 1C2JA 4R0IA 3RXHA 5C3NA 1BMLA 2GCTC 2ODQA 4GCHF 4ABIA 1E35B 1S5SA 2O9QA 2QCYA 4X1NU 5DK1A 5DP5A 2WPMS 1ELCA 2QYIA 3MU4A 3VGCC 2SGAA 5AFZH 1C1RA 3SV2H 2VIVA 1QFKH 2CV3A 3SV6A 1MTUA 1YF4A 3SQEE 1PPHE 1UVSH 1GJ5H 3GCHC 5ESBA 2XC0A 3SI4H 3UNRA 1ELGA 1O2TA 1SBWA 1IQHA 2ZPSA 3RP2A 3A82A 2P8OC 1HXFH 4CRCA 2UUJB 3RXEA 4YOGA 2A0QB 3MH5A 1EJMA 4INLA 2A31A 2M5TA 2WPIS 1LVMA 2EA3A 1P02A 1A5GH 4GHQA 1CHOF 1SGQE 1C9PA 3MWIU 4MDSA 3ZZAA 3ZVEA 3SU6A 4ABHA 4BNRA 1FI8A 3RU4E 4IMZA 1VCWA 1V2VT 1DS2E 3PMJA 5CHAB 3TLOA 3MH4A 2GP9B 1FJSA 2AGIX 3HPTB 1EAXA 1MQ5A 1P9SA 1KSNA 2EI6A 1GBFA 3FZDA 2A7CA 3M3TA 1O3CA 2WPKS 4NCYA 3UWJH 1IQNA 1H9LB 1UCYK 2ZG0H 1T8NA 1O2IA 2OLGA 2OC1A 2ZTYA 1C5SA 1X7AC 4B2AA 1C5UA 4K5ZA 1C2FA 1BMNH 5EPYA 2BX4A 3MNCA 3MU1A 1GHXH 2A5AA 2BDGA 4MPXA 1GBLA 4NGAH 1RJXB 2ALVA 2C3SA 3RLWH 1TBQH 1EAWA 2BDYA 1QRXA 2WUBA 2BOHB 8ESTE 1MKWH 1EJNA 4AORA 2AIPA 2J4IA 1GI8B 2P93A 2CXVA 1DT2A 3P8GA 3D62A 3NKKA 4ZUHA 3TNSA 3QZRA 2BVSH 2ANYA 1MAYA 5K7RA 2ZNKH 1PYTC 5E0HA 1TNIA 1LQDB 1LPKB 4WXVA 2VIPA 1H9HE 1WSSH 1V2KT 1LHEH 1O2YA 1RRKA 2GZ9A 1RXPA 5GCHG 2PWXA 2A2XH 2CF9H 4ABDA 4Q7ZA 1GDNA 3TGKE 1QNJA 4JZEH 4FUFA 1GHAG 1K1IA 1GBMA 3BG8A 3PLPA 1ZSKA 1EOJA 2A1DB 3UFAA 1BITA 4ABFA 1EAUA 2Y5GA 3BTFE 1EKBB 2A32A 4WJG2 1MZDA 4DIIH 2THFB 1SQTA 1GJAB 2FP7B 1AKSA 2BDAA 1DSUA 4XDEA 1P2JA 1GBIA 1DWBH 5CE1A 2YNAA 4JZDH 3ZV9A 2AMDA 3O8DA 4LK4A 1TA2A 4X6NA 2ZHEH 4NZQA 3RDZA 3LGYA 1YP9A 4IC5A 1O5AB 3P8OA 1B0EA 2XW9A 1V2LT 4AG2A 1NN6A 1QA0A 1BUIA 2Y6TA 3GY5A 4ZKNU 1SL3A 2RG3A 1NFUA 3S0NA 1FPCH 1J8AA 4Y8YA 3EQ0H 1E38B 4AB8A 1GWAA 1MQ6A 1SPJA 4D7GA 3U1IB 4MNXA 4UFEH 4CHAC 3A8AA 2RCEA 1GBEA 2IPHA 2PGQB 4ESTE 1B7XB 3JZ2B 5C5OA 1MKWK 1SGFA 2ZKSA 4DY7B 4SGAE 1SHHB 1AVGH 3UY9A 1LVOA 2WPJS 1KY9A 2A4RA 2VVUA 1KXFA 1KXDA 2ZPRA 3EA8A 3TPIZ 4B74A 2H2ZA 4LXBH 1TX8A 4AX9H 2O8UA 2TBSA 3GY3A 2FESH 1ANEA 1P2KA 3AVZA 1VITG 1DSTA 1KTSB 4GSOA 3TK9A 5CMXH 2ZHFH 5L2YH 1BTUA 3HGNA 2F91A 3EGKH 2FTMA 2FI5E 2SNVA 3I29A 2O8MA 1NTPA 4IN1A 4OGXA 1TWXB 3FP6E 4AN7A 1YPHE 3Q3KA 3P70B 4NIWA 1UHBB 1D4PB 5BPEA 4BAQB 3ATWA 2VU8E 1QB9A 1O5FH 1C2IA 1L0ZA 1W12U 2ZWLH 2F83A 1CGHA 3FVFB 1G36A 1JIRA 3VGCB 2H9HA 2C8YB 1HJ8A 3QN7A 5C20A 2FIRH 2B5TB 1CU1A 2WUCA 3R3GB 3QTVH 3MMGA 3RC6A 2FYQA 1O3BA 4I7YH 5DKMA 1BBRE 3QTOH 1E0FD 4NSVA 1FY8E 3RC4A 2P3FH 3TITA 1SSXA 1DLKB 4DG4A 1HAVB 2B7DH 3E0PB 1ZGVA 1OWDA 1C1NA 4X8TH 3N7OA 3SQHE 2Y81A 3F1SB 1T32A 1YPJH 3B23B 1L1NA 1FN6A 3A80A 3BN9A 1O2XA 2R3YA 3H5CB 1QJ6B 2BDBA 4Q7XA 1FAXA 2I6SA 4O9VA 3NCLA 2ZCKP 1O2WA 1F0SA 3A83A 1PPCE 1TGCA 3VEQB 2QV1A 3BTTE 1A3BH 5F03A 3NXPA 2AH4X 1LDTT 1BTZA 1GG6B 2F9NA 3A84A 2WPHS 3A8CA 1ACBE 1AUJA 1TPPA 4Y71A 2NWNA 1GJ9B 3RXTA 4OS4A 3RM0H 5LGOA 2VWMA 5K0HA 1TPAE 1O39A 3OX7U 4XSKU 3RXIA 2Q1JA 3FAOA 4MNVA 1Z8RA 2PKAA 3MNSA 4NIVA 3ZYEA 1HAZB 1RTFB 3WY8A 1TFXA 2LNCA 2FOFA 4INKA 3IWMA 5FBEA 1S6HA 1AFQC 4AFSA 1ELFA 2JETB 5DP4A 4Y10E 4I32A 1AB9B 2GT7A 4X8SH 3VB3A 3UQOA 5GPIB 3SUGA 3QLPH 2GZ8A 1CA0C 4UFFH 5HM2A 1BRCE 2STAE 1S6FA 5E2PA 1Z71A 2BD7A 2HPQH 1NU7B 2AGGX 1D3DB 2FI3E 5DP3A 1UMAH 3BIVH 4JMYA 3A8BA 2Q6FA 5A8ZA 1AMHA 1NRPH 1NT1A 4XFQA 1P05A 2CMYA 3SV7A 1GI6A 1G3BA 1AIXH 1C9TA 5F8TA 1P01A 1A7SA 2OCVB 2JH5D 2NU0E 1Z1JA 2ZFFH 4TY6A 1GL1A 3PV4A 3CP7A 2OBQA 3ZV8A 1O36A 2WYJA 3BTWE 3KGPA 1O5DH 1EZXC 1SG8B 4OGYA 1ABJH 2TGDA 4NFFA 2W7UA 1WQSA 1G3EA 1DY9A 4MPWA 1FY3A 3PO1C 2Z3CA 1DOJA 1TNHA 4MPUA 1O3IA 4HZHA 4MNWA 3UIRA 5GDSH 1HGTH 4UD9H 4D9RA 2F9BH 5LH8A 2G81E 1MTNB 2J95A 5A8YA 3C27B 1TQ7B 4H6SB 1HV7A 1FPHH 1VITH 1H4WA 1JRTA 2F9PA 2VH6A 5TJXA 4I8GA 5HGGA 1IQEA 4TPIZ 1AU8A 3ODFA 2BQWB 2AYWA 2RA3A 1AI8H 1ZJDA 1SLWB 3GOVB 3U9AH 5AVDA 3MOCA 7LPRA 1E36B 4BTUB 4A1TA 1EATA 1BHXF 2FOAA 4INHA 1HAOH 1C5XB 1EAIA 3RC5A 1S81A 2YNBA 4K1TA 1EZQA 3CENA 3SU0A 4CRFA 5FX5A 1YC0A 4KTUA 3URCA 3TH4H 1AUTC 3AAVA 1O2MA 1TAWA 1KXBA 2QXIA 1GBCA 2QXHA 3GCNA 1A2CH 4I8HA 3GDVA 2W3IA 6GCHG 5DG6A 2G55A 1NZQH 1EPTA 1TABE 3M37A 3RXVA 1W0ZU 1XUHA 2XYAA 1AZ8A 1YCPH 1JWTA 1T31A 2VINA 5E8EH 2WV4A 1O35A 4BAHB 1E37B 2ZHQH 4DT7B 4XE4A 1YLDA 2R2MB 3BV9B 1V2ST 1N8OC 1MMJN 1MU8B 4X0WU 3SGBE 1VCPA 1QL9A 3TK5A 3Q76A 1QR3E 3RMNH 5SGAE 1C2MA 2ZFQH 1K28D 1HRTH 1XX9A 3KIDU 3S9AA 1ELEE 4HFPB 1DITH 4B1TA 2RA0A 4JK6A 1QJ1B 2GX4A 1XKBC 3S7KB 2IOTA 2Z3DA 1W7GH 3RU4D 3PMAB 5PTPA 4FU9A 1WV7H 2VGCC 4ZKOU 1A3EH 4AB9A 5FX6A 2CGAA 4X6OA 5GJ4B 4ZKSU 2FS9A 1O33A 1ZHMA 3NWUA 1DUAA 3LH3A 1IQFA 7ESTE 2O8TA 3H7TA 4NA7A 1A5IA 1F5RA 2ZTXA 2Z7FE 1CHGA 4AGKA 1MAXA 1O3PB 2XC4A 5EQSA 2GV6A 3FZZA 4BTIB 3BEUA 2H5CA 2HPPH 1S0QA 4B73A 2P95A 1BTHH 2W5EA 2XCFA 3ZVCA 1RD3B 1B0FA 4TWWA 1PJPA 1QQUA 2H9EH 1O2KA 1GBDA 3NUMA 4Z0KA 1C5QA 3RXCA 2WV5A 2BDCA 3RMOH 1P0SH 4E7NA 1Y3XA 1OWEA 1G9IE 3MYWA 5JB8S 1IQKA 4FUEA 1QY6A 5EQRA 4D76A 1TYNA 1AE5A 4WWYA 1VR1H 2ZZUH 4I8JA 3V3MA 1QB1A 4VGCB 1DWEH 3KL6A 1AE8H 6CHAC 1VGCC 3KQBA 1TIOA 1FQ3A 1ETRH 2TPIZ 1TBZH 4A1VA 2BXTH 1HFDA 1BMAA 2A4OA 4IN2A 4NFEA 1MU6B 3PLKA 2BD5A 