2RCEA

Dfp modified degs delta pdz
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
215
structure length
204
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRTGRQNFLQTDASINHGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DFP modified DegS delta PDZ
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 43
structure length 204
sequence length 215
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rceA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rceA02
1FY5A 5A8YA 1SSXA 1MCVA 3PYHA 4NA9H 2TBSA 2QGRA 1S5SA 1ELGA 1C5SA 3KGPA 1NRPH 4ZKSU 1NFXA 3SI4H 5C3NA 2ZHQH 1CGIE 1OYQA 4YOIA 1ZZZA 2A45B 1Z8IB 3ZV9A 1O2GH 4ABBA 1Q2WA 5C5OA 1V2UT 1IQNA 3VB7A 1Z8RA 1TGCA 4UEHH 3UFAA 1GJ5H 2ESTE 1O36A 1P06A 3RXUA 2FPZA 1BTXA 4MNYA 3QN7A 1P12E 1THPB 2CMYA 2I6SA 3ZZ9A 4B2CA 1K1OA 1PJPA 1RTFB 1UK3A 3S9BA 1ACBE 3UTUH 1VITG 3ATMA 1DM4B 2G81E 1EJMA 3UQOA 2ZFTA 3M5MA 1C9TA 5L2YH 4Q7ZA 2VIWA 1T8NA 1ARCA 3T25A 9ESTA 1MKWH 1SQAA 3VGCC 1ANEA 4BAKB 1VCQA 2FTLE 5EW1H 2UUJB 4U30A 4INHA 2KAIB 2R3UA 3AVZA 1BTPA 2JH5D 4IC6A 2VIVA 2G55A 1PPZA 1O2IA 2BD9A 2BQ6B 1PYTC 2XXLA 3RXLA 2OINA 1AMHA 3KQEA 1CO7E 1ELAA 1V2VT 2YNBA 4OS1A 1VJ9U 3U69H 1JIMA 4K5ZA 1E37B 1C5YB 2DUCA 4KTUA 4SGAE 1S0RA 3P70B 1RJXB 3ATKA 5ABWA 1BTZA 4DY7B 4NIXA 1KYNA 5EODA 1O2JA 1MD7A 3UR6A 3B8JA 2TGDA 1O2MA 2GKVE 3QZRA 1FJSA 3RXKA 3ZZAA 1GHAF 2ZFPH 1HXEH 1F5LA 1NFWA 5GIBA 5F03A 1BITA 1CE5A 2GMTB 3C1KA 3IITA 2PKAB 1O37A 1HAHH 1MCTA 1SR5C 3P8GA 2TRMA 4FUBA 3TH2H 1J15A 2CJIA 4X2VA 1GBJA 1VR1H 3GCOA 1EOLA 3PWBA 1B0EA 4K1TA 1UVSH 1XKBC 2A0QB 2UWLA 3LONA 1JWTA 4X8TH 1LTOA 1K1MA 1E38B 1E35B 4R8TB 2EEKA 4A1XA 2VGCB 3TVJB 1KLIH 4A1VA 1BTHH 1SOZA 1GHXH 1DFPA 2Z9IA 1ZMNA 1EB2A 1SGFG 1DLEA 1NRRH 3ATLA 2ASUB 2FWWA 2F9UA 4WF8A 3A80A 1AB9B 3M36A 3BTKE 2JH6D 2M5TA 5BRRE 1YPJH 2GMTC 1AE8H 4BTTB 4DOQA 1MQ6A 2FO9A 5EW2H 2P3UB 1TPOA 1ETSH 1ANCA 2G51A 4AN7A 1UCYK 3MO3A 2FOEA 4FUIA 2BVXH 4DJZB 1QRZA 2P93A 3GYLB 2DE8A 1FAKH 2P8OC 1Z8JB 3TJOA 1SG8B 2FESH 1A1RA 1P2MA 3MU0A 1UTPA 2A7CA 1SGEE 4ESTE 1T8LA 1IHTH 6GCHF 3A89A 2OD3B 4U32A 1DLKB 1QRWA 2FDAA 4BTUB 1MTNC 4MPXA 1HIAA 1AZ8A 2P8OB 3IWMA 4MQAA 3WY8A 1QB1A 4LOYH 1OWHA 1O3NA 2ZPQA 3SNEA 1AUJA 5C1XA 1KXAA 4GCHG 1OXGA 5DP7A 4OS4A 1QR3E 2ZTZA 4B2BA 3TJNA 2Y82A 3RUOA 4QT8C 4LK4A 4ZROA 1Z7KA 1TQ7B 3PMJA 3MMGA 3S7KB 2BOHB 1C1UH 4ZHMU 7GCHG 1AB9C 1Y3XA 2ALPA 4FUJA 1TNKA 2OQ5A 2ZIQH 3SO3A 1HBTH 4YO9A 3UNQA 1GVZA 1NFYA 3AW0A 1IAUA 3RXOA 1XKAC 3QK1A 2BD2A 4X6NA 2ZP0H 1C5VA 4B75A 2QV1A 3GCTG 1UTMA 3ZYDA 1S0QA 3PB1E 4JZDH 3BEFB 4BAMB 1TAWA 4X1QU 1Q31A 3ENSB 1TGTA 2CV3A 2BXUH 2CHAB 4CRBA 1NT1A 3SI3H 2GTBA 2F9NA 1TOCB 2EI6A 3A7WA 1UO6A 1K1JA 3UWIA 2Y5GA 4R0IA 1ZLRA 1BMAA 2AIPA 3BTWE 1OWDA 1GHWH 2VIDA 5HM2A 2P3FH 2PFEA 3TITA 1BB0B 2W5EA 3K6ZA 1H9IE 1J14A 8KME2 4A6LA 1DE7H 1YLDA 1MUEB 2Z3DA 1UTLM 3NZIA 1ESBA 5EPNA 3GYMA 4MNWA 2GCHG 2J92A 1GI1A 1D3QB 1CA0B 4BNRA 4AYYB 1ZYOA 3SV6A 1GMHF 2BVRH 1CA8B 1GL1A 1GHZA 1SBWA 3GCNA 4B76A 3LGWA 1C2LA 4LZ1H 1MH0A 2GVFA 3KNXA 4AFZA 4CRGA 4HFPB 2BZAA 3TNSA 5LPFA 4NZQA 5T6GA 1C1QA 3K65B 3F9EA 1Z1IA 1PPCE 2VJ1A 3PLPA 1AWHB 4YZUA 2WPKS 1V2NT 3SU2A 4CH8B 2V3OH 1P09A 1NU7B 1G32B 4A1TA 4E06H 1YCPM 1IHSH 1ZSJA 1KTSB 1FN6A 4JK6A 2WV5A 3AAUA 2H5DA 4UFGH 1TGBA 2R3YA 1O2TA 3PO1C 2VNTA 1JRTA 1HGTH 1FPHH 4UFEH 1EAUA 1QRXA 1TB6H 3ELAH 1MKXK 2AFQB 2TGAA 2OLGA 1GJ8B 1AVWA 1C5XB 3GY3A 3RXCA 4X8UH 3HPTB 5E2OA 5CE1A 1OP2A 4CRAA 1C1MA 1MZDA 5JYIA 1DDJA 3LGIA 4VGCB 1W2KH 2FX4A 5FPSA 3RU4E 2OC8A 2RDLA 1RRKA 1WAYB 4WMDA 1O5CB 1AFEH 1RS0A 1D3PB 2Z9KA 1ZGVA 1UCYH 3MO9A 5A0AE 1C4V2 5FCRA 2ZGJA 4UFDH 1A3BH 1GI7B 1CSOE 2PR3A 3VEQB 1HV7A 1P04A 3M37A 3JZ2B 2ILNA 3PROA 1GHVH 3LDXH 3U1JB 3A7YA 1S85A 4A7IB 4FU8A 1O2LA 