1XVOA 2B9LA 1ABIH 2ZDLA 3VXEH 1SHYA 1UK4A 4CRGA 5EXMA 1QQ4A 1T8MA 1GHAF 4TYDA 5DP7A 1GBTA 1XVMA 2A5KA 2QF0A 4O3TA 3PTNA 1BZXE 1GBAA 1CBWC 2ZEBA 1UK2A 1RGQA 5GXPA 1YPKH 3P92A 1BB0B 4FVBA 4FUJA 3GDUA 1W7XH 1BDAA 4YM9A 1P04A 1ELTA 1N6YA 2ZU3A 2UWLA 1QCPA 1PQ7A 2VWNA 2OC0A 2UWPA 4DURA 2XBWA 3PYHA 3L33A 5E2OA 1TA6A 4IMQA 3F9HA 1DXWA 1FAKH 2SNWA 3RXQA 1Z8GA 2XTTB 1ZHPA 5T6FA 3TJNA 3ZZDA 4D9QA 5DP8A 5A8XA 1HJAB 4BAKB 1BRUP 2BZAA 1HXEH 2OQ5A 1KTTB 1GBJA 1HLTH 4U2WA 1XUKA 3AW0A 3K65B 2BY7X 1HPGA 3SU1A 2BHGA 1AY6H 3W94A 3T2NA 1FN8A 2FODA 1H9IE 1A0HB 1UTNA 4LZ4B 1OOKB 2FS8A 1T4UH 1C5YB 3OTJE 4X2VA 3M5NA 1GVZA 3ESTA 4Y7BA 2NU2E 4J1YA 2DE8A 1LVYA 3I78A 2F3CE 4YLQH 3RXAA 1DX5M 2O8WA 2BMGB 1THPB 2NU4E 3HKJB 2ZHDA 1MBQA 1PPFE 3H7OA 4WMEA 1K1MA 5EU8A 5T6GA 1C1MA 3SNEA 1G3CA 1H8IH 3KCGH 5LPRA 3K2UA 1GPZA 4NA9H 3ZVGA 1FNIA 2R2WU 1O5CB 1GBHA 1VJ9U 1ESTA 4FXGH 1EZUC 1GDUA 1GJCB 1OSSA 3LDXH 3SNDA 4BANB 2F9OA 2ZGCA 1O3DA 4CH2B 1Y59T 1TALA 2RDLA 3GCOA 5JBCS 1V2MT 2D26C 3UNQA 1C1OA 1RFNA 3BIUH 3TIUA 3GY4A 2FWWA 2AEIH 1HAXB 2BVRH 1XUFA 3ATKA 1TMTH 2ANKH 1SMFE 1DWCH 4TWYA 1PPBH 2BY5X 1LKAA 2A5IA 5J4QA 3O8BA 3A7WA 2V3OH 4OS1A 1EJAA 3LJOA 1TGSZ 3ODDA 1TRNA 3ATIA 3KQDA 1ZMLA 4AZ2B 8GCHG 4CR5A 1N8OB 1W3CA 1ZZZA 1ZPBA 4GUXA 2R0LA 1Z1IA 3VB4A 2XRCA 4Q7YA 2A45B 1XUIA 2P94A 1O2UA 5JB9S 4AG1A 5B6OA 2W3KA 1ORFA 2Y80A 2ZF0H 4GCHG 5T3HA 1XMNB 3E6PH 4CBNA 1GVKB 1GHBG 1A5HA 1GGDC 1P9UA 3RLYH 4TY7A 2QC2A 1UTPA 2FMJA 3KHVA 3LGVA 7GCHF 1ZYOA 1MCTA 5A2MH 1QIXB 1F5KU 3P95A 1MD8A 1AWFH 3RU4T 2XWAA 1TNLA 3TNTA 2OUAA 3TK6A 4H4FA 1TLDA 1J17T 1LCYA 1NFWA 3EE0B 4DIHH 1L4ZA 2GTBA 5EW2H 1UTOA 2W26A 5HXFA 3PTBA 1ARCA 1V2WT 1WOFA 3RXFA 1CT2E 1N1LA 3R0FA 3M5OA 3T26A 3ATMA 4SGBE 1EP6A 2SGFE 4X1PU 3T5FH 4X8UH 5L6NH 1LTOA 2ULLA 4FUGA 1BQYA 1OP2A 3NK8A 4BAOB 1UTJA 1AVXA 3CS0A 4IW4E 4OS6A 1P3EA 1EX3A 1GJ6A 1SGTA 2AGEX 3LC3A 1GI0A 1NM6A 3O8RA 4WMFA 4FUDA 1P8VC 3LT3A 1OYTH 5C2ZA 5JBAS 3RXPA 2PKSC 1FY5A 1Z7KA 4RSPA 4DW2U 2DUCA 2FOHA 1AN1E 1FONA 1O32A 4B76A 5LPFA 2LPRA 1YBWA 4YTAA 1O2OA 2UUKB 1GI2A 2PTNA 2XNIA 1LPGB 1IHTH 1VGCB 5I46H 3TH3H 4FUCA 1PQ5A 2V6NA 3C1KA 5LPEA 2UUYA 4NG9H 4GAWA 1W13U 1WAYB 2I6QA 3EAJA 2GCTB 1TE0A 1TRMA 2ZP0H 1Z8JB 3SUFA 1D9IA 5C1XA 1C1WH 4MTBA 4YLUA 2ZGHA 4DOQA 1F0TA 1JIMA 5C5NA 3UR6A 3T28A 1O2SA 1ELVA 3SU3A 3BTEE 1ARBA 3B9FH 8KME2 4MG3A 1P3CA 2OC7A 5DJ7A 3LGUA 3ZZ9A 3GCHB 2BD4A 5HMAA 5HM9A 4I8LA 4XOJA 1AZZA 4MQAA 4I31A 2ANWA 1T4VH 1QRWA 2FTLE 3ZVAA 2P8OB 3GICB 5EXLA 4ABEA 2ZGXH 1EB2A 2BD2A 1UVOA 1RTLA 4K60A 1YKTA 1MBMA 4NWLA 2ZDKA 5AF9H 1EQ9A 2FPZA 3GCTG 3V0XA 1TMBH 1GI4A 1QB6A 2GDDA 1SVPA 3UUZA 2G5NA 1OX1A 3PMBB 3RMMH 1KLJH 3K6YA 3SJ9A 2QIQA 2ZDAH 1O2JA 4IS5A 2CN0H 4ZXYH 1C2HA 1PYTD 1HNEE 3LC5A 1FIZA 3A81A 2C4FH 1T8OA 2FI4E 1MD7A 4E06H 1OWIA 3Q3YA 1LMWB 2XBXA 1OWKA 3MO6A 4Y8ZA 2V3HH 2VVCA 3BTKE 3PROA 3EDXB 5G4BA 3ZVFA 1ZTKA 1PFXC 3UNSA 1O2ZA 1FV9A 1HBTH 3RXUA 2ZO3H 3KEEA 1YPLH 3STJA 1P10A 2VWLA 3LIWA 3BEFB 1TGNA 2Q6GA 3RXMA 1C2KA 4U01A 4WXIA 3DHKH 1M9UA 1NU9A 1NRSH 5FPYA 1G2LA 1Y3VA 3T27A 1V2UT 6GCHF 1LHGH 1OPHB 1O3GA 2NU1E 5ETXA 5EXNA 2OINA 2VH0A 5DGJA 4JYTA 1YGCH 1EPTC 5EGMA 4K1SA 2PFEA 1NPMA 1YCPM 4F49A 2R3UA 2ZECA 5IDKA 4A1XA 4CBOA 4X8VH 1AQ7A 3SNBA 4B75A 4GPGA 1Z6JH 2BB4A 1O30A 4X1SU 3QDZB 2OP9A 1WCZA 1C2LA 2FX4A 3S9CA 1UCYE 3A89A 1SC8U 2VIOA 1CSOE 1ZHRA 3Q3XA 1OWHA 4AFQA 4X1QU 1TMUH 1C5MD 1IHSH 5FPTA 4AGJA 1DDJA 2BY6X 2G5VA 3S69A 1KXAA 4JZFH 3U8TH 3UOPA 5A0CA 3HATH 3TJUA 3BG4C 3KN2A 1O3NA 2P3TB 1DXPA 1E34B 2ZCLP 2ALPA 3G01A 2Z6BD 3L3TA 2FEQH 1C5OH 2PUQH 4BXWA 4O97A 2QAAA 1C5PA 2PR3A 5FCRA 2ZQ1A 1P12E 4GVUA 1TPSA 1ZMJA 1GGDB 4RKJB 4NA8A 4CREA 2GDEH 1HAIH 3TU7H 1IQLA 1GMCG 3AAUA 1OS8A 1C4Y2 3RXDA 3LGIA 5JPMH 2SFAA 2IN2A 3RXRA 1C4U2 3ELAH 3LGTA 1C2DA 1TB6H 3SNCA 3BTQE 5CHAC 1H1BA 1FXYA 1OP0A 2HALA 3RXSA 2SGQE 2BLVA 2K1QA 2ZU4A 1C5RA 1WUNH 1SGCA 4Y0ZE 1OXGA 2BDHA 1WQVH 2QF3A 1IOEA 1C1SA 1OKXA 2TGTA 3MI4A 3GY2A 1LHFH 1O3FA 1DVAH 3I77A 4CHAB 1GMDF 2HNTC 1W2KH 1OYQA 3STIA 2EC9H 1L2EA 1NY22 4MPVA 1G32B 5FCKA 2A7HA 1RTKA 1P03A 1QURH 1HAHH 4ZH8A 1GI1A 2TGPZ 1TRYA 2G52A 2ZU2A 3BTGE 3U1JB 3BF6H 1O2QA 2J92A 4YT7H 1DICA 2KAIB 3M5LA 1NC6A 1XXFA 1ZJKA 2C8WB 3RXKA 1P2MA 3LONA 2HWLB 3ATLA 2VWOA 4IBLH 1Q31A 1S84A 2B8OH 3ZYDA 1RIWC 4U32A 5EPNA 2ODPA 1KDQB 2JH6D 3SV8A 5T6DA 1ID5H 2FLBH 1MTVA 3M7QA 4RKOB 1A0JA 2GV7A 2H6MA 2VIDA 2HLCA 3RXOA 1GBKA 3JZ1B 2FXRA 2Z9JA 1BBRH 1J15A 1F5LA 1XUGA 1BHXB 1H8DH 2P3UB 1GCDA 2R9PA 2Z9LA 3A86A 4I33A 4QT8C 1NROH 2GT8A 1ELBA 3OYPA 1ZLRA 1O38A 1BTWA 1TX7A 2O8LA 1TPOA 3KQEA 1YPEH 2TGAA 1TQ0B 3FFGA 1QL7A 2JH0D 1CGIE 3F9GA 1BTXA 1NFXA 3PWBA 1MZAA 3U69H 1ZRBA 1SQOA 3S7HB 4ISHH 1EXFA 4IC6A 1ZSJA 5BRRE 4ASHA 1PQ8A 3SU4A 3HGPA 3QZQA 4XBCA 1O31A 1ESBA 1D3TB 4H6TA 2AMPA 1W10U 4NSYA 2F9VA 3SHCH 5EW1H 2ZA5A 2J34A 3KQCA 2C8ZB 4Z6AH 2Z3EA 2VVVA 2WYGA 1EOLA 3Q00A 2TIOA 1GHWH 3TJVA 3MO9A 1TOMH 2ZPQA 2PGBB 2PTCE 2A4QA 1IAUA 2XWBI 2GCHG 2DE9A 3TJOA 5GWZA 1SGEE 2PLXA 2ZHWH 3RXJA 2Q6DA 1UO6A 1UVTH 1JMOH 4AOQA 1GMHG 3QUMP 4X2WA 3BEIB 1BIOA 1FLEE 5A0BA 5TCAA 2BY8X 1PPGE 2XC5A 2BLOA 2FZZA 4JYVH 1O2VA 2V0BA 4OS2A 3E91A 4THNH 3SU2A 3T62A 4KP0A 1F2SE 4CRBA 1Q3XA 2C93B 1YCPK 5F8ZA 2GMTC 8LPRA 1ANDA 1Y3UA 1O37A 1MUEB 4BAMB 1Z8IB 2BD3A 1AFQB 4RN6A 5GCHF 3SJ8A 2ZI2H 1A4WH 1BBRK 1GL0E 1Z6EA 1IQIA 1CA0B 1O2PA 1P2NA 2ZCHP 2ZFPH 3SNAA 4BTTB 1Y5BT 1P09A 2BD9A 5ABWA 3O8CA 1AO5A 1YLCA 3BTHE 1EPTB 1DFPA 2HGTH 8GCHF 1FUJA 2BXUH 1O3JA 1UTKA 1CQQA 2Z94A 1A1RA 3HK6B 4ABBA 2UWOA 3UR9A 4YO9A 1GI9B 5DP9A 2HVXA 3ZZBA 3F68H 2ZFRH 1EUFA 1CT4E 3RXGA 1GHBF 2C8XB 3AASA 2VB0A 5I25A 1G37A 1N6XA 1P2QA 1K1JA 4K2YA 1YPMH 2VIQA 3TVJB 4YOIA 3UREA 3PMHB 1FMGA 3MU0A 5GIBA 3RM2H 5A09A 3BG4B 5C1UA 3A88A 2FLRH 3U8OH 4JYUH 2Z9IA 3PO1B 4BOHA 1D6RA 3IG6B 1HDTH 3MO3A 4FUBA 4O3UA 1YYY1 2HNTF 3ENSB 3F6UH 1K9OE 3U8RH 3ZZCA 4A5TS 1V3XA 1ELDE 4JZIA 2FDAA 4U30A 3UTUH 4Y0YE 1KLTA 2QA9E 1BTYA 1LVBA 1LQEA 4IGDA 2PSYA 3BTME 1Y3YA 4WH8A 4H42U 4I8KA 4MVNA 1D3PB 3Q77A 1BRAA 1O3KA 1HYLA 3K6ZA 1GJ7B 2ZDVH 3NPSA 5EODA 4WH6A 1CE5A 3SOSA 4TPYA 3M36A 3T29A 5C1YA 3B8JA 4X2XA 2BYAX 4Y76A 4X6MA 3SHAH 2BQ6B 1GG6C 3QO6A 1FDPA 1VJAU 1DLEA 3KNXA 9LPRA 1AFEH 2G51A 2P16A 5FPSA 4ZMAH 1VITF 4A6LA 1CVWH 4ZAEA 1MH0A 2IJOB 2ILNA 3SJKA 3A7XA 3S9BA 3EA7A 2D8WA 4NIXA 5IYTA 4FU7A 3FANA 2ANMH 4F4OC 1IQGA 4DCDA 1QBNA 4WMDA 1TOCB 2R0KA 1G2MA 2FOCA 5A0AE 4KKDA 3ZZ4A 2BM2A 1THRH 5DP6A 4E05H 2JETC 1XUJA 1AB9C 1A0LA 1SR5C 3A85A 2TRMA 2Y5HA 4Y6DA 1Y5UT 4JCNA 1Y8TA 1OWJA 3SU5A 4ZHLU 1HIAB 1MKXH 1A46H 1AGJA 4BXSA 3LGWA 2H5DA 5EQQA 1AVWA 4ISIH 3LH1A 4R8TB 3MTYA 4ABAA 1UHBA 1RIWB 1O5BB 4X2YA 4JK5A 3M5MA 3LPRA 3QK1A 1S82A 3TGJE 1ZOMA 4NIYA 2STBE 1HJ9A 1AD8H 2OBOA 2ZDMA 1ELAA 2GVFA 1O34A 4FUIA 4B71A 4K8BA 4GLYA 2QXGA 4A7IB 3DUXH 1SGYE 5FBIA 3QX5H 4ABJA 2ZFSA 2CJIA 4DJZB 2BTCE 2GZ7A 3M3SA 3GCTF 1JXPA 4WY3A 1OP8A 1NFYA 3ZZ6A 2VGCB 5DO4H 2A7JA 4AYVB 2XXLA 3SJOA 3GY8A 3MNBA 3SZNA 5ESTE 3DD2H 2J94A 2ZGJA 3IITA 1LHDH 3UOUA 3VB5A 4ZHAA 1HAVA 2A2QH 1LHCH 1QA7A 1BA8B 3D49H 2Y7XA 1GI5A 1S85A 1G30B 4HGCA 2UUFB 1MTNC 2J2UA 2ZU1A 2HNTE 3PB1E 3LU9B 3M35A 1C1PA 2GD4B 1O3AA 3M7TA 1ZRKA 3MHWU 1UJ1A 1CGJE 1MCVA 1J9CH 3E90B 1GJ4H 1CHOG 1P06A 1O3LA 6ESTA 4CRAA 1NRRH 4HI3A 3SJIA 1NRQH 4FVDA 1GBBA 1W8BH 3M61U 2YOLA 4OS7A 1MTSA 2FOEA 2PW8H 1SI5H 1C1QA 1T8LA 4WF8A 3OY5U 3SW2B 1C2GA 1LO6A 1NRNH 4LZ1H 1A61H 3E1XB 2ZGBH 1TONA 1UTLM 1F0UA 4LOYH 2BD8A 1C5ZB 2P59A 1SGRE 4FUHA 1C5LH 2EEKA 1MKXK 2CHAC 2J9NA 1Q2WA 7KMEH 1C5VA 3VB6A 4UFGH 4MLFB 4GHTA 3P8NA 1EASA 1O0DH 4Y11E 1DWDH 1DUEA 1K1PA 2GMTB 4OS5A 1C5TA 1YM0A 4NWKA 2ESTE 5F6MA 4XBBA 6CHAB 1RS0A 1K22H 1FY1A 1EB1H 1HAYB 3PWCA 1L1GA 4UDWH 3D65E 2PHBA 1ZPCA 1JOUB 3URDA 2BX3A 1IQMA 1INCA 1SLUB 4UEHH 1F92A 1F0RA 2QXJA 3P17H 5J4SA 1GI3A 2XBVA 3HK3B 3GISB 1CBWB 1HAPH 1GI7B 3LOXA 1WBGB 4KTCA 1O2RA 1TNJA 2BLQA 4YT6H 1J14A 1O5EH 1SOTA 1ZTJA 4Q2KA 3MH7A 2GKVE 1SGNE 1LKBA 2EI7A 2FOGA 3SN8A 2VJ1A 4D7FA 3MFJA 4E7RG 3SBKA 3F9EA 1GHVH 1IQJA 1UVPA 1AKSB 1GMCF 3U98H 4K3JA 3DA9B 4ZHMU 3A7TA 3RUOA 4Q80A 4ISLA 4KTSA 1NS3A 4KGAA 1GDQA 5JBBS 2AS9A 1JRSA 4HTCH 1PQAA 2BVXH 4AYYB 1SB1H 2ZDNA 2BQ7B 1L1JA 2J38A 4X6PA 1YPGH 2ZU5A 2D1JA 2VNTA 1V2OT 3W95A 3K9XB 2CF8H 1AHTH 3BTDE 2ZFTA 3OY6U 7GCHG 1K1OA 2WINI 2Z9GA 1K1NA 3SUDA 1LPZB 1DY8A 5E0GA 4JZ1A 1XKAC 1EZSC 4AFZA 1CO7E 1SGIB 4KELA 1KIGH 2QN5T 1O3HA 1SGPE 1F7ZA 1UVUH 6LPRA 5EG4A 1ZR0A 3HKIB 2Y7ZA 1GHYH 4A92A 3F9FA 1MTWA 4ISOA 4ISNA 4D8NA 4UE7H 2ZQ2A 5FHTA 5F8XA 2G00A 4ZROA 3A7YA 2Z9KA 3SV9A 2KAIA 3EYDA 4VGCC 1V2PT 1PPEE 1GCTC 1Y5AT 3M3VA 3P8FA 3A8DA 3MU8A 3MU5A 4B2CA 3PLBA 3UWIA 2PV9B 1BJVA 5JYIA 3ZZ7A 4M7GA 4XBDA 3SORA 3GYLB 1EP5A 1K21H 1KDQA 1BT7A 3TH2H 1TGTA 4Y7AA 1BOQA 3FP8E 1VCQA 2G4UA 1JBUH 1P57B 3GY7A 3DT0H 3ZVBA 1C5NH 2F9UA 1HB0B 1S0RA 1Y3WA 1QGFA 1CT0E 1BJUA 1C5WB 2SGDE 2ZIQH 1ZTLA 1O3OA 3EA9A 4CRDA 1CA8B 1ZPZA 1QHRB 1QBVH 4B2BA 1WTGH 3UQVA 1VZQH 1TNGA 2HOBA 3MH6A 3MNXA 1GJ8B 1V2NT 2OQUA 1U6QA 1HJAC 3BSQA 2ZTZA 3D23A 2PUXB 5H4IB 3OSYA 2QY0B 2BDIA 4AFUA 3V12A 2BY9X 2GCHF 1AWHB 2BOKA 1NESE 1ZSLA 1FIWA 3ZZ5A 1UK3A 3DFJA 3V13A 2AERH 2H1UA 1GMHF 5L2ZH 3A7VA 1HCGA 1O2LA 1SGFG 3FP7E 1SLXB 3E16B 1ZGIA 4J2YB 3RXBA 3RXLA 1XXDA 4UONA 1W0YH 1HUTH 1KXCA 4CH8B 1SFIA 2Y5FA 5L30H 3SO3A 3GY6A 3OU0A 2SGEE 1D6WA 3ZZ8A 2G8TA 4NZLA 1ETSH 2FX6A 1C4V2 1L4DA 1QTFA 2PKAB 1O3EA 1QJ7B 2VIWA 3E0NB 3SI3H 1XM1A 1TGBA 1PPZA 1BTPA 1GJBB 1TBRH 1C1TA 1B5GH 1BMMH 1WYKA 3ZZ3A 2A4GA 2OXSA 3SUEA 4DGJA 1DE7H 2H9TH 4K8YA 5JDUB 1ZMNA 4K69A 2OTVA 1HAGE 1BCUH 2EI8A 3V7TA 5TCCA 1UTMA 1UTQA 2XCNA 2CHAB 2PKSB 4ZXXH 4CR9A 4ABGA 4Y79A 1O2NA 1W14U 2V35A 5AHGH 3SGAE 3LKWA 3M7UA 5FAHA 1V6DA 5E0JA 1ANCA 1ESAA 1W11U 4UFDH 1K1LA 2NU3E 2QGRA 1C1UH 2ZC9H 1FZZA 2W7SA 1GJDB 4YESB 1C2EA 1T7CA 2BZ6H 1V2TT 1V2JT 2JKHA 2XBYA 2B0FA 2G4TA 1V2QT 3QWCH 1DM4B 2D2DA 4PROA 3DFLA 5EOKA 5HYOA 3VXFH 1KYNA 9ESTA 1YPHC 3GYMA 4FU8A 4K1EA 4DVAU 4O03A 1GHZA 1S83A 4YOJA 1P11E 3L6PA 2FYRA 2C90B 1BRBE 3CS7A 3TGIE 2ODYB 1SOZA 1ETTH 1WU1A 2ASUB 2Y82A 3A87A 1O5GH 3PM3A