2XBWA 4DT7B 4LXBH 1ZPBA 1GCDA 1FN8A 4X6PA 1AWFH 1O38A 2VWNA 1N6XA 3ATIA 1HJAC 1O5EH 3HATH 3F6UH 4Y79A 3TPIZ 3A7ZA 4KTCA 1GBEA 1HAIH 2FI3E 1GVLA 3MOCA 3UUZA 1BBRK 3RXPA 1EQ9A 5J4QA 1LO6A 3LOXA 2OC1A 2BDGA 2FM2A 1W13U 1C9PA 2D8WA 3MFJA 3SU4A 3EE0B 2HNTC 3NK8A 3LGYA 5AFZH 3RC6A 2DE9A 4Q7YA 4YT6H 5E2PA 9LPRA 1QL7A 1XVOA 2H9HA 2FLRH 3E91A 3UOUA 4AFSA 1SMFE 1O3FA 1LHFH 1TLDA 1SLWB 3Q3XA 4Y76A 2F83A 3TLOA 3SNCA 3TNTA 4JZFH 2ZU3A 4ABHA 1VZQH 1ESTA 2BY8X 4DIIH 4ISLA 3PLKA 2VVUA 1RXPA 3A83A 4NFFA 3OYPA 5J4SA 1O2XA 1RIWB 4BAOB 4ZUHA 1MU6B 1THSH 3ZZCA 1V2TT 2YNAA 1DY8A 4IC5A 2OUAA 5HGGA 2JETC 1BRCE 1AY6H 2J94A 1A5HA 2P3TB 4YLQH 3GCHB 1C2EA 1G9IE 2XWBI 1NTPA 3G01A 1DICA 5DGJA 2Y80A 2FOCA 4NZLA 1IQGA 3HK3B 1PPFE 1EAXA 2VU8E 1FDPA 4MPVA 3QTOH 1YKTA 1AU8A 3U1IB 2BD8A 1ABIH 3M7TA 4ZKRU 3ZZ4A 4DW2U 1BMLA 1E34B 1GJ7B 4I8KA 1Q3XA 5IDKA 2AGEX 2Y7ZA 1TBZH 4I32A 4ISOA 3GY8A 4ZAEA 1N1LA 3RC5A 1DWCH 1A5IA 4H42U 2PKSC 5GWZA 1GMDG 1NN6A 3SN8A 1NRQH 4ABEA 5FAHA 4YOJA 3DT0H 6CHAC 4AORA 2PGBB 1HB0B 5A2MH 1HXFH 1WV7H 1XUFA 3BTHE 5ETXA 4DIHH 1ZPCA 1C5NH 3Q76A 1INCA 1KLJH 3JZ1B 4Y7BA 1DVAH 1G3CA 2OP9A 3QWCH 2HGTH 1BHXF 3R3GB 1L4DA 1TPSA 2TGTA 5A0CA 1LQDB 3RMMH 5EXMA 1O3JA 3D65E 1WUNH 3TGJE 3SGBE 2F9OA 2BX3A 1GBMA 2P59A 5F8ZA 1K21H 4D9RA 4FUHA 5K0HA 1JBUH 4IGDA 3E6PH 2H9TH 1S6FA 5DPAA 1T31A 1UK2A 5L2ZH 2J9NA 1P57B 1TX6A 1O2HA 1RD3B 1XUGA 3NPSA 1NROH 2ODYB 4UE7H 2PWXA 4ZKNU 1FIZA 1K2I1 2ZHEH 1L4ZA 2SNWA 2ZZUH 4I8GA 2RA3A 3CENA 1ELDE 1IQMA 2A1DB 2FYRA 3PMAB 3RXBA 5DK1A 4ABJA 2O8LA 1T4UH 1TBQH 1V2MT 2XCNA 1GHBG 1EZSC 4OS5A 1ESAA 3KF2A 2GGVB 3RM0H 2GDDA 3P92A 4OS7A 3MU1A 4Y8ZA 3LT3A 2Z3EA 5C20A 2A32A 1SGCA 1V2ST 2CF9H 3NXPA 1OX1A 2J4IA 5LPRA 2BDHA 3M5OA 4MNVA 3NWUA 4X2WA 3D49H 4GHQA 1H8IH 2ZHFH 1DY9A 3QTVH 2Q6GA 1AVGH 2ZQ2A 4UFFH 1CVWH 1HLTH 3RXIA 5A0BA 2B0FA 2ZGXH 2R2MB 4GPGA 2RG3A 1C2KA 1HCGA 1P10A 2CHAC 2WYJA 1NFUA 1QA7A 4D7GA 1IQEA 1C1WH 4MG3A 2BB4A 3SQEE 1F92A 3UR9A 5AF9H 3VXEH 1MBMA 1O34A 4JZIA 1ELVA 1GVKB 1PPGE 1EOJA 2VH6A 3VB5A 2G8TA 5T6FA 2ANWA 4FUCA 4NIYA 2J34A 1EPTC 1G3BA 4NIWA 2ZPRA 3MHWU 1DXWA 1GBHA 3SORA 2Z7FE 2PLXA 1EASA 2CGAA 1F2SE 1GI5A 1DSTA 2JH0D 1XM1A 1U6QA 1GJCB 4TWYA 1GHYH 3B9FH 2BY9X 3MNBA 1WU1A 4ZMAH 3FZZA 2V0BA 4ZXYH 2HRVA 3SBKA 1Z6JH 2FMJA 5E0HA 3RU4T 3KEEA 4MDSA 2EA3A 8GCHF 3M5LA 3T26A 2Z6BD 2EI7A 2WPJS 4ISHH 1PQ8A 3LH3A 1T4VH 2FI5E 1LHCH 2GCTC 4GSOA 1MTUA 4NGAH 5DO4H 1SB1H 1YPKH 3URDA 1SFQB 2PKSB 2BLWA 1TGNA 4THNH 1HAOH 2H5CA 1TPPA 3ZZ7A 4UDWH 1Y8TA 3BF6H 1BDAA 3EDXB 1HDTH 5DP5A 1YM0A 2TPIZ 1F0UA 1O39A 3F1SB 3RC4A 2HWLB 2FOAA 1T8MA 1P3CA 3O8RA 3QUMP 3SU0A 3MU4A 2A2XH 2EI8A 1C1OA 4K8YA 3LGUA 2AH4X 2ODPA 1GJDB 3UREA 2SGDE 1XUHA 1A46H 5GCHG 3GOVB 3FVFB 3RXEA 2P95A 1P2KA 1GBTA 5LH8A 2WYGA 1N8OC 1GBCA 1DITH 1O5BB 1TIOA 5EXLA 1B0FA 1GJAB 1Z71A 2FOFA 1L1NA 3HGPA 1C5RA 1TQ0B 3BG4C 1VCPA 3DFJA 4NA7A 1SGRE 1NZQH 3EYDA 2ULLA 1V2WT 1DWDH 1O2PA 1O2QA 3QGNB 3TH3H 1BTWA 1ZMLA 1TRYA 3SUDA 1CHGA 1Y3VA 2O8UA 2WINI 1C1RA 1ZTJA 2QY0B 1FV9A 1O2ZA 4GAWA 2UWPA 3SV9A 1W0YH 3MYWA 2BVSH 4O3TA 4NWKA 4BXSA 3GISB 3ZVDA 2VH0A 2B9LA 2RCEA 1O3BA 1LHGH 1ANDA 1QJ6B 4H6TA 4I31A 1W14U 2HLCA 4INKA 1O32A 2W3IA 3OX7U 3TIUA 1MKXH 1UK4A 2QCYA 5A8ZA 2GDEH 2K1QA 1DSUA 2G4TA 1Y3UA 4MNXA 4B73A 1M9UA 1SLVB 3L6PA 3QX5H 2PSXA 1FY1A 1HIAB 4WWYA 3A7XA 1JXPA 1WQVH 3I29A 2BX4A 4KTSA 3ZVFA 2H9EH 2GD4B 4ABIA 2XRCA 1A7SA 1W11U 2VVVA 1AVXA 1IQFA 4J1YA 3ZYEA 1HRTH 4BTIB 3DD2H 1CGHA 3IG6B 1G2LA 1H9HE 1P8VC 5E8EH 3Q00A 5FBIA 1VITH 2Y5FA 2F91A 1J17T 5GCHF 2P16A 4MPWA 4FXGH 3TJUA 5DG6A 2ZCLP 2ZU4A 1QBOA 3E0PB 1QGFA 4AYVB 3ZZ6A 2SGQE 4Z6AH 2R0KA 1F0SA 2BDCA 3T2NA 3SJIA 3SUEA 1T7CA 1VCWA 2A7HA 3KQCA 2D2DA 4GLYA 1WCZA 4JMYA 3S9CA 3CS7A 1IOEA 3NKKA 5GDSH 