chains in the Genus database with same CATH superfamily
3LJJA 3F2FA 1O2GH 2AMQA 4M9FA 1ANBA 1SKYE 3VFEA 3P6ZB 1G3DA 2PSXA 4MNYA 1P2OA 2FOBA 3ITIA 5AFYH 3RMLH 1C1VH 1V2RT 2WPLS 3E8LA 5FXLA 3VPKA 1O3MA 1NO9H 2SGPE 4ACBA 4ZKRU 2GGVB 2KCAA 1J16A 2AIQA 3QGNB 1DPOA 1FY4A 1QRZA 1KLIH 3KF2A 4Y8XA 1SFQB 1D3QB 2KX4A 3AW1A 3VB7A 3NZIA 2HRVA 2QF4A 1UCYH 3E3TA 3SGQE 1TX6A 1K2I1 1WTHD 3ZVDA 5C67A 1SGDE 2BLWA 3T25A 2AFQB 1P2IA 1DANH 1SQAA 3KYGA 1TNKA 1QL8A 1GMDG 3A7ZA 5DPAA 1QBOA 3PV5A 3GS9A 2FOMB 1GVLA 4F48B 1O2HA 2OC8A 5JBTA 1THSH 1KXEA 1GCTB 4WVPE 3QGJA 2FO9A 1HIAA 3UPEA 4YZUA 2FM2A 1SLVB 2OD3B 2HVYB 3GDSA 4X1RU 2YMSB 1C2JA 4R0IA 3RXHA 5C3NA 1BMLA 2GCTC 2ODQA 4GCHF 4ABIA 1E35B 1S5SA 2O9QA 2QCYA 4X1NU 5DK1A 5DP5A 2WPMS 1ELCA 2QYIA 3MU4A 3VGCC 2SGAA 1WXRA 5AFZH 1C1RA 3SV2H 2VIVA 1QFKH 2CV3A 3SV6A 1MTUA 1YF4A 3SQEE 1PPHE 1UVSH 1GJ5H 3GCHC 5HIZA 5ESBA 2XC0A 3SI4H 3UNRA 1ELGA 1O2TA 1SBWA 1IQHA 2ZPSA 3RP2A 3A82A 2P8OC 1HXFH 4CRCA 2UUJB 3RXEA 4YOGA 2A0QB 3MH5A 1EJMA 3FO8D 4INLA 2A31A 2M5TA 2WPIS 1LVMA 2EA3A 1P02A 5EJ1A 1A5GH 4GHQA 4TT3D 1CHOF 2EY4C 1SGQE 1C9PA 3MWIU 4MDSA 3ZZAA 3ZVEA 3SU6A 4ABHA 4BNRA 5C0TA 1FI8A 3RU4E 4IMZA 1VCWA 1VKYA 1V2VT 1DS2E 3OFND 3PMJA 5CHAB 3MH4A 3TLOA 2GP9B 1FJSA 2AGIX 3HPTB 1EAXA 1MQ5A 1P9SA 1KSNA 2EI6A 1GBFA 3FZDA 2A7CA 3M3TA 1O3CA 2WPKS 4NCYA 3UWJH 1IQNA 1H9LB 1UCYK 2ZG0H 1T8NA 1O2IA 2OLGA 2OC1A 2ZTYA 1C5SA 1X7AC 4B2AA 1C5UA 4K5ZA 1C2FA 1BMNH 5EPYA 2BX4A 3MNCA 3MU1A 1GHXH 2A5AA 2BDGA 4MPXA 1GBLA 4NGAH 1RJXB 2ALVA 2C3SA 3RLWH 1TBQH 1S6LA 1EAWA 2BDYA 1QRXA 2WUBA 2BOHB 8ESTE 1MKWH 5C94A 1EJNA 4AORA 3DCLA 2AIPA 2J4IA 1GI8B 2P93A 2CXVA 1DT2A 3P8GA 3D62A 3NKKA 4ZUHA 3TNSA 3QZRA 2BVSH 2ANYA 1MAYA 5K7RA 2ZNKH 1PYTC 5E0HA 1TNIA 1LQDB 1LPKB 4WXVA 2VIPA 1H9HE 1WSSH 1V2KT 1LHEH 1O2YA 1RRKA 2GZ9A 5F53A 1RXPA 5GCHG 2PWXA 3DSGA 2A2XH 1WDIA 2CF9H 4ABDA 4Q7ZA 1GDNA 3EE7A 3TGKE 1QNJA 4JZEH 4FUFA 1GHAG 1K1IA 1GBMA 3BG8A 3PLPA 1ZSKA 1EOJA 2A1DB 3UFAA 1BITA 4ABFA 1EAUA 5DN6D 2Y5GA 3BTFE 1EKBB 2A32A 4WJG2 1MZDA 4DIIH 2THFB 1SQTA 1GJAB 2FP7B 1AKSA 2F4LA 2BDAA 1DSUA 4XDEA 1P2JA 1GBIA 1DWBH 5CE1A 2YNAA 5T1VA 4JZDH 3ZV9A 2AMDA 3O8DA 4LK4A 1TA2A 4X6NA 2ZHEH 4NZQA 3RDZA 3LGYA 1YP9A 4IC5A 2WZQA 1O5AB 3P8OA 1YLNA 1B0EA 2XW9A 1V2LT 4AG2A 1NN6A 1QA0A 1BUIA 2Y6TA 3GY5A 4ZKNU 1SL3A 2RG3A 1NFUA 3S0NA 1FPCH 1J8AA 4Y8YA 3EQ0H 1E38B 4AB8A 1GWAA 1MQ6A 1SPJA 4D7GA 3U1IB 4MNXA 4UFEH 4CHAC 3A8AA 2RCEA 1GBEA 2IPHA 2PGQB 4ESTE 1B7XB 3JZ2B 5C5OA 3SYJA 1MKWK 2M2AA 1SGFA 2ZKSA 2L74A 4DY7B 4SGAE 1SHHB 5CDFE 1AVGH 3UY9A 1LVOA 2WPJS 1KY9A 2A4RA 2VVUA 1KXFA 1KXDA 2ZPRA 3EA8A 3TPIZ 4B74A 1K0HA 2H2ZA 4LXBH 1TX8A 4AX9H 2O8UA 2TBSA 3GY3A 2FESH 1ANEA 1P2KA 4Z1MD 3AVZA 1VITG 1DSTA 1KTSB 4GSOA 3TK9A 5CMXH 2ZHFH 5L2YH 1BTUA 3HGNA 2F91A 3EGKH 2FTMA 2FI5E 1NBMD 2SNVA 3I29A 2O8MA 1NTPA 4IN1A 4OGXA 1TWXB 3FP6E 4AN7A 1YPHE 3Q3KA 3P70B 4NIWA 1UHBB 1D4PB 5BPEA 4BAQB 3ATWA 2VU8E 1QB9A 1O5FH 1C2IA 1L0ZA 1W12U 2ZWLH 2F83A 1CGHA 3FVFB 1G36A 1JIRA 3VGCB 2H9HA 2C8YB 1HJ8A 3QN7A 5C20A 2FIRH 2B5TB 1CU1A 2WUCA 3R3GB 3QTVH 3MMGA 3RC6A 2FYQA 1O3BA 4I7YH 5DKMA 1BBRE 3QTOH 1E0FD 4NSVA 1FY8E 3RC4A 2P3FH 3PRDA 1SSXA 3TITA 1DLKB 4DG4A 1HAVB 2B7DH 3E0PB 4B6EA 1ZGVA 1OWDA 1C1NA 4X8TH 3N7OA 3SQHE 2Y81A 3F1SB 1T32A 1YPJH 3B23B 1L1NA 1FN6A 3A80A 3BN9A 1O2XA 2R3YA 3H5CB 1QJ6B 2BDBA 4Q7XA 1FAXA 2I6SA 4O9VA 3NCLA 2ZCKP 1O2WA 1F0SA 3A83A 1PPCE 1TGCA 3VEQB 2QV1A 3BTTE 1A3BH 5F03A 3NXPA 2AH4X 1LDTT 1BTZA 1GG6B 2F9NA 3A84A 2WPHS 3A8CA 1ACBE 1AUJA 1TPPA 4Y71A 2NWNA 1GJ9B 3RXTA 4OS4A 4F55A 3RM0H 5LGOA 2VWMA 5K0HA 1TPAE 1O39A 3OX7U 4XSKU 3RXIA 2Q1JA 2JIZD 3FAOA 4MNVA 4FOUC 1Z8RA 2PKAA 3MNSA 4NIVA 3ZYEA 1HAZB 1RTFB 3WY8A 1TFXA 2LNCA 2FOFA 4INKA 3IWMA 5FBEA 1S6HA 1AFQC 4AFSA 1ELFA 2JETB 5DP4A 4Y10E 4I32A 1AB9B 2JJ1D 2GT7A 4X8SH 3VB3A 3UQOA 5GPIB 3SUGA 3QLPH 2GZ8A 1CA0C 4UFFH 5HM2A 1BRCE 2STAE 2KCYA 1S6FA 5E2PA 1Z71A 2BD7A 2HPQH 3NRLA 1NU7B 2AGGX 1D3DB 2FI3E 5DP3A 1UMAH 3BIVH 4JMYA 3A8BA 2Q6FA 4TSFD 5A8ZA 1AMHA 1NRPH 1NT1A 4XFQA 1P05A 2CMYA 3SV7A 1GI6A 1G3BA 1AIXH 1C9TA 5F8TA 1P01A 1A7SA 2OCVB 2JJ2D 2JH5D 2NU0E 1Z1JA 2ZFFH 4TY6A 1GL1A 3PV4A 3CP7A 2OBQA 3ZV8A 1O36A 2WYJA 5HKKD 3BTWE 3KGPA 1O5DH 1EZXC 1SG8B 4OGYA 1ABJH 2TGDA 4NFFA 2W7UA 1WQSA 1G3EA 1DY9A 4MPWA 1FY3A 3PO1C 2Z3CA 1DOJA 1TNHA 4MPUA 1O3IA 4HZHA 4MNWA 3UIRA 5GDSH 1HGTH 4UD9H 4D9RA 2F9BH 5LH8A 2G81E 1MTNB 1QZ8A 2J95A 5A8YA 3C27B 1TQ7B 4H6SB 1HV7A 1FPHH 1VITH 1H4WA 1JRTA 2F9PA 2VH6A 3ZIAD 5TJXA 4I8GA 5HGGA 4P00A 1IQEA 2EQNA 1AU8A 4TPIZ 3ODFA 2BQWB 2AYWA 2RA3A 1AI8H 1ZJDA 1E1QD 1SLWB 4P02A 3GOVB 3U9AH 5AVDA 3MOCA 7LPRA 1E36B 4BTUB 4A1TA 1EATA 1BHXF 2FOAA 4INHA 1HAOH 1C5XB 1EAIA 3RC5A 1S81A 2YNBA 4K1TA 1EZQA 3CENA 3SU0A 4CRFA 5FX5A 1COWD 1YC0A 4KTUA 3URCA 3TH4H 1AUTC 3AAVA 1O2MA 1TAWA 1KXBA 2QXIA 1GBCA 2QXHA 3GCNA 1A2CH 4I8HA 3GDVA 2W3IA 6GCHG 