2PW8H 1SGTA 2FOHA 2OBOA 3OTJE 4UD9H 5C1UA 4K1EA 1C4U2 1SGPE 1WYKA 1H4WA 3Q3YA 1L1GA 2BMGB 3O8DA 3KN2A 1V2OT 3GDUA 4CR9A 4I8JA 1YPEH 2AS9A 5BPEA 5A09A 4IW4E 1SC8U 5EGMA 2XBVA 1EB1H 2ZF0H 2XYAA 1OWJA 3U9AH 4MLFB 2Z3CA 2BLOA 1CT0E 3SOSA 1D3TB 1NY22 4IBLH 4Q7XA 1IQIA 5T6DA 1C2FA 1UTQA 1K1NA 3PMHB 5JBTA 1S84A 1BQYA 1K1IA 3RXDA 5GJ4B 3U8OH 1GI8B 1N6YA 1O30A 3V13A 1UJ1A 1SGIB 2QAAA 1TA6A 2NU2E 4JZEH 1BZXE 4TPYA 3AASA 2AERH 2VINA 1C1SA 2QA9E 5LPEA 1D6RA 1ZTKA 2V6NA 4JK5A 1DPOA 3W95A 1P9UA 2ZQ1A 3ZVEA 4GVUA 4E7NA 1S6HA 3K9XB 3SV7A 1FUJA 3EA8A 4K69A 1PPBH 4YT7H 2AMDA 1S82A 4XE4A 1C5TA 1ANBA 2BQWB 2XCFA 2J95A 3M3VA 3PWCA 2ZTXA 2A4RA 4AGJA 2KAIA 2BDIA 2FZZA 3ITIA 4XFQA 1RTLA 2OQUA 2F3CE 5FX5A 3UPEA 5CHAB 3SJKA 3RXMA 4CRDA 6GCHG 1GI0A 1C5PA 1EAWA 2BD5A 1VITF 2VVCA 4XBCA 1GMDF 1SLXB 3A7VA 5HMAA 1KXBA 1EAIA 3TU7H 3FP7E 5DP9A 3BN9A 4CHAB 1WQSA 3RXTA 1HAYB 1DXPA 1GJBB 4JZ1A 4M7GA 3B23B 1C5WB 1GMCG 3BTME 1Y59T 1SHHB 2A4GA 1NPMA 1TPAE 2EC9H 2ZFFH 3CS0A 4IMZA 2ZDMA 3RP2A 3E16B 3HKIB 4Z0KA 1IQKA 5EQQA 5EQRA 4DCDA 1NC6A 1TOMH 4GUXA 3RLYH 3LIWA 4JYUH 1PQ7A 3ZZ8A 1DWBH 1OS8A 5IYTA 2C8XB 3P6ZB 1W8BH 3RU4D 3A86A 3SQHE 1J16A 2C8ZB 1C5OH 1C1NA 5EPYA 3EQ0H 2W7SA 1Y5UT 1O5GH 2C4FH 1VGCC 1TMUH 1AFQC 2OTVA 5GXPA 2IJOB 1BCUH 3KQBA 2BY7X 2SGPE 4FUGA 3MH7A 2Z9LA 4O9VA 5TCAA 1ORFA 3L3TA 1ZOMA 3HK6B 1QHRB 2NU3E 1OSSA 5H4IB 2JKHA 4INLA 1AI8H 1O3IA 3RXHA 4CH2B 1O3LA 1THRH 1V2PT 2GCHF 4RN6A 2UWOA 2ZCHP 4ZHAA 4Y7AA 1EX3A 1D9IA 1YCPK 1TX8A 1JMOH 2HPPH 2BDAA 3BTQE 7KMEH 4B2AA 1C1VH 1P0SH 2PV9B 1V2JT 4AFUA 3ODDA 3A82A 3URCA 3SUGA 1BA8B 4JCNA 3SNAA 2FP7B 2GP9B 2LPRA 1D3DB 2ZGBH 5FCKA 1CHOG 4BAQB 3ZZDA 2ANYA 3VFEA 2A2QH 3PLBA 3A8DA 1P05A 5C67A 6CHAB 1TRNA 2ANKH 5JB8S 1AE5A 1AZZA 2J38A 1E36B 1BIOA 1RFNA 3RXVA 4K1SA 1Z1JA 5ESBA 2BZ6H 3ZVAA 3GY7A 5FXLA 1MMJN 2SFAA 3P8NA 4KP0A 2D26C 3M61U 1OP0A 2ZC9H 2BDBA 2PTNA 1F7ZA 2UUKB 5FX6A 1O2WA 3UQVA 2FEQH 2XC4A 1H9LB 2PUXB 2FXRA 1KDQA 1LPGB 3SU1A 2XC5A 1DOJA 1UTJA 1Y3YA 1VGCB 2WPMS 3LJJA 1J9CH 3LJOA 4Q80A 4FUFA 5A8XA 1MTSA 3ZZBA 2QIQA 2OXSA 5CMXH 1OKXA 1OP8A 5C1YA 1HYLA 3SHAH 1GGDC 2JETB 2ZHWH 5B6OA 1MTWA 1MZAA 2ZFRH 3GY6A 3FP8E 3ZVBA 4NCYA 2XC0A 4O3UA 4NSVA 1TALA 3PV4A 1C5UA 1Z8GA 3BEUA 3GICB 3RXFA 1AKSA 1ELTA 3N7OA 1NESE 3SV2H 3O8CA 2Z9GA 2PSYA 2Y7XA 1P03A 3P8OA 3RXSA 2VWLA 1O5AB 1V6DA 2CF8H 4FUDA 1Y5BT 1AUTC 5HYOA 5I46H 1O0DH 2QN5T 1OWIA 3MNCA 1ZPZA 1G30B 1KIGH 1P9SA 3S7HB 4WH6A 3BTFE 2ZCKP 1UTOA 1C4Y2 7GCHF 4X6OA 2LNCA 1AQ7A 5AVDA 5JBAS 3UNRA 4IMQA 2SGAA 2FTMA 4B71A 1L2EA 2A7JA 1G37A 2HALA 4BXWA 1O2SA 4ISIH 1O3GA 4K60A 1BBRE 2WV4A 2BHGA 2W3KA 1EZUC 1EJAA 1QFKH 3RXRA 2VIPA 5C2ZA 2FIRH 3H7OA 2TIOA 3LC5A 3Q77A 3VB6A 1A0JA 1GBDA 3A85A 4U2WA 4ABAA 2ZWLH 1LKAA 1TWXB 2H2ZA 3M3SA 1AD8H 1PFXC 1TYNA 5HM9A 4SGBE 1WTHD 3GY5A 1ABJH 3MI4A 3SU3A 1NO9H 1O2KA 1XMNB 2P94A 4LZ4B 2BD3A 1ZGIA 5JBBS 2NU0E 5DJ7A 4WVPE 1TNLA 1LHDH 3I78A 1LVOA 1B5GH 1GHAG 2HVXA 4AFQA 2WPLS 2Z94A 4DG4A 2BD7A 2QC2A 4WH8A 2NU1E 4F4OC 2G52A 4RKJB 2WPHS 3LU9B 1F0RA 5LGOA 1C2GA 3BTTE 1W3CA 1GI2A 2G5VA 3OSYA 5CHAC 2RA0A 4H6SB 1AGJA 1GWAA 2OC7A 2ZTYA 2ZO3H 2XW9A 3F9HA 4XDEA 1BTYA 5F8XA 4AOQA 6ESTA 1GCTC 3ATWA 1Y3WA 1UMAH 3MH4A 1AN1E 1BRUP 2ZDNA 4IN2A 1O35A 2ZU2A 1TE0A 1G3DA 3VB3A 2ZU5A 3ZVGA 1QNJA 5EU8A 2V3HH 2GZ7A 2ZEBA 1GBAA 2ZU1A 1O5DH 1HAPH 4D8NA 3LGTA 1EZQA 1TGSZ 2A4QA 1C2JA 1GMCF 1Y5AT 1MKWK 2UUYA 1O3MA 3A87A 1MAYA 3UWJH 1QJ7B 2C93B 2ZI2H 1GI3A 1RGQA 1P3EA 1P2JA 1LMWB 3CP7A 1S81A 2ZNKH 3SNBA 1YGCH 4AB9A 4Y71A 1FIWA 4K2YA 2ZDKA 6LPRA 1PQ5A 1W10U 1QQ4A 5AFYH 3VB4A 4I8LA 2Q6DA 2BDYA 2SNVA 4KGAA 2J2UA 1HUTH 3SUFA 1IQJA 2G00A 1SHYA 1A5GH 3FANA 3I77A 1O3DA 1BTUA 1C2DA 1F0TA 3A8AA 1KY9A 3U8TH 4U01A 3TK9A 1SI5H 3S69A 4X1NU 1YC0A 3RM2H 1DWEH 2NU4E 3TGKE 3EAJA 1H8DH 4YM9A 4ZKOU 3A88A 1TX7A 2ZGHA 2GZ8A 4CBNA 3DA9B 3C27B 1SGFA 1P2NA 3LGVA 1S83A 2B5TB 4TYDA 3ZVCA 1O2RA 2ODQA 1BMMH 1NM6A 2AGGX 1TNGA 3NUMA 1LDTT 1ZHRA 4OGYA 3GDSA 5JBCS 2FODA 3PMBB 5ESTE 1BBRH 1BRAA 1K9OE 3OY6U 3R0FA 1JIRA 1ELEE 1FXYA 3SJ9A 2PKAA 1AFQB 3P17H 1OPHB 1YPMH 1B7XB 3TH4H 3RXJA 1NU9A 1ZHPA 4WXIA 3S0NA 4Q2KA 1EXFA 1ARBA 1DANH 1A3EH 1BJUA 1MAXA 1DUEA 4E7RG 1TNHA 4H4FA 1GI6A 2VIOA 3OY5U 1TA2A 1KTTB 2CXVA 4UONA 1ZRBA 1GG6B 4Y6DA 1ELBA 1ELFA 2BY6X 2FOBA 3SHCH 2AIQA 3FP6E 1KLTA 2GT7A 4X1RU 3MU5A 4GHTA 1O31A 1UHBB 1CGJE 3E0NB 1MTNB 3QZQA 4B1TA 4XSKU 3GCTF 1O3PB 1P2IA 5FPYA 1JRSA 1PYTD 3RXQA 1FAXA 1T32A 3T5FH 2Y81A 3STJA 3E3TA 4MTBA 4NWLA 1ZSKA 1GBLA 3MH6A 4ZHLU 2BY5X 1ZJDA 2R0LA 1K1LA 3ZZ5A 1GMHG 3KL6A 2V35A 3M35A 1IQLA 1BMNH 1FQ3A 4TY7A 1LPKB 1BT7A 8LPRA 1SGQE 2G5NA 3PTBA 3ESTA 3K6YA 1K28D 1QL9A 2THFB 1A4WH 3MTYA 1C5LH 4DURA 3EA9A 1O2YA 3KHVA 1HAXB 1SQTA 3QGJA 3RMLH 1FONA 3UNSA 3H7TA 2B8OH 5DP8A 1GJ4H 4X6MA 2FLBH 3BV9B 2R9PA 2ZDLA 3SJ8A 4FU9A 1PQAA 2VB0A 1LVMA 1ETRH 4WXVA 2AMPA 2Y5HA 1QTFA 1C2HA 1OYTH 3TK5A 3EA7A 1GJ6A 1TBRH 4I33A 1EP5A 1HAZB 5FHTA 2GX4A 8GCHG 4ABDA 1TFXA 1O2VA 5L6NH 1AHTH 1CQQA 4YESB 2QXGA 3QLPH 1A2CH 3BIVH 1C5ZB 2GCTB 2YOLA 4PROA 3ZZ3A 2W7UA 1QQUA 1MQ5A 4AGKA 4E05H 5E0JA 1BJVA 3UIRA 1GI9B 2ZA5A 2ZHDA 3MO6A 8ESTE 5GPIB 4YLUA 5EXNA 1RTKA 3E1XB 1Z6EA 3A84A 4CRCA 2QXHA 4JYTA 5SGAE 1EUFA 2H6MA 1GBKA 2G4UA 1K1PA 3RMOH 4I7YH 5DKMA 3BG8A 1UHBA 1UVUH 2ZKSA 4X1SU 3U98H 2O8TA 1NS3A 2BOKA 2Y6TA 1QB6A 1W7XH 1XUKA 4FUEA 1VJAU 4ABGA 1E0FD 4F49A 4Y0ZE 1A0HB 4O97A 1GGDB 3LH1A 3RLWH 4CR5A 1AIXH 2F9PA 1P11E 1SGYE 4K3JA 1C2MA 3F68H 2BM2A 5EG4A 4NFEA 1O2OA 2ZFQH 2WUBA 2B7DH 4WMEA 3V12A 3NCLA 2A4OA 5F6MA 1UTKA 1YLCA 5JB9S 2HNTE 4RKOB 1QURH 1GCTB 1NRSH 1C1PA 2PGQB 3E8LA 3P95A 5JPMH 1GHBF 1GBBA 5DP4A 2ANMH 4D9QA 3HKJB 2D1JA 3T28A 1YP9A 2UUFB 1JOUB 4O03A 2BLQA 2GZ9A 2Q6FA 1FY3A 1UVPA 4BOHA 4HI3A 3O8BA 3RDZA 3VXFH 1OWKA 3DFLA 1LKBA 2QXIA 1SQOA 2XTTB 3KCGH 1EATA 2BXTH 1BUIA 7ESTE 2TGPZ 1XXFA 2A5IA 1GPZA 1XX9A 4VGCC 5HXFA 5C5NA 1HAVB 2PUQH 2FOGA 2GV6A 2ZFSA 1CBWB 7LPRA 2C90B 3M7UA 1FNIA 1YPGH 1O2UA 2AYWA 1C1TA 1O3EA 2O8MA 1YPHE 1WTGH 2ZGCA 3LC3A 1BHXB 1OWEA 1EKBB 4X1PU 1O33A 1PPHE 4JYVH 4D76A 4AB8A 1GJ9B 2Z9JA 3KIDU 2C8YB 4X2YA 3MWIU 1O3CA 3PTNA 3BEIB 3SGAE 5G4BA 3Q3KA 1H1BA 1QCPA 2H1UA 2XNIA 1KXEA 1TNIA 4IS5A 1QJ1B 1LHEH 3VPKA 4ZXXH 1GG6C 4FVBA 3DHKH 3L33A 4HGCA 1TONA 1EJNA 1QIXB 5AHGH 2A5KA 3FAOA 3M3TA 2C3SA 1SL3A 1O3AA 1C5QA 1XXDA 2ALVA 1SOTA 3BIUH 2IOTA 2WPIS 1WBGB 1GDNA 1P2QA 1UVOA 4A92A 2XWAA 1ZJKA 4I8HA 2ZDVH 1GBIA 1O3HA 2BQ7B 2NWNA 3V0XA 1OOKB 1G3EA 1HJ9A 2FX6A 3MNSA 4NSYA 1V2RT 1QA0A 4XBBA 1W7GH 1PPEE 3STIA 5JDUB 3SU5A 3PM3A 2VIQA 3BTEE 1FI8A 2HPQH 3D23A 1UVTH 2FOMB 2BYAX 4OGXA 1YF4A 2OCVB 4KELA 4X8SH 1EPTB 3PO1B 1LPZB 1C2IA 5DP6A 2QXJA 2BLVA 3T62A 4J2YB 3HGNA 5DP3A 2A31A 3F9FA 1LQEA 2CN0H 1A61H 5F8TA 4HZHA 3VGCB 2ZECA 3AAVA 1QB9A 4A5TS 4NIVA 2SGFE 2C8WB 3MH5A 1HFDA 3GCHC 3P8FA 3SU6A 3D62A 4DVAU 3RMNH 1BOQA 3E90B 3F9GA 1YBWA 1DUAA 5EQSA 5FPTA 1ZMJA 1DT2A 2FI4E 1FY8E 1KSNA 1ZHMA 2BTCE 1C5MD 4RSPA 4DGJA 1EPTA 1YPHC 2XBYA 1MBQA 4YOGA 1MTVA 3A81A 1V2LT 1EZXC 4BAHB 2FS9A 4MVNA 3GDVA 1QY6A 5TCCA 1ZSLA 1NRNH 4CREA 1F5RA 3K2UA 1XUJA 4AZ2B 3QDZB 2AEIH 2XBXA 1CHOF 1K22H 3RXGA 3SGQE 2STBE 3UOPA 2ZPSA 4D7FA 2HNTF 4Y0YE 3V3MA 1ID5H 2VWMA 1T8OA 1W0ZU 4OS6A 2F9BH 2FS8A 2VWOA 4FU7A 1SGNE 4Y8YA 1YPLH 5EOKA 4MPUA 1QBNA 1TMTH 1KXFA 4Y8XA 4B74A 4HTCH 1A0LA 1F5KU 1SFIA 4ABFA 1HJ8A 3DUXH 1DX5M 3ODFA 4IN1A 4NG9H 1GL0E 1P01A 4GCHF 2QF0A 3T27A 4TPIZ 1QBVH 1HAGE 1AKSB 3BSQA 3H5CB 1KXCA 3TJVA 2GV7A 5TJXA 4AG1A 2IPHA 1YCPH 2O9QA 1FY4A 1QL8A 2AMQA 2BD4A 1X7AC 3GY4A 4YTAA 1L0ZA 