5DG6A 2G55A 1NZQH 1EPTA 1TABE 3M37A 3RXVA 1W0ZU 1XUHA 2XYAA 1AZ8A 1YCPH 1JWTA 1T31A 2VINA 5E8EH 3U28C 2WV4A 1O35A 4BAHB 1E37B 2ZHQH 4DT7B 4XE4A 1YLDA 2R2MB 3BV9B 1V2ST 1N8OC 1MMJN 1MU8B 4X0WU 3SGBE 1VCPA 1QL9A 3TK5A 3Q76A 1QR3E 3RMNH 5SGAE 1C2MA 2ZFQH 1K28D 1HRTH 1XX9A 3KIDU 3S9AA 1ELEE 4HFPB 1DITH 4B1TA 2RA0A 4JK6A 1QJ1B 2GX4A 1XKBC 3S7KB 2IOTA 2Z3DA 1W7GH 3RU4D 3PMAB 5PTPA 4FU9A 5C0UA 1WV7H 2VGCC 2OK5A 4ZKOU 1A3EH 4AB9A 2KFWA 5CHBA 5FX6A 2CGAA 4X6OA 5GJ4B 4ZKSU 2FS9A 1O33A 1ZHMA 4B6FA 3NWUA 1DUAA 3LH3A 1IQFA 2YMSD 7ESTE 2O8TA 3H7TA 4NA7A 1A5IA 1F5RA 2ZTXA 2Z7FE 2KM0A 1CHGA 4AGKA 1MAXA 1O3PB 2XC4A 5EQSA 2GV6A 3FZZA 4BTIB 3BEUA 2H5CA 2HPPH 1S0QA 4B73A 2P95A 1BTHH 2W5EA 2XCFA 3ZVCA 1RD3B 1B0FA 3UAIC 4TWWA 1PJPA 3F0OA 1QQUA 2H9EH 1O2KA 1GBDA 5KEDA 3NUMA 4Z0KA 1C5QA 3RXCA 2WV5A 2BDCA 3RMOH 1P0SH 4E7NA 1Y3XA 1OWEA 1G9IE 3MYWA 5JB8S 1IQKA 4FUEA 1QY6A 5EQRA 4D76A 1TYNA 1AE5A 2JDID 4WWYA 1VR1H 2ZZUH 1OHHD 4I8JA 3V3MA 1QB1A 4YXWD 4VGCB 1DWEH 3KL6A 1AE8H 6CHAC 1VGCC 3KQBA 1TIOA 1FQ3A 1ETRH 1W0JD 1TBZH 2TPIZ 4A1VA 2BXTH 3FOAA 1HFDA 2XNDD 1BMAA 2A4OA 4IN2A 4NFEA 1MU6B 3PLKA 2BD5A 1XVOA 2B9LA 1ABIH 2ZDLA 3VXEH 1SHYA 1UK4A 4CRGA 5EXMA 1QQ4A 1T8MA 1GHAF 4TYDA 5DP7A 1GBTA 1XVMA 2A5KA 2QF0A 4O3TA 3PTNA 1BZXE 1GBAA 1CBWC 2ZEBA 1UK2A 1RGQA 5GXPA 1YPKH 3P92A 1BB0B 4FVBA 4FUJA 3GDUA 1W7XH 1BDAA 4YM9A 1P04A 1ELTA 1N6YA 2ZU3A 2UWLA 1QCPA 1PQ7A 2VWNA 2OC0A 2UWPA 5KGOA 4DURA 2XBWA 3PYHA 3L33A 5E2OA 3OTPA 1TA6A 4IMQA 3F9HA 3MQKC 1DXWA 1FAKH 3KYFA 2SNWA 2CK3D 3RXQA 1Z8GA 2XTTB 1ZHPA 5T6FA 3TJNA 3ZZDA 4D9QA 5DP8A 5A8XA 1HJAB 4BAKB 1BRUP 2BZAA 1HXEH 2OQ5A 1KTTB 1GBJA 1HLTH 4U2WA 1XUKA 3AW0A 3K65B 2BY7X 1HPGA 3SU1A 2BHGA 1AY6H 1FX0B 3W94A 3T2NA 1FN8A 2FODA 1H9IE 1A0HB 1UTNA 4LZ4B 1OOKB 2FS8A 1T4UH 1C5YB 3OTJE 4X2VA 3M5NA 1GVZA 3ESTA 4Y7BA 2NU2E 4J1YA 2DE8A 1LVYA 3I78A 2F3CE 4YLQH 3RXAA 1DX5M 2O8WA 2BMGB 1THPB 2NU4E 3HKJB 2ZHDA 1MBQA 1PPFE 3H7OA 4WMEA 5EIYA 1K1MA 5EU8A 5T6GA 1C1MA 3SNEA 1G3CA 1H8IH 3KCGH 5LPRA 3K2UA 2V7QD 1GPZA 4NA9H 3ZVGA 1FNIA 2R2WU 1O5CB 1GBHA 1VJ9U 3F0PA 1ESTA 4FXGH 1EZUC 1GDUA 1GJCB 1OSSA 3LDXH 3SNDA 4BANB 2F9OA 2ZGCA 1O3DA 4CH2B 1Y59T 1TALA 2RDLA 3GCOA 5JBCS 1V2MT 2D26C 3UNQA 1C1OA 1RFNA 3BIUH 3TIUA 3GY4A 2FWWA 2AEIH 2QF5A 1HAXB 2BVRH 5IK2D 1XUFA 3ATKA 1TMTH 2ANKH 1SMFE 1DWCH 4TWYA 1PPBH 2BY5X 1LKAA 2A5IA 5J4QA 3O8BA 3A7WA 2V3MA 2V3OH 1EJAA 3LJOA 4OS1A 1TGSZ 3ODDA 2RFKC 1TRNA 3ATIA 3KQDA 1ZMLA 4AZ2B 8GCHG 4CR5A 1N8OB 1W3CA 1ZZZA 1ZPBA 4GUXA 2R0LA 1Z1IA 3VB4A 2XRCA 4Q7YA 5C17A 2A45B 1XUIA 2P94A 1O2UA 5JB9S 4AG1A 5B6OA 2W3KA 1ORFA 2Y80A 2ZF0H 4GCHG 5T3HA 1XMNB 5GNDA 3E6PH 4CBNA 1GVKB 1GHBG 1A5HA 1GGDC 1P9UA 3RLYH 4TY7A 2QC2A 1UTPA 2FMJA 3KHVA 3LGVA 3SZEA 7GCHF 1ZYOA 1MCTA 5A2MH 1QIXB 1F5KU 3P95A 1MD8A 1AWFH 3RU4T 2XWAA 1TNLA 3TNTA 2OUAA 4RT0A 3TK6A 4H4FA 1TLDA 1J17T 1LCYA 1NFWA 3EE0B 4DIHH 1L4ZA 2GTBA 5EW2H 1UTOA 2W26A 5HXFA 3PTBA 1ARCA 1V2WT 1WOFA 3RXFA 1CT2E 1N1LA 3R0FA 3M5OA 3T26A 3ATMA 4SGBE 1EP6A 2SGFE 4X1PU 3T5FH 4X8UH 5L6NH 1LTOA 2ULLA 2WPDD 4FUGA 1BQYA 1OP2A 3NK8A 4BAOB 1UTJA 1AVXA 3CS0A 4IW4E 4OS6A 1P3EA 1EX3A 1GJ6A 1SGTA 2AGEX 3LC3A 1GI0A 1NM6A 3O8RA 4WMFA 4FUDA 1P8VC 3LT3A 1OYTH 5C2ZA 5JBAS 3RXPA 2PKSC 1FY5A 1Z7KA 4RSPA 4DW2U 2DUCA 2FOHA 1AN1E 1FONA 1O32A 4B76A 5LPFA 2LPRA 1YBWA 4YTAA 1O2OA 2UUKB 1GI2A 2PTNA 2XNIA 1LPGB 1IHTH 1VGCB 5I46H 3TH3H 3OEHD 4FUCA 1PQ5A 2V6NA 3C1KA 5LPEA 2UUYA 4NG9H 4GAWA 1W13U 1WAYB 2I6QA 3EAJA 2GCTB 1TE0A 1TRMA 2J5UA 2ZP0H 1Z8JB 3SUFA 1D9IA 5C1XA 1C1WH 4MTBA 4YLUA 2ZGHA 4DOQA 1F0TA 1JIMA 5C5NA 3UR6A 3T28A 1O2SA 1ELVA 3SU3A 3BTEE 3F2GA 1ARBA 3B9FH 8KME2 4MG3A 1P3CA 2IPQX 2OC7A 5DJ7A 3LGUA 3ZZ9A 3GCHB 2BD4A 5HMAA 5HM9A 4I8LA 4XOJA 1AZZA 4MQAA 2J97A 4I31A 2ANWA 1T4VH 4RI0A 1QRWA 2FTLE 3ZVAA 2P8OB 3GICB 5EXLA 4ABEA 2ZGXH 1EB2A 2BD2A 3UB0A 1UVOA 1RTLA 4K60A 1YKTA 1MBMA 4NWLA 2ZDKA 5AF9H 1EQ9A 2FPZA 3GCTG 3V0XA 1TMBH 1GI4A 3DSPA 1QB6A 2GDDA 1SVPA 3UUZA 2G5NA 1OX1A 3PMBB 3RMMH 1KLJH 3K6YA 3SJ9A 2QIQA 2ZDAH 1O2JA 4IS5A 2CN0H 4ZXYH 1C2HA 1PYTD 1HNEE 3LC5A 1FIZA 3A81A 2C4FH 1T8OA 2FI4E 1MD7A 4E06H 1OWIA 3Q3YA 1LMWB 2XBXA 1OWKA 3MO6A 4Y8ZA 2V3HH 2VVCA 3BTKE 3PROA 3EDXB 5G4BA 3ZVFA 1ZTKA 1PFXC 3UNSA 1O2ZA 1FV9A 1HBTH 3RXUA 2ZO3H 3KEEA 1YPLH 3STJA 1P10A 2VWLA 3LIWA 3BEFB 1TGNA 2Q6GA 3RXMA 1C2KA 4OM9A 4U01A 4WXIA 3DHKH 1M9UA 1NU9A 1NRSH 5FPYA 1G2LA 1Y3VA 3T27A 1V2UT 6GCHF 1LHGH 1OPHB 1O3GA 2NU1E 5ETXA 5EXNA 2OINA 2VH0A 5DGJA 4JYTA 1YGCH 1EPTC 5EGMA 4K1SA 2PFEA 1NPMA 1YCPM 4F49A 2R3UA 2ZECA 5IDKA 4A1XA 4CBOA 4X8VH 1AQ7A 3SNBA 4B75A 4GPGA 1Z6JH 2BB4A 1O30A 4X1SU 3QDZB 2OP9A 1WCZA 1C2LA 2FX4A 2WSSD 3S9CA 1UCYE 3A89A 1SC8U 2VIOA 1CSOE 1ZHRA 3Q3XA 1OWHA 4AFQA 4X1QU 1TMUH 1C5MD 1IHSH 5FPTA 4AGJA 1DDJA 2BY6X 2G5VA 3S69A 1KXAA 4JZFH 3U8TH 4AC9A 2RDEA 3H09A 3UOPA 5A0CA 3HATH 3TJUA 3BG4C 3KN2A 1O3NA 2P3TB 1DXPA 1E34B 2ZCLP 4XRNA 2ALPA 3G01A 2Z6BD 2J98A 3L3TA 2FEQH 1C5OH 2PUQH 4BXWA 4O97A 3KQ5A 2QAAA 