3EGKH 3ZV8A 4FVDA 3V7TA 1CT4E 1CBWC 1O2NA 1D6WA 3W94A 2WUCA 4ISNA 3BG4B 1KXDA 4OS2A 3SV8A 1O3OA 1SVPA 2OBQA 1FMGA 2Q1JA 1GDQA 1V2KT 1DS2E 4KKDA 2PHBA 1N8OB 5FBEA 1HAVA 1V3XA 3LKWA 1CT2E 5K7RA 3SW2B 4CHAC 3T29A 3MNXA 4TY6A 5L30H 4WY3A 1CA0C 1P02A 1KDQB 4NA8A 4CRFA 1BRBE 4X2XA 3SJOA 2OC0A 2STAE 5PTPA 4X0WU 1MU8B 1WSSH 1LVBA 5I25A 3UY9A 2IN2A 1WOFA 4CBOA 1HPGA 3U8RH 1CU1A 1TABE 1FZZA 1TMBH 4BANB 1FLEE 4Y11E 3QO6A 3SNDA 4X8VH 4Y10E 1ELCA 2AGIX 3RXAA 2W26A 3FFGA 4TWWA 3OU0A 1P2OA 2SGEE 2F9VA 4WMFA 3LPRA 1SLUB 1UCYE 5T3HA 1D4PB 1FPCH 1TNJA 1XVMA 3A8BA 2ZG0H 3M5NA 1LCYA 1GBFA 1G36A 1MD8A 2HOBA 2O8WA 3S9AA 1ZRKA 1SPJA 4ZH8A 4AX9H 2A5AA 1GDUA 4K8BA 3GY2A 4XOJA 3BTDE 3M7QA 3A7TA 4AG2A 2PTCE 3BTGE 1GI4A 1SGDE 1J8AA 1YYY1 3TGIE 4XBDA 1RIWC 1EP6A 1HJAB 1TRMA 3AW1A 2FYQA 1ETTH 1XUIA 1O5FH 3KQDA 3FZDA 1O3KA 2QF3A 1ZR0A 2GT8A 2ZDAH 2I6QA 2R2WU 1HNEE 1G2MA 1UTNA 2QYIA 1V2QT 1W12U 1ZTLA 3A8CA 4ASHA 3SZNA 1L1JA 1IQHA 2VGCC 5E0GA 1LVYA 3MU8A 3TK6A 4WJG2 1AO5A
chains in the Genus database with same CATH superfamily
1FY5A 5A8YA 1SSXA 1MCVA 3PYHA 4NA9H 2TBSA 5T1VA 2QGRA 1S5SA 1ELGA 1C5SA 3KGPA 1NRPH 4ZKSU 1NFXA 3SI4H 5C3NA 2ZHQH 1CGIE 1OYQA 4YOIA 1ZZZA 2A45B 1Z8IB 3ZV9A 1O2GH 4ABBA 1Q2WA 5C5OA 1V2UT 1IQNA 4TSFD 3VB7A 1Z8RA 1TGCA 4UEHH 3UFAA 1GJ5H 2ESTE 1O36A 1NBMD 1P06A 3RXUA 2FPZA 1BTXA 4MNYA 3QN7A 1P12E 1THPB 2CMYA 2I6SA 3ZZ9A 4B2CA 1K1OA 1PJPA 1RTFB 1UK3A 3S9BA 1ACBE 3UTUH 1VITG 3ATMA 1DM4B 2G81E 1EJMA 3UQOA 2ZFTA 3M5MA 1C9TA 5L2YH 4Q7ZA 2VIWA 1T8NA 1ARCA 3T25A 9ESTA 1MKWH 1SQAA 3VGCC 1ANEA 4BAKB 1VCQA 2FTLE 5EW1H 2UUJB 4U30A 1WXRA 4INHA 2KAIB 2R3UA 3AVZA 1BTPA 2JH5D 2GJGA 4IC6A 2VIVA 2G55A 1PPZA 1O2IA 2BD9A 2BQ6B 1PYTC 2XXLA 3WWBA 3RXLA 2OINA 1AMHA 3KQEA 1CO7E 1ELAA 1V2VT 2YNBA 4OS1A 1VJ9U 3U69H 1JIMA 4K5ZA 1E37B 1C5YB 2DUCA 4KTUA 4SGAE 1S0RA 3P70B 1RJXB 3ATKA 5ABWA 1BTZA 4DY7B 4NIXA 1KYNA 2WPDD 5EODA 1O2JA 1MD7A 3UR6A 3B8JA 2TGDA 1O2MA 2GKVE 3QZRA 1FJSA 3RXKA 3ZZAA 1GHAF 2ZFPH 1HXEH 1F5LA 1NFWA 5GIBA 5F03A 1BITA 1CE5A 4RT1A 2GMTB 3C1KA 1H8ED 3IITA 2PKAB 1O37A 1HAHH 1MCTA 1SR5C 3P8GA 2TRMA 4FUBA 3TH2H 1J15A 2CJIA 4X2VA 1GBJA 2J97A 1VR1H 3GCOA 1EOLA 3PWBA 1B0EA 4K1TA 1UVSH 1XKBC 2A0QB 2UWLA 3LONA 1JWTA 4X8TH 1LTOA 1K1MA 1E38B 1E35B 4R8TB 2EEKA 4A1XA 2VGCB 3TVJB 5EIYA 1KLIH 4A1VA 1BTHH 1SOZA 1GHXH 1DFPA 2Z9IA 1ZMNA 1EB2A 1SGFG 1DLEA 1NRRH 3ATLA 2ASUB 2FWWA 2F9UA 4WF8A 3A80A 1AB9B 3M36A 3BTKE 2JH6D 2M5TA 3NRLA 5BRRE 1YPJH 2GMTC 1AE8H 4BTTB 2F43B 4DOQA 1MQ6A 2FO9A 5EW2H 2P3UB 3DSOA 1TPOA 1ETSH 1ANCA 2G51A 4AN7A 1UCYK 3MO3A 2FOEA 4FUIA 2BVXH 4DJZB 1QRZA 2P93A 3GYLB 2DE8A 1FAKH 2P8OC 3F2HA 1Z8JB 3TJOA 1SG8B 2FESH 1A1RA 1P2MA 3MU0A 2KCPA 1UTPA 2A7CA 1SGEE 4ESTE 1T8LA 1IHTH 6GCHF 3A89A 2OD3B 4U32A 1DLKB 1QRWA 2FDAA 2PP6A 4BTUB 1MTNC 4MPXA 1HIAA 2JJ1D 1AZ8A 2P8OB 3IWMA 4MQAA 3WY8A 1QB1A 4LOYH 1OWHA 1O3NA 2ZPQA 3SNEA 2YMSB 1AUJA 5C1XA 1KXAA 4GCHG 1OXGA 5DP7A 4OS4A 1QR3E 2ZTZA 4B2BA 3TJNA 2Y82A 3RUOA 4QT8C 4LK4A 4ZROA 1Z7KA 1TQ7B 3PMJA 3MMGA 3S7KB 2BOHB 2XOKD 1C1UH 4ZHMU 3N7EA 7GCHG 1AB9C 1Y3XA 2ALPA 4FUJA 1TNKA 2OQ5A 2ZIQH 3SO3A 1HBTH 4YO9A 3UNQA 1GVZA 1NFYA 3AW0A 1IAUA 3RXOA 1XKAC 3QK1A 2BD2A 4X6NA 2ZP0H 1C5VA 4B75A 2QV1A 3GCTG 1UTMA 3CNRA 3ZYDA 1S0QA 3PB1E 4JZDH 3BEFB 4BAMB 1TAWA 4X1QU 1Q31A 3ENSB 1TGTA 2CV3A 2BXUH 2CHAB 4CRBA 1NT1A 3SI3H 2GTBA 2F9NA 1TOCB 2EI6A 3A7WA 1UO6A 1K1JA 1S6LA 3UWIA 2Y5GA 4R0IA 1ZLRA 1BMAA 2AIPA 3BTWE 1OWDA 1GHWH 1YLNA 2VIDA 5HM2A 2P3FH 2PFEA 3TITA 1BB0B 2W5EA 3K6ZA 1H9IE 1J14A 4FOUC 8KME2 4A6LA 1DE7H 1YLDA 1MUEB 2Z3DA 1UTLM 3NZIA 1KMHB 5EJLA 1ESBA 5EPNA 3GYMA 4MNWA 5KGOA 2GCHG 2J92A 1GI1A 1D3QB 1CA0B 4BNRA 4AYYB 1ZYOA 3SV6A 1GMHF 2BVRH 1CA8B 1GL1A 4HG6A 1GHZA 1SBWA 3GCNA 4B76A 3LGWA 