1C5PA 2PR3A 5FCRA 2ZQ1A 1P12E 4GVUA 1TPSA 1ZMJA 1GGDB 4RKJB 4NA8A 4CREA 2GDEH 1HAIH 3TU7H 1IQLA 1GMCG 3AAUA 1OS8A 1C4Y2 3RXDA 3LGIA 5JPMH 2SFAA 2IN2A 3RXRA 1C4U2 3ELAH 3LGTA 1C2DA 1TB6H 3SNCA 3BTQE 5CHAC 1H1BA 1FXYA 1OP0A 2HALA 3RXSA 2SGQE 2BLVA 2K1QA 2ZU4A 1C5RA 1WUNH 1SGCA 4Y0ZE 1OXGA 2BDHA 1WQVH 2QF3A 1IOEA 1C1SA 1OKXA 2TGTA 3MI4A 3GY2A 1LHFH 2HLDD 1O3FA 1DVAH 3I77A 4CHAB 1GMDF 2HNTC 1W2KH 1OYQA 3STIA 2EC9H 1L2EA 1NY22 4MPVA 1G32B 5FCKA 2A7HA 1RTKA 1P03A 1QURH 1HAHH 4ZH8A 1GI1A 2TGPZ 1TRYA 2G52A 2ZU2A 3BTGE 3U1JB 3BF6H 1O2QA 2J92A 4YT7H 1DICA 2KAIB 3M5LA 1NC6A 1XXFA 1ZJKA 2C8WB 3RXKA 1P2MA 3LONA 2HWLB 3ATLA 2VWOA 4IBLH 1Q31A 1S84A 2B8OH 3ZYDA 1RIWC 1W0KD 4U32A 5EPNA 2ODPA 1KDQB 2JH6D 3SV8A 5T6DA 1ID5H 2FLBH 1MTVA 3M7QA 4RKOB 1A0JA 2GV7A 2H6MA 2VIDA 2HLCA 3RXOA 1GBKA 3JZ1B 2FXRA 2Z9JA 1BBRH 1J15A 1F5LA 1XUGA 1BHXB 1H8DH 2P3UB 1GCDA 2R9PA 2Z9LA 3A86A 4I33A 4QT8C 1NROH 2GT8A 1ELBA 3OYPA 1ZLRA 1O38A 1BTWA 1TX7A 3OAAD 1TPOA 2O8LA 3KQEA 1YPEH 2TGAA 1TQ0B 3FFGA 1QL7A 2JH0D 2W6JD 1CGIE 2KZ4A 1BTXA 3F9GA 1NFXA 3PWBA 1MZAA 3U69H 1ZRBA 1SQOA 3S7HB 4ISHH 1EXFA 4IC6A 1ZSJA 5BRRE 4ASHA 1PQ8A 3SU4A 3HGPA 3QZQA 4XBCA 1O31A 1ESBA 1D3TB 4H6TA 2AMPA 1W10U 4NSYA 2F9VA 3SHCH 5EW1H 2KR7A 2ZA5A 2J34A 3KQCA 2C8ZB 4Z6AH 2Z3EA 2VVVA 2WYGA 1EOLA 3Q00A 2TIOA 1GHWH 3TJVA 3MO9A 1TOMH 2ZPQA 2PGBB 2PTCE 2A4QA 1IAUA 2XWBI 2GCHG 2DE9A 3TJOA 5GWZA 1SGEE 2PLXA 2ZHWH 3RXJA 2Q6DA 1UO6A 1UVTH 1JMOH 4AOQA 1GMHG 2XOKD 3QUMP 4X2WA 3BEIB 1BIOA 1FLEE 5A0BA 5TCAA 2BY8X 1PPGE 2XC5A 2BLOA 2FZZA 4JYVH 1O2VA 2V0BA 4OS2A 3E91A 4THNH 3SU2A 3T62A 4KP0A 1F2SE 4CRBA 1Q3XA 2C93B 1YCPK 5F8ZA 2GMTC 8LPRA 1ANDA 1Y3UA 1O37A 1MUEB 4BAMB 1Z8IB 2BD3A 1AFQB 4RN6A 5GCHF 3SJ8A 2ZI2H 1A4WH 1BBRK 1GL0E 1Z6EA 1IQIA 1CA0B 1O2PA 1P2NA 2ZCHP 2ZFPH 4I86A 3SNAA 1Y5BT 1P09A 4BTTB 2BD9A 5ABWA 3O8CA 1AO5A 1YLCA 3BTHE 1EPTB 1DFPA 2HGTH 8GCHF 1FUJA 2BXUH 1O3JA 1UTKA 1CQQA 2Z94A 3PV2A 1A1RA 3HK6B 4ABBA 2UWOA 3UR9A 4YO9A 1GI9B 5DP9A 3PRBA 2HVXA 4FETA 3ZZBA 3F68H 3W1EA 2ZFRH 1EUFA 1CT4E 3RXGA 1GHBF 2C8XB 3AASA 2VB0A 5I25A 1G37A 1N6XA 1P2QA 1K1JA 4K2YA 1YPMH 2VIQA 3TVJB 4YOIA 3UREA 3PMHB 1FMGA 3MU0A 5GIBA 3RM2H 4ASUD 5A09A 3BG4B 5C1UA 3A88A 2FLRH 3U8OH 4JYUH 2Z9IA 3PO1B 4BOHA 1D6RA 3IG6B 1HDTH 3MO3A 4FUBA 4O3UA 1YYY1 2HNTF 3ENSB 3F6UH 1K9OE 4Q4LA 3U8RH 3ZZCA 4A5TS 1V3XA 1ELDE 4JZIA 2FDAA 4U30A 3UTUH 4Y0YE 1KLTA 2QA9E 1BTYA 1LVBA 1LQEA 4IGDA 2PSYA 3BTME 1Y3YA 3FKSD 4WH8A 3F3BA 3N7EA 4H42U 4I8KA 4MVNA 1D3PB 3Q77A 1BRAA 1O3KA 1HYLA 3K6ZA 1GJ7B 2ZDVH 3NPSA 5EODA 4WH6A 1CE5A 3SOSA 4TPYA 3M36A 3T29A 5C1YA 3B8JA 2W6ID 4X2XA 2BYAX 4Y76A 4X6MA 3SHAH 3OE7D 2BQ6B 1GG6C 1H8HD 3QO6A 1FDPA 1VJAU 2VBCA 5HIYA 1DLEA 3KNXA 3FN8A 9LPRA 1AFEH 2G51A 2P16A 5FPSA 4ZMAH 1VITF 4A6LA 1CVWH 4ZAEA 1MH0A 2IJOB 2ILNA 3SJKA 3A7XA 3S9BA 3EA7A 2D8WA 4NIXA 5IYTA 4FU7A 3FANA 3F2HA 2ANMH 4F4OC 1IQGA 4DCDA 1QBNA 4WMDA 1TOCB 1YWUA 2R0KA 1G2MA 2FOCA 5A0AE 4KKDA 3ZZ4A 2BM2A 1THRH 5DP6A 4E05H 2JETC 1XUJA 1AB9C 1A0LA 1SR5C 3A85A 2TRMA 2Y5HA 4Y6DA 1Y5UT 4JCNA 1Y8TA 1OWJA 1E1RD 3SU5A 4ZHLU 1HIAB 1MKXH 5EJLA 1A46H 1AGJA 4BXSA 3LGWA 2H5DA 5EQQA 1AVWA 4ISIH 3LH1A 4R8TB 3MTYA 4ABAA 1UHBA 1RIWB 1O5BB 4X2YA 4JK5A 3M5MA 3LPRA 3QK1A 1S82A 3TGJE 1ZOMA 4NIYA 2STBE 1HJ9A 1AD8H 2OBOA 2ZDMA 1ELAA 2GVFA 1O34A 4FUIA 4B71A 4K8BA 4GLYA 2QXGA 4A7IB 3DUXH 1SGYE 5FBIA 3QX5H 4ABJA 2ZFSA 2CJIA 4DJZB 2BTCE 2GZ7A 3M3SA 3GCTF 1JXPA 4WY3A 1OP8A 2LP6A 1NFYA 3ZZ6A 2VGCB 5DO4H 2A7JA 4AYVB 2XXLA 3SJOA 3GY8A 3MNBA 3SZNA 5ESTE 3DD2H 2J94A 2ZGJA 3IITA 2KCOA 1LHDH 3UOUA 3VB5A 5DSFA 4ZHAA 1HAVA 2A2QH 1LHCH 1QA7A 1BA8B 3D49H 2Y7XA 1GI5A 1S85A 1G30B 4HGCA 2UUFB 1MTNC 2J2UA 2ZU1A 2HNTE 3PB1E 3LU9B 3M35A 1C1PA 2GD4B 3VG8A 1O3AA 3M7TA 1ZRKA 3MHWU 1E79D 1UJ1A 1CGJE 1MCVA 2K8IA 1J9CH 3E90B 1GJ4H 1CHOG 1P06A 1O3LA 6ESTA 4CRAA 1NRRH 4HI3A 3SJIA 1NRQH 4FVDA 1GBBA 1W8BH 3M61U 2YOLA 4OS7A 1MTSA 2FOEA 2PW8H 1SI5H 1C1QA 1T8LA 4WF8A 3OY5U 3SW2B 1C2GA 1LO6A 1NRNH 4LZ1H 1A61H 3E1XB 2ZGBH 3WWFA 5FL7D 1TONA 1UTLM 1F0UA 4LOYH 2BD8A 1C5ZB 2KCPA 1SGRE 2P59A 2WV9A 4FUHA 1C5LH 2EEKA 1MKXK 2CHAC 2J9NA 1Q2WA 7KMEH 1C5VA 3VB6A 4UFGH 4MLFB 2AHME 4GHTA 3P8NA 1EASA 1O0DH 4Y11E 1DWDH 1UW7A 1DUEA 1K1PA 2GMTB 4OS5A 1C5TA 1YM0A 4NWKA 2ESTE 5F6MA 4XBBA 6CHAB 1RS0A 1K22H 1FY1A 1EB1H 1HAYB 3PWCA 1L1GA 4UDWH 3D65E 2PHBA 4ACAA 1ZPCA 1JOUB 3URDA 2BX3A 1IQMA 1INCA 1SLUB 3AK5A 4UEHH 1F92A 1F0RA 2QXJA 3P17H 5J4SA 4ZCNA 1GI3A 1EFRD 2XBVA 3HK3B 3GISB 1CBWB 1HAPH 1GI7B 3LOXA 1WBGB 4KTCA 1O2RA 1TNJA 2BLQA 4YT6H 1J14A 2K0QA 1O5EH 1SOTA 1H8ED 1ZTJA 4Q2KA 3MH7A 2GKVE 1SGNE 1LKBA 2IJD1 2EI7A 2FOGA 3SN8A 2VJ1A 4D7FA 3MFJA 4E7RG 3SBKA 3F9EA 1GHVH 1IQJA 1UVPA 1AKSB 1GMCF 3U98H 4K3JA 2WHXA 3DA9B 3N7DA 4ZHMU 3A7TA 3RUOA 4Q80A 4ISLA 4KTSA 1NS3A 4KGAA 1GDQA 5JBBS 2AS9A 1JRSA 4HTCH 1PQAA 2BVXH 2L6OA 4AYYB 1SB1H 2ZDNA 2BQ7B 1L1JA 2J38A 4X6PA 1YPGH 2ZU5A 2D1JA 2VNTA 1V2OT 3W95A 3K9XB 2CF8H 1AHTH 3BTDE 2ZFTA 3OY6U 7GCHG 1K1OA 