1C2LA 4LZ1H 1MH0A 2GVFA 3KNXA 4AFZA 2IJD1 4CRGA 4HFPB 2BZAA 3TNSA 3KYFA 5LPFA 4NZQA 5T6GA 1C1QA 4Q63A 3F0OA 3K65B 3F9EA 1Z1IA 1PPCE 2VJ1A 3PLPA 1AWHB 4YZUA 2WPKS 1V2NT 3SU2A 4CH8B 2V3OH 1P09A 1NU7B 1G32B 3VG8A 4A1TA 4E06H 1YCPM 1IHSH 1ZSJA 1KTSB 1FN6A 4JK6A 2WV5A 3AAUA 2H5DA 4UFGH 1TGBA 2R3YA 1O2TA 3PO1C 2VNTA 1JRTA 1HGTH 1FPHH 4UFEH 1EAUA 1QRXA 1TB6H 3ELAH 1MKXK 2AFQB 2TGAA 1SKYE 2OLGA 1GJ8B 1AVWA 1C5XB 3GY3A 3RXCA 4X8UH 3HPTB 5E2OA 5CE1A 1OP2A 3U28C 4CRAA 1C1MA 1MZDA 5JYIA 1DDJA 3LGIA 4VGCB 1W2KH 2FX4A 5FPSA 3RU4E 2OC8A 3FO8D 2RDLA 1YY3A 1RRKA 1WAYB 4WMDA 1O5CB 1AFEH 1RS0A 1D3PB 5C17A 2Z9KA 1ZGVA 1UCYH 3MO9A 5A0AE 1C4V2 5FCRA 2ZGJA 4UFDH 1A3BH 1GI7B 2EY4C 2KCYA 1CSOE 2PR3A 3OE7D 3VEQB 1HV7A 1P04A 3M37A 3JZ2B 2ILNA 3PROA 1GHVH 3LDXH 3U1JB 3A7YA 1S85A 4A7IB 4FU8A 1O2LA 2XBWA 4DT7B 4LXBH 2QF4A 1ZPBA 1GCDA 1FN8A 4X6PA 1AWFH 1O38A 5IK2D 2VWNA 1N6XA 3ATIA 1HJAC 1O5EH 3HATH 3F6UH 4Y79A 3TPIZ 3SZEA 3A7ZA 4KTCA 1GBEA 1HAIH 2FI3E 3W1EA 1GVLA 3MOCA 3UUZA 1BBRK 3RXPA 4OM9A 1EQ9A 5J4QA 1LO6A 3LOXA 2OC1A 2BDGA 2FM2A 1W13U 1C9PA 2D8WA 3MFJA 3SU4A 3EE0B 4P00A 2HNTC 3NK8A 3LGYA 5AFZH 3RC6A 2DE9A 2RFKC 4Q7YA 4YT6H 5E2PA 9LPRA 1QL7A 1XVOA 2H9HA 2FLRH 3E91A 3UOUA 4AFSA 1SMFE 3KYGA 1O3FA 1LHFH 1TLDA 1SLWB 3Q3XA 4Y76A 2F83A 3TLOA 3SNCA 3TNTA 4JZFH 2ZU3A 4ABHA 1VZQH 1ESTA 2BY8X 4DIIH 4ISLA 3PLKA 2VVUA 1RXPA 3A83A 3FOAA 4NFFA 3OYPA 5J4SA 1O2XA 1RIWB 4BAOB 4ZUHA 1MU6B 1THSH 3ZZCA 1V2TT 2YNAA 1DY8A 4IC5A 2OUAA 5HGGA 2JETC 1BRCE 1AY6H 2J94A 1A5HA 2P3TB 4YLQH 3GCHB 1C2EA 3H09A 1G9IE 2XWBI 1NTPA 3G01A 1DICA 5DGJA 2Y80A 2FOCA 4NZLA 1IQGA 3HK3B 1PPFE 1EAXA 2VU8E 1FDPA 4MPVA 2EQNA 3QTOH 1YKTA 1AU8A 3U1IB 2YMSD 1E1RD 1ABIH 2BD8A 3M7TA 4ZKRU 3ZZ4A 4DW2U 1BMLA 5F53A 2K8IA 1E34B 1GJ7B 4I8KA 1Q3XA 5IDKA 2AGEX 2Y7ZA 1TBZH 4I32A 4ISOA 3GY8A 4ZAEA 1N1LA 3RC5A 1DWCH 1A5IA 4H42U 2PKSC 5GWZA 1GMDG 1NN6A 2WZQA 3SN8A 1NRQH 4ABEA 5FAHA 4YOJA 3DT0H 6CHAC 4AORA 2PGBB 1HB0B 5A2MH 1HXFH 1WV7H 1XUFA 3BTHE 5ETXA 4DIHH 1ZPCA 1C5NH 3Q76A 1INCA 1KLJH 3JZ1B 4Y7BA 1DVAH 1G3CA 2OP9A 3QWCH 2HGTH 1BHXF 3R3GB 1L4DA 1TPSA 2TGTA 5A0CA 1LQDB 3RMMH 5EXMA 1O3JA 3D65E 1WUNH 3TGJE 3SGBE 2F9OA 2BX3A 1GBMA 2P59A 5F8ZA 2WHXA 1K21H 4D9RA 3DSPA 4FUHA 5K0HA 1JBUH 4IGDA 3E6PH 2H9TH 1S6FA 5DPAA 1E79D 1T31A 1UK2A 5L2ZH 2J9NA 1P57B 2KZ4A 1TX6A 1O2HA 1RD3B 1XUGA 3NPSA 1NROH 2ODYB 4UE7H 2PWXA 4ZKNU 1FIZA 1K2I1 2ZHEH 1L4ZA 2SNWA 2ZZUH 4I8GA 2RA3A 3CENA 2L6OA 1ELDE 1IQMA 2A1DB 2FYRA 3PMAB 3RXBA 5DK1A 4ABJA 2O8LA 1T4UH 1TBQH 1V2MT 2XCNA 1GHBG 1EZSC 4OS5A 4XD7D 1ESAA 3KF2A 2GGVB 3RM0H 2GDDA 3P92A 4OS7A 3MU1A 4Y8ZA 3LT3A 1MABB 2Z3EA 2IPQX 5C20A 2A32A 1SGCA 1V2ST 2CF9H 3NXPA 1OX1A 2J4IA 5LPRA 2BDHA 3M5OA 4MNVA 3NWUA 4X2WA 3WW7A 3D49H 4GHQA 1EFRD 1H8IH 1DY9A 2ZHFH 3OTPA 3QTVH 2Q6GA 1AVGH 2ZQ2A 2CK3D 4UFFH 3N7DA 1CVWH 2V3MA 1HLTH 3RXIA 5A0BA 2B0FA 2ZGXH 2R2MB 4GPGA 2RG3A 1C2KA 1HCGA 1P10A 2CHAC 2WYJA 1NFUA 1QA7A 4D7GA 1IQEA 1C1WH 4MG3A 2BB4A 3SQEE 1F92A 3UR9A 2W6JD 5AF9H 3VXEH 1MBMA 1O34A 4JZIA 1ELVA 1GVKB 1PPGE 1EOJA 5B6LA 2VH6A 3VB5A 2G8TA 3F3BA 5T6FA 2L74A 2ANWA 4FUCA 4NIYA 2J34A 1EPTC 1G3BA 4NIWA 2ZPRA 3MHWU 1DXWA 1GBHA 3SORA 2Z7FE 2PLXA 1EASA 2CGAA 5HIZA 1F2SE 1GI5A 1DSTA 2JH0D 1XM1A 1U6QA 1GJCB 4TWYA 1GHYH 3B9FH 2BY9X 3MNBA 4RT0A 1WU1A 4ZMAH 3FZZA 2V0BA 4ZXYH 2HRVA 3SBKA 1Z6JH 2FMJA 5E0HA 3RU4T 3KEEA 4MDSA 2EA3A 8GCHF 3M5LA 3T26A 2Z6BD 2EI7A 2WPJS 4ISHH 1PQ8A 3LH3A 1T4VH 2YMSC 2FI5E 3DCLA 1LHCH 2GCTC 4GSOA 1MTUA 4NGAH 5DO4H 1SB1H 1YPKH 3URDA 4AC9A 1SFQB 2PKSB 2BLWA 1TGNA 4THNH 1HAOH 2H5CA 1TPPA 3ZZ7A 4UDWH 1Y8TA 3BF6H 1BDAA 3EDXB 1HDTH 5DP5A 1YM0A 2TPIZ 1F0UA 1O39A 3F1SB 3RC4A 2HWLB 2FOAA 1T8MA 1P3CA 3F2GA 3O8RA 3QUMP 3SU0A 3MU4A 2A2XH 2EI8A 1C1OA 4K8YA 3LGUA 