2WINI 2Z9GA 1K1NA 3SUDA 1LPZB 1YY3A 1DY8A 5E0GA 3WWBA 4JZ1A 1XKAC 1EZSC 4AFZA 1CO7E 1SGIB 4KELA 1KIGH 2QN5T 1O3HA 1SGPE 1F7ZA 1UVUH 6LPRA 5EG4A 1ZR0A 3HKIB 5KECA 2Y7ZA 1GHYH 4A92A 3F9FA 1MTWA 4ISOA 2PP6A 4ISNA 4D8NA 4UE7H 2ZQ2A 5FHTA 5F8XA 2G00A 4ZROA 5B6LA 3A7YA 2LELA 2Z9KA 3SV9A 2KAIA 3EYDA 4VGCC 1V2PT 1PPEE 1GCTC 1Y5AT 3M3VA 3P8FA 2YMSC 3A8DA 3MU8A 4Q63A 3MU5A 4B2CA 3PLBA 3UWIA 2PV9B 1BJVA 2QE7D 5JYIA 1KMHB 3ZZ7A 4M7GA 4XBDA 3SORA 3GYLB 1EP5A 1K21H 1KDQA 1BT7A 3TH2H 1TGTA 4Y7AA 1BOQA 3FP8E 1VCQA 2G4UA 1JBUH 1P57B 3GY7A 3DT0H 3ZVBA 1C5NH 2F9UA 1HB0B 1S0RA 1Y3WA 1QGFA 1CT0E 1BJUA 1C5WB 2SGDE 2ZIQH 1ZTLA 1O3OA 4XD7D 1NBME 3EA9A 4CRDA 1CA8B 1ZPZA 1QHRB 1QBVH 4B2BA 5EJZA 1WTGH 3UQVA 1VZQH 3OEED 1TNGA 2HOBA 3MH6A 3MNXA 1GJ8B 1V2NT 2OQUA 3CNRA 1SQRA 1U6QA 4DT4A 1HJAC 3BSQA 2ZTZA 3D23A 2PUXB 5H4IB 3OSYA 2QY0B 2BDIA 4AFUA 3V12A 2BY9X 2GCHF 1AWHB 2BOKA 1NESE 1ZSLA 1FIWA 3ZZ5A 1UK3A 3DFJA 3V13A 2AERH 2H1UA 1GMHF 5L2ZH 3A7VA 1HCGA 1O2LA 1SGFG 3FP7E 1SLXB 3E16B 1ZGIA 4J2YB 3RXBA 3RXLA 1XXDA 4UONA 1W0YH 1HUTH 1KXCA 4CH8B 1SFIA 2Y5FA 5L30H 3SO3A 3GY6A 3OU0A 2SGEE 3N99A 1D6WA 3ZZ8A 2G8TA 4NZLA 2GJGA 4RT1A 1ETSH 2FX6A 1C4V2 1L4DA 1QTFA 1O3EA 2PKAB 1QJ7B 2VIWA 3E0NB 3SI3H 1XM1A 1TGBA 1PPZA 1BTPA 1GJBB 1TBRH 1C1TA 1B5GH 1BMMH 1WYKA 3ZZ3A 2A4GA 2OXSA 3SUEA 4DGJA 1DE7H 2H9TH 1BMFD 4K8YA 1ZMNA 4K69A 2OTVA 5JDUB 1MABB 1HAGE 1BCUH 2EI8A 3V7TA 5TCCA 1UTMA 1UTQA 2XCNA 2CHAB 2PKSB 4ZXXH 4CR9A 4ABGA 4Y79A 1O2NA 1W14U 2V35A 5AHGH 3SGAE 3LKWA 3M7UA 5FAHA 1V6DA 5E0JA 1ANCA 1ESAA 1W11U 4UFDH 1K1LA 4HG6A 2NU3E 2QGRA 1C1UH 2ZC9H 1FZZA 2W7SA 3WW7A 1GJDB 4YESB 1C2EA 1T7CA 2BZ6H 1V2TT 1V2JT 2JKHA 3DSOA 2XBYA 2F43B 2B0FA 2G4TA 1V2QT 3QWCH 1DM4B 2D2DA 4PROA 3DFLA 5EOKA 5HYOA 3VXFH 1KYNA 9ESTA 1YPHC 3GYMA 4FU8A 4K1EA 2J98B 4DVAU 4O03A 1GHZA 1S83A 4YOJA 1P11E 3L6PA 2FYRA 2C90B 1BRBE 3CS7A 3TGIE 2ODYB 1SOZA 1ETTH 1WU1A 2ASUB 2Y82A 3A87A 1O5GH 3PM3A
chains in the Genus database with same CATH topology
3LJJA 1O2GH 2AMQA 1ANBA 3VFEA 3P6ZB 1G3DA 2PSXA 4MNYA 1P2OA 2FOBA 3ITIA 5AFYH 3RMLH 1C1VH 1V2RT 2WPLS 3E8LA 5FXLA 3VPKA 1O3MA 1NO9H 2SGPE 4ZKRU 2GGVB 1J16A 2AIQA 3QGNB 1DPOA 1FY4A 1QRZA 1KLIH 3KF2A 4Y8XA 1SFQB 1D3QB 3AW1A 3VB7A 3NZIA 2HRVA 1UCYH 3E3TA 3SGQE 1TX6A 1K2I1 1WTHD 3ZVDA 5C67A 1SGDE 2BLWA 3T25A 2AFQB 1P2IA 1DANH 1SQAA 1TNKA 1QL8A 1GMDG 3A7ZA 5DPAA 1QBOA 2FOMB 1GVLA 1O2HA 2OC8A 5JBTA 1THSH 1KXEA 1GCTB 4WVPE 3QGJA 2FO9A 1HIAA 3UPEA 4YZUA 2FM2A 1SLVB 2OD3B 3GDSA 4X1RU 1C2JA 4R0IA 3RXHA 5C3NA 1BMLA 2GCTC 2ODQA 4GCHF 4ABIA 1E35B 1S5SA 2O9QA 2QCYA 4X1NU 5DK1A 5DP5A 2WPMS 1ELCA 2QYIA 3MU4A 3VGCC 2SGAA 5AFZH 1C1RA 3SV2H 2VIVA 1QFKH 2CV3A 3SV6A 1MTUA 1YF4A 3SQEE 1PPHE 1UVSH 1GJ5H 3GCHC 5ESBA 2XC0A 3SI4H 3UNRA 1ELGA 1O2TA 1SBWA 1IQHA 2ZPSA 3RP2A 3A82A 2P8OC 1HXFH 4CRCA 2UUJB 3RXEA 4YOGA 2A0QB 3MH5A 1EJMA 4INLA 2A31A 2M5TA 2WPIS 1LVMA 2EA3A 1P02A 1A5GH 4GHQA 1CHOF 1SGQE 1C9PA 3MWIU 4MDSA 3ZZAA 3ZVEA 3SU6A 4ABHA 4BNRA 1FI8A 3RU4E 4IMZA 1VCWA 1V2VT 1DS2E 3PMJA 5CHAB 3TLOA 3MH4A 2GP9B 1FJSA 2AGIX 3HPTB 1EAXA 1MQ5A 1P9SA 1KSNA 2EI6A 1GBFA 3FZDA 2A7CA 3M3TA 1O3CA 2WPKS 4NCYA 3UWJH 1IQNA 1H9LB 1UCYK 2ZG0H 1T8NA 1O2IA 2OLGA 2OC1A 2ZTYA 1C5SA 1X7AC 4B2AA 1C5UA 4K5ZA 1C2FA 1BMNH 5EPYA 2BX4A 3MNCA 3MU1A 1GHXH 2A5AA 2BDGA 4MPXA 1GBLA 4NGAH 1RJXB 2ALVA 2C3SA 3RLWH 1TBQH 1EAWA 2BDYA 1QRXA 2WUBA 2BOHB 8ESTE 1MKWH 1EJNA 4AORA 2AIPA 2J4IA 1GI8B 2P93A 2CXVA 1DT2A 3P8GA 3D62A 3NKKA 4ZUHA 3TNSA 3QZRA 2BVSH 2ANYA 1MAYA 5K7RA 2ZNKH 1PYTC 5E0HA 1TNIA 1LQDB 1LPKB 4WXVA 2VIPA 1H9HE 1WSSH 1V2KT 1LHEH 1O2YA 1RRKA 2GZ9A 1RXPA 5GCHG 2PWXA 2A2XH 2CF9H 4ABDA 4Q7ZA 1GDNA 3TGKE 1QNJA 4JZEH 4FUFA 1GHAG 1K1IA 1GBMA 3BG8A 3PLPA 1ZSKA 1EOJA 2A1DB 3UFAA 1BITA 4ABFA 1EAUA 2Y5GA 3BTFE 1EKBB 2A32A 4WJG2 1MZDA 4DIIH 2THFB 1SQTA 1GJAB 2FP7B 1AKSA 2BDAA 1DSUA 4XDEA 1P2JA 1GBIA 1DWBH 5CE1A 2YNAA 4JZDH 3ZV9A 2AMDA 3O8DA 4LK4A 1TA2A 4X6NA 2ZHEH 4NZQA 3RDZA 3LGYA 1YP9A 4IC5A 1O5AB 3P8OA 1B0EA 2XW9A 1V2LT 4AG2A 1NN6A 1QA0A 1BUIA 2Y6TA 3GY5A 4ZKNU 1SL3A 2RG3A 1NFUA 3S0NA 1FPCH 1J8AA 4Y8YA 3EQ0H 1E38B 4AB8A 1GWAA 1MQ6A 1SPJA 4D7GA 3U1IB 4MNXA 4UFEH 4CHAC 3A8AA 2RCEA 1GBEA 2IPHA 2PGQB 4ESTE 1B7XB 3JZ2B 5C5OA 1MKWK 1SGFA 2ZKSA 4DY7B 4SGAE 1SHHB 1AVGH 3UY9A 1LVOA 2WPJS 1KY9A 2A4RA 2VVUA 1KXFA 1KXDA 2ZPRA 3EA8A 3TPIZ 4B74A 2H2ZA 4LXBH 1TX8A 4AX9H 2O8UA 2TBSA 3GY3A 2FESH 1ANEA 1P2KA 3AVZA 1VITG 1DSTA 1KTSB 4GSOA 3TK9A 5CMXH 2ZHFH 5L2YH 1BTUA 3HGNA 2F91A 3EGKH 2FTMA 2FI5E 2SNVA 3I29A 2O8MA 1NTPA 4IN1A 4OGXA 1TWXB 3FP6E 4AN7A 1YPHE 3Q3KA 3P70B 4NIWA 1UHBB 1D4PB 5BPEA 4BAQB 3ATWA 2VU8E 1QB9A 1O5FH 1C2IA 1L0ZA 1W12U 2ZWLH 2F83A 1CGHA 3FVFB 1G36A 1JIRA 3VGCB 2H9HA 2C8YB 1HJ8A 3QN7A 5C20A 2FIRH 2B5TB 1CU1A 2WUCA 3R3GB 3QTVH 3MMGA 3RC6A 2FYQA 1O3BA 4I7YH 5DKMA 1BBRE 3QTOH 1E0FD 4NSVA 1FY8E 3RC4A 2P3FH 3TITA 1SSXA 1DLKB 4DG4A 1HAVB 2B7DH 3E0PB 1ZGVA 1OWDA 1C1NA 4X8TH 3N7OA 3SQHE 2Y81A 3F1SB 1T32A 1YPJH 3B23B 