2AH4X 2ODPA 1GJDB 3PRDA 3UREA 2SGDE 1XUHA 1A46H 5GCHG 3GOVB 3FVFB 3RXEA 1FX0B 1P2KA 2P95A 1GBTA 1NBME 5LH8A 2WYGA 1N8OC 1GBCA 1DITH 1O5BB 1TIOA 5EXLA 1B0FA 1GJAB 1UW7A 1Z71A 2FOFA 1L1NA 3HGPA 1C5RA 1TQ0B 3BG4C 1VCPA 3DFJA 4NA7A 1SGRE 1NZQH 3EYDA 2ULLA 1V2WT 1DWDH 1O2PA 1O2QA 2KM0A 3QGNB 3TH3H 1BTWA 1ZMLA 1TRYA 3SUDA 1CHGA 1Y3VA 2O8UA 2WINI 1C1RA 1ZTJA 2QY0B 1FV9A 1O2ZA 4GAWA 5DSFA 2UWPA 3SV9A 1W0YH 3MYWA 2BVSH 4O3TA 4NWKA 4BXSA 3GISB 3ZVDA 2VH0A 2B9LA 2RCEA 1O3BA 1LHGH 1ANDA 1QJ6B 4H6TA 4I31A 1W14U 2HLCA 4INKA 1O32A 2W3IA 3OX7U 3TIUA 1MKXH 1UK4A 2QCYA 5A8ZA 2GDEH 2K1QA 1DSUA 2G4TA 1Y3UA 4MNXA 4B73A 1M9UA 1SLVB 2JIZD 3L6PA 3QX5H 2PSXA 1FY1A 1HIAB 4WWYA 3A7XA 1JXPA 1WQVH 3I29A 2BX4A 4KTSA 3ZVFA 2H9EH 2GD4B 4ABIA 2XRCA 1A7SA 1W11U 2VVVA 1AVXA 1IQFA 4J1YA 3ZYEA 1HRTH 4BTIB 3DD2H 1CGHA 3IG6B 1G2LA 1H9HE 1P8VC 5E8EH 3Q00A 5FBIA 1VITH 2Y5FA 2F91A 5FL7D 1J17T 5GCHF 2P16A 4MPWA 1W0JD 4FXGH 3TJUA 5DG6A 2ZCLP 2ZU4A 1QBOA 3E0PB 1QGFA 4AYVB 3ZZ6A 2SGQE 4Z6AH 2R0KA 1F0SA 2BDCA 3T2NA 3SJIA 3SUEA 1T7CA 1VCWA 2A7HA 3KQCA 2D2DA 4GLYA 1WCZA 4JMYA 3S9CA 3CS7A 1IOEA 3NKKA 5GDSH 2PW8H 1SGTA 2FOHA 2OBOA 3OTJE 4UD9H 5C1UA 4K1EA 1C4U2 1SGPE 1WYKA 1H4WA 3Q3YA 1L1GA 2BMGB 3O8DA 3KN2A 1V2OT 3GDUA 4CR9A 4I8JA 2K0QA 1YPEH 2AS9A 5BPEA 1QZ8A 5A09A 4IW4E 1SC8U 5EGMA 2JDID 2XBVA 1EB1H 2ZF0H 2XYAA 1OWJA 3U9AH 4MLFB 2Z3CA 2BLOA 1CT0E 3SOSA 1D3TB 1NY22 4IBLH 4Q7XA 1IQIA 5T6DA 1C2FA 1UTQA 1K1NA 3PMHB 5JBTA 4ACAA 1E1QD 1S84A 1BQYA 1K1IA 3RXDA 5GJ4B 3U8OH 1GI8B 1N6YA 1O30A 3V13A 1UJ1A 1SGIB 2QAAA 1TA6A 2NU2E 4TT3D 4JZEH 1BZXE 4TPYA 3AASA 2AERH 2VINA 1C1SA 2QA9E 5LPEA 1D6RA 1ZTKA 2V6NA 4JK5A 1DPOA 3W95A 1P9UA 2ZQ1A 3ZVEA 4GVUA 4E7NA 1S6HA 3K9XB 3SV7A 1FUJA 3EA8A 4K69A 1PPBH 4YT7H 2AMDA 1S82A 4XE4A 1C5TA 1ANBA 2BQWB 2J95A 2XCFA 3M3VA 3PWCA 2ZTXA 2A4RA 4AGJA 2KAIA 2BDIA 2FZZA 3ITIA 4XFQA 1RTLA 2OQUA 2F3CE 5FX5A 3UPEA 5CHAB 3SJKA 3RXMA 4CRDA 6GCHG 1GI0A 1C5PA 5HKKD 1EAWA 2BD5A 1VITF 2VVCA 4XBCA 1GMDF 1SLXB 3A7VA 5HMAA 1KXBA 1EAIA 3TU7H 3FP7E 5DP9A 3BN9A 4CHAB 1WQSA 3RXTA 1HAYB 1DXPA 1GJBB 4JZ1A 4M7GA 3B23B 1C5WB 1GMCG 3BTME 1Y59T 1SHHB 2A4GA 1NPMA 2F4LA 1TPAE 2EC9H 2ZFFH 3CS0A 4IMZA 2ZDMA 3RP2A 3E16B 3HKIB 4Z0KA 1IQKA 5EQQA 5EQRA 4DCDA 1NC6A 1TOMH 4GUXA 3RLYH 3LIWA 4JYUH 1PQ7A 3ZZ8A 1DWBH 1OS8A 5IYTA 2C8XB 3P6ZB 1W8BH 2KFWA 3A86A 3RU4D 3SQHE 1J16A 2C8ZB 1C5OH 1C1NA 2LELA 5EPYA 3EQ0H 2W7SA 1Y5UT 1O5GH 2C4FH 1VGCC 1TMUH 1AFQC 2OTVA 5GXPA 2IJOB 1BCUH 3KQBA 2BY7X 2SGPE 4FUGA 3MH7A 2Z9LA 4O9VA 5TCAA 1ORFA 3L3TA 5C94A 1ZOMA 3HK6B 1QHRB 2NU3E 1OSSA 5H4IB 2JKHA 4INLA 1AI8H 1O3IA 3RXHA 4CH2B 1O3LA 1THRH 1V2PT 2GCHF 4RN6A 2UWOA 2ZCHP 4ZHAA 4Y7AA 1EX3A 1D9IA 1YCPK 1TX8A 1JMOH 2HPPH 2BDAA 3BTQE 7KMEH 4B2AA 1C1VH 1P0SH 2PV9B 2QF5A 1V2JT 4AFUA 3PV2A 3ODDA 3A82A 3URCA 3SUGA 1BA8B 4JCNA 3SNAA 2FP7B 2GP9B 2LPRA 1D3DB 2ZGBH 5FCKA 1CHOG 4BAQB 3ZZDA 2ANYA 3VFEA 2A2QH 3PLBA 3A8DA 1P05A 5C67A 3EE7A 1TRNA 2ANKH 6CHAB 1AE5A 1AZZA 2J38A 5JB8S 1E36B 1BIOA 1RFNA 3RXVA 4K1SA 1Z1JA 5ESBA 2BZ6H 2J98B 3ZVAA 3GY7A 5FXLA 1MMJN 2SFAA 3P8NA 4KP0A 2D26C 3M61U 1OP0A 2ZC9H 2BDBA 2PTNA 1F7ZA 2UUKB 5FX6A 1O2WA 3UQVA 2FEQH 2XC4A 1H9LB 2PUXB 2FXRA 1KDQA 1LPGB 3SU1A 2XC5A 1DOJA 1UTJA 1Y3YA 1VGCB 2WPMS 3LJJA 1J9CH 3LJOA 4Q80A 4FUFA 5A8XA 1MTSA 3ZZBA 2QIQA 2OXSA 5CMXH 1OKXA 1OP8A 5C1YA 1HYLA 3SHAH 1GGDC 2JETB 2ZHWH 3OAAD 5B6OA 1MTWA 1MZAA 2ZFRH 3GY6A 3FP8E 3ZVBA 4NCYA 2XC0A 4O3UA 4NSVA 1TALA 3PV4A 1C5UA 1Z8GA 3BEUA 3GICB 3RXFA 1AKSA 1ELTA 3N7OA 1NESE 5KEDA 3SV2H 3O8CA 2Z9GA 2PSYA 2Y7XA 1P03A 3P8OA 3RXSA 2VWLA 1O5AB 1V6DA 2CF8H 4FUDA 1Y5BT 1AUTC 1COWD 5HYOA 5I46H 1O0DH 2QN5T 1OWIA 3MNCA 1ZPZA 1G30B 1KIGH 1P9SA 3S7HB 4WH6A 3BTFE 2ZCKP 1UTOA 1C4Y2 7GCHF 4X6OA 2LNCA 1AQ7A 5AVDA 5JBAS 3UNRA 4IMQA 2SGAA 2FTMA 4B71A 1L2EA 2A7JA 1G37A 2HALA 4BXWA 1O2SA 4ISIH 1O3GA 4K60A 1BBRE 2WV4A 2BHGA 2W3KA 1EZUC 1EJAA 1QFKH 3RXRA 2VIPA 5C2ZA 2WSSD 2FIRH 3H7OA 2TIOA 3LC5A 3Q77A 3VB6A 1A0JA 1GBDA 3A85A 4U2WA 3AK5A 4ABAA 2ZWLH 3F0PA 1LKAA 5KECA 1TWXB 2H2ZA 2KCAA 3M3SA 1AD8H 1PFXC 1TYNA 5HM9A 4SGBE 1WTHD 3GY5A 1ABJH 3MI4A 3SU3A 1NO9H 4F55A 1O2KA 1XMNB 2P94A 4LZ4B 2BD3A 1ZGIA 5JBBS 2NU0E 5DJ7A 4WVPE 1K0HA 1TNLA 1LHDH 3I78A 1LVOA 1B5GH 1GHAG 2HVXA 4AFQA 2WPLS 2Z94A 4DG4A 2BD7A 2QC2A 4WH8A 2NU1E 4F4OC 2G52A 4RKJB 2WPHS 3LU9B 1F0RA 5LGOA 1C2GA 3BTTE 1W3CA 1GI2A 2G5VA 3OSYA 5CHAC 2RA0A 4H6SB 3GS9A 1AGJA 1GWAA 2OC7A 2ZTYA 2ZO3H 2XW9A 3F9HA 4XDEA 1BTYA 4Q4LA 5F8XA 4AOQA 6ESTA 1GCTC 3ATWA 1Y3WA 1UMAH 3MH4A 1AN1E 1BRUP 4ASUD 2ZDNA 4IN2A 1O35A 2ZU2A 1TE0A 1G3DA 3VB3A 1W0KD 2ZU5A 3ZVGA 1QNJA 5EU8A 2V3HH 2GZ7A 2ZEBA 1GBAA 2ZU1A 1O5DH 4DT4A 1HAPH 4D8NA 3LGTA 1EZQA 1TGSZ 2A4QA 1C2JA 1GMCF 1Y5AT 1MKWK 2UUYA 1O3MA 3A87A 1MAYA 3UWJH 1QJ7B 2C93B 2ZI2H 1GI3A 1RGQA 1P3EA 1P2JA 1LMWB 3CP7A 1S81A 2ZNKH 3SNBA 1YGCH 4AB9A 2HLDD 4Y71A 1FIWA 4K2YA 2ZDKA 3UAIC 6LPRA 1PQ5A 1W10U 1QQ4A 5AFYH 3VB4A 4I8LA 2Q6DA 2BDYA 2SNVA 4KGAA 2J2UA 1HUTH 3SUFA 1IQJA 2G00A 1SHYA 1A5GH 3FANA 3I77A 1O3DA 1BTUA 1C2DA 1F0TA 3A8AA 1KY9A 2XNDD 3U8TH 4U01A 4Z1MD 3TK9A 1SI5H 3S69A 4X1NU 1YC0A 3RM2H 1DWEH 2NU4E 3TGKE 3EAJA 1H8DH 4YM9A 3OFND 4ZKOU 3A88A 1TX7A 2ZGHA 2GZ8A 4CBNA 3DA9B 3C27B 1SGFA 1P2NA 3LGVA 1S83A 2B5TB 4TYDA 3F2FA 3ZVCA 1O2RA 2ODQA 1BMMH 1NM6A 2HVYB 2AGGX 3PRBA 1TNGA 3NUMA 1LDTT 1ZHRA 1H8HD 4OGYA 3GDSA 5JBCS 2FODA 3PMBB 5ESTE 3UB0A 1BBRH 1BRAA 1K9OE 3OY6U 3R0FA 1JIRA 1ELEE 1FXYA 3SJ9A 2PKAA 2V7QD 1AFQB 4B6FA 3P17H 1OPHB 1YPMH 1B7XB 3TH4H 3RXJA 1NU9A 1ZHPA 4WXIA 3S0NA 4Q2KA 1EXFA 1ARBA 1DANH 1A3EH 1BJUA 1MAXA 1DUEA 4E7RG 1TNHA 4H4FA 1GI6A 2VIOA 3OY5U 1TA2A 1KTTB 2CXVA 4UONA 1ZRBA 1GG6B 4Y6DA 1ELBA 5CDFE 1ELFA 2BY6X 2FOBA 3SHCH 2AIQA 3FP6E 1KLTA 2GT7A 4X1RU 3MU5A 4GHTA 1O31A 1UHBB 1CGJE 3E0NB 1MTNB 3QZQA 4B1TA 4XSKU 3GCTF 1O3PB 1P2IA 5FPYA 1JRSA 1PYTD 3RXQA 1FAXA 1T32A 3T5FH 2Y81A 3STJA 3E3TA 4MTBA 4NWLA 1ZSKA 1GBLA 3MH6A 4ZHLU 2BY5X 1ZJDA 2R0LA 1K1LA 3ZZ5A 1GMHG 3KL6A 2V35A 3M35A 1IQLA 1BMNH 1FQ3A 4TY7A 1LPKB 1BT7A 8LPRA 1SGQE 2G5NA 3PTBA 3ESTA 3K6YA 1K28D 1QL9A 2THFB 1A4WH 2KCOA 3MTYA 1C5LH 4DURA 3EA9A 1O2YA 3KHVA 1HAXB 1SQTA 1BMFD 3QGJA 3RMLH 3MQKC 1FONA 2WV9A 3OEED 3UNSA 3H7TA 2B8OH 5DP8A 1GJ4H 4X6MA 2FLBH 3BV9B 2R9PA 2ZDLA 3SJ8A 4FU9A 1PQAA 2VB0A 1LVMA 4ACBA 1ETRH 4WXVA 2AMPA 2Y5HA 1QTFA 1C2HA 1OYTH 3TK5A 3EA7A 1GJ6A 1TBRH 4I33A 1EP5A 1HAZB 5FHTA 4M9FA 2GX4A 8GCHG 4ABDA 1TFXA 1O2VA 5L6NH 1AHTH 1CQQA 4YESB 2QXGA 3QLPH 1A2CH 3BIVH 1C5ZB 2GCTB 2YOLA 4PROA 3ZZ3A 2W7UA 1QQUA 1MQ5A 4AGKA 4E05H 5E0JA 1BJVA 3UIRA 1GI9B 2ZA5A 2ZHDA 3MO6A 8ESTE 5GPIB 4YLUA 5EXNA 1RTKA 3E1XB 2RDEA 1Z6EA 3A84A 4CRCA 2QXHA 4JYTA 4ZCNA 5SGAE 4F48B 1EUFA 2H6MA 1GBKA 2G4UA 3PV5A 1K1PA 3RMOH 4I7YH 3FN8A 5DKMA 3BG8A 1UHBA 1UVUH 2ZKSA 2OK5A 4X1SU 3U98H 2O8TA 1NS3A 2BOKA 2Y6TA 1QB6A 1W7XH 1XUKA 4FUEA 1VJAU 4ABGA 1E0FD 4F49A 4Y0ZE 1A0HB 4O97A 4FETA 1GGDB 3LH1A 3RLWH 4CR5A 1AIXH 2F9PA 1P11E 1SGYE 2VBCA 4K3JA 1C2MA 3F68H 2BM2A 5EG4A 4NFEA 1O2OA 2ZFQH 2WUBA 2JJ2D 3FKSD 2B7DH 4WMEA 5EJ1A 3V12A 3NCLA 2A4OA 5F6MA 1UTKA 1YLCA 5JB9S 2HNTE 4RKOB 1QURH 1GCTB 1NRSH 1C1PA 2PGQB 3E8LA 3P95A 5JPMH 1GHBF 1GBBA 5DP4A 2ANMH 4D9QA 3HKJB 2D1JA 3T28A 1YP9A 2UUFB 1JOUB 4O03A 2BLQA 2GZ9A 2Q6FA 1FY3A 1UVPA 4BOHA 3N99A 4HI3A 3O8BA 5C0TA 3RDZA 3VXFH 1OWKA 3DFLA 1LKBA 2QXIA 1SQOA 2XTTB 3KCGH 2W6ID 1EATA 2BXTH 1BUIA 7ESTE 2TGPZ 1WDIA 1XXFA 2A5IA 1GPZA 1XX9A 1OHHD 4I86A 4VGCC 5HXFA 5C5NA 1HAVB 2PUQH 2FOGA 2GV6A 2ZFSA 1CBWB 7LPRA 2C90B 3M7UA 1FNIA 1YPGH 1O2UA 2AYWA 1C1TA 1