1L1NA 1FN6A 3A80A 3BN9A 1O2XA 2R3YA 3H5CB 1QJ6B 2BDBA 4Q7XA 1FAXA 2I6SA 4O9VA 3NCLA 2ZCKP 1O2WA 1F0SA 3A83A 1PPCE 1TGCA 3VEQB 2QV1A 3BTTE 1A3BH 5F03A 3NXPA 2AH4X 1LDTT 1BTZA 1GG6B 2F9NA 3A84A 2WPHS 3A8CA 1ACBE 1AUJA 1TPPA 4Y71A 2NWNA 1GJ9B 3RXTA 4OS4A 3RM0H 5LGOA 2VWMA 5K0HA 1TPAE 1O39A 3OX7U 4XSKU 3RXIA 2Q1JA 3FAOA 4MNVA 1Z8RA 2PKAA 3MNSA 4NIVA 3ZYEA 1HAZB 1RTFB 3WY8A 1TFXA 2LNCA 2FOFA 4INKA 3IWMA 5FBEA 1S6HA 1AFQC 4AFSA 1ELFA 2JETB 5DP4A 4Y10E 4I32A 1AB9B 2GT7A 4X8SH 3VB3A 3UQOA 5GPIB 3SUGA 3QLPH 2GZ8A 1CA0C 4UFFH 5HM2A 1BRCE 2STAE 1S6FA 5E2PA 1Z71A 2BD7A 2HPQH 1NU7B 2AGGX 1D3DB 2FI3E 5DP3A 1UMAH 3BIVH 4JMYA 3A8BA 2Q6FA 5A8ZA 1AMHA 1NRPH 1NT1A 4XFQA 1P05A 2CMYA 3SV7A 1GI6A 1G3BA 1AIXH 1C9TA 5F8TA 1P01A 1A7SA 2OCVB 2JH5D 2NU0E 1Z1JA 2ZFFH 4TY6A 1GL1A 3PV4A 3CP7A 2OBQA 3ZV8A 1O36A 2WYJA 3BTWE 3KGPA 1O5DH 1EZXC 1SG8B 4OGYA 1ABJH 2TGDA 4NFFA 2W7UA 1WQSA 1G3EA 1DY9A 4MPWA 1FY3A 3PO1C 2Z3CA 1DOJA 1TNHA 4MPUA 1O3IA 4HZHA 4MNWA 3UIRA 5GDSH 1HGTH 4UD9H 4D9RA 2F9BH 5LH8A 2G81E 1MTNB 2J95A 5A8YA 3C27B 1TQ7B 4H6SB 1HV7A 1FPHH 1VITH 1H4WA 1JRTA 2F9PA 2VH6A 5TJXA 4I8GA 5HGGA 1IQEA 4TPIZ 1AU8A 3ODFA 2BQWB 2AYWA 2RA3A 1AI8H 1ZJDA 1SLWB 3GOVB 3U9AH 5AVDA 3MOCA 7LPRA 1E36B 4BTUB 4A1TA 1EATA 1BHXF 2FOAA 4INHA 1HAOH 1C5XB 1EAIA 3RC5A 1S81A 2YNBA 4K1TA 1EZQA 3CENA 3SU0A 4CRFA 5FX5A 1YC0A 4KTUA 3URCA 3TH4H 1AUTC 3AAVA 1O2MA 1TAWA 1KXBA 2QXIA 1GBCA 2QXHA 3GCNA 1A2CH 4I8HA 3GDVA 2W3IA 6GCHG 5DG6A 2G55A 1NZQH 1EPTA 1TABE 3M37A 3RXVA 1W0ZU 1XUHA 2XYAA 1AZ8A 1YCPH 1JWTA 1T31A 2VINA 5E8EH 2WV4A 1O35A 4BAHB 1E37B 2ZHQH 4DT7B 4XE4A 1YLDA 2R2MB 3BV9B 1V2ST 1N8OC 1MMJN 1MU8B 4X0WU 3SGBE 1VCPA 1QL9A 3TK5A 3Q76A 1QR3E 3RMNH 5SGAE 1C2MA 2ZFQH 1K28D 1HRTH 1XX9A 3KIDU 3S9AA 1ELEE 4HFPB 1DITH 4B1TA 2RA0A 4JK6A 1QJ1B 2GX4A 1XKBC 3S7KB 2IOTA 2Z3DA 1W7GH 3RU4D 3PMAB 5PTPA 4FU9A 1WV7H 2VGCC 4ZKOU 1A3EH 4AB9A 5FX6A 2CGAA 4X6OA 5GJ4B 4ZKSU 2FS9A 1O33A 1ZHMA 3NWUA 1DUAA 3LH3A 1IQFA 7ESTE 2O8TA 3H7TA 4NA7A 1A5IA 1F5RA 2ZTXA 2Z7FE 1CHGA 4AGKA 1MAXA 1O3PB 2XC4A 5EQSA 2GV6A 3FZZA 4BTIB 3BEUA 2H5CA 2HPPH 1S0QA 4B73A 2P95A 1BTHH 2W5EA 2XCFA 3ZVCA 1RD3B 1B0FA 4TWWA 1PJPA 1QQUA 2H9EH 1O2KA 1GBDA 3NUMA 4Z0KA 1C5QA 3RXCA 2WV5A 2BDCA 3RMOH 1P0SH 4E7NA 1Y3XA 1OWEA 1G9IE 3MYWA 5JB8S 1IQKA 4FUEA 1QY6A 5EQRA 4D76A 1TYNA 1AE5A 4WWYA 1VR1H 2ZZUH 4I8JA 3V3MA 1QB1A 4VGCB 1DWEH 3KL6A 1AE8H 6CHAC 1VGCC 3KQBA 1TIOA 1FQ3A 1ETRH 2TPIZ 1TBZH 4A1VA 2BXTH 1HFDA 1BMAA 2A4OA 4IN2A 4NFEA 1MU6B 3PLKA 2BD5A 1XVOA 2B9LA 1ABIH 2ZDLA 3VXEH 1SHYA 1UK4A 4CRGA 5EXMA 1QQ4A 1T8MA 1GHAF 4TYDA 5DP7A 1GBTA 1XVMA 2A5KA 2QF0A 4O3TA 3PTNA 1BZXE 1GBAA 1CBWC 2ZEBA 1UK2A 1RGQA 5GXPA 1YPKH 3P92A 1BB0B 4FVBA 4FUJA 3GDUA 1W7XH 1BDAA 4YM9A 1P04A 1ELTA 1N6YA 2ZU3A 2UWLA 1QCPA 1PQ7A 2VWNA 2OC0A 2UWPA 4DURA 2XBWA 3PYHA 3L33A 5E2OA 1TA6A 4IMQA 3F9HA 1DXWA 1FAKH 2SNWA 3RXQA 1Z8GA 2XTTB 1ZHPA 5T6FA 3TJNA 3ZZDA 4D9QA 5DP8A 5A8XA 1HJAB 4BAKB 1BRUP 2BZAA 1HXEH 2OQ5A 1KTTB 1GBJA 1HLTH 4U2WA 1XUKA 3AW0A 3K65B 2BY7X 1HPGA 3SU1A 2BHGA 1AY6H 3W94A 3T2NA 1FN8A 2FODA 1H9IE 1A0HB 1UTNA 4LZ4B 1OOKB 2FS8A 1T4UH 1C5YB 3OTJE 4X2VA 3M5NA 1GVZA 3ESTA 4Y7BA 2NU2E 4J1YA 2DE8A 1LVYA 3I78A 2F3CE 4YLQH 3RXAA 1DX5M 2O8WA 2BMGB 1THPB 2NU4E 3HKJB 2ZHDA 1MBQA 1PPFE 3H7OA 4WMEA 1K1MA 5EU8A 5T6GA 1C1MA 3SNEA 1G3CA 1H8IH 3KCGH 5LPRA 3K2UA 1GPZA 4NA9H 3ZVGA 1FNIA 2R2WU 1O5CB 1GBHA 1VJ9U 1ESTA 4FXGH 1EZUC 1GDUA 1GJCB 1OSSA 3LDXH 3SNDA 4BANB 2F9OA 2ZGCA 1O3DA 4CH2B 1Y59T 1TALA 2RDLA 3GCOA 5JBCS 1V2MT 2D26C 3UNQA 1C1OA 1RFNA 3BIUH 3TIUA 3GY4A 2FWWA 2AEIH 1HAXB 2BVRH 1XUFA 3ATKA 1TMTH 2ANKH 1SMFE 1DWCH 4TWYA 1PPBH 2BY5X 1LKAA 2A5IA 5J4QA 3O8BA 3A7WA 2V3OH 4OS1A 1EJAA 3LJOA 1TGSZ 3ODDA 1TRNA 3ATIA 3KQDA 1ZMLA 4AZ2B 8GCHG 4CR5A 1N8OB 1W3CA 1ZZZA 1ZPBA 4GUXA 2R0LA 1Z1IA 3VB4A 2XRCA 4Q7YA 2A45B 1XUIA 2P94A 1O2UA 5JB9S 4AG1A 5B6OA 2W3KA 1ORFA 2Y80A 2ZF0H 4GCHG 5T3HA 1XMNB 3E6PH 4CBNA 1GVKB 1GHBG 1A5HA 1GGDC 1P9UA 3RLYH 4TY7A 2QC2A 1UTPA 2FMJA 3KHVA 3LGVA 7GCHF 1ZYOA 1MCTA 5A2MH 1QIXB 1F5KU 3P95A 1MD8A 1AWFH 3RU4T 2XWAA 1TNLA 3TNTA 2OUAA 3TK6A 4H4FA 1TLDA 1J17T 1LCYA 1NFWA 3EE0B 4DIHH 1L4ZA 2GTBA 5EW2H 1UTOA 2W26A 5HXFA 3PTBA 1ARCA 1V2WT 1WOFA 3RXFA 1CT2E 1N1LA 3R0FA 3M5OA 3T26A 3ATMA 4SGBE 1EP6A 2SGFE 4X1PU 3T5FH 4X8UH 5L6NH 1LTOA 2ULLA 4FUGA 1BQYA 1OP2A 3NK8A 4BAOB 1UTJA 1AVXA 3CS0A 4IW4E 4OS6A 1P3EA 1EX3A 1GJ6A 1SGTA 2AGEX 3LC3A 1GI0A 1NM6A 3O8RA 4WMFA 4FUDA 1P8VC 3LT3A 1OYTH 5C2ZA 5JBAS 3RXPA 2PKSC 1FY5A 1Z7KA 4RSPA 4DW2U 2DUCA 2FOHA 1AN1E 1FONA 1O32A 4B76A 5LPFA 2LPRA 1YBWA 4YTAA 1O2OA 2UUKB 1GI2A 2PTNA 2XNIA 1LPGB 1IHTH 1VGCB 5I46H 3TH3H 4FUCA 1PQ5A 2V6NA 3C1KA 5LPEA 2UUYA 4NG9H 4GAWA 1W13U 1WAYB 2I6QA 3EAJA 2GCTB 1TE0A 1TRMA 2ZP0H 1Z8JB 3SUFA 1D9IA 5C1XA 1C1WH 4MTBA 4YLUA 2ZGHA 4DOQA 1F0TA 1JIMA 5C5NA 3UR6A 3T28A 1O2SA 1ELVA 3SU3A 3BTEE 1ARBA 3B9FH 8KME2 4MG3A 1P3CA 2OC7A 5DJ7A 3LGUA 3ZZ9A 3GCHB 2BD4A 5HMAA 5HM9A 4I8LA 4XOJA 1AZZA 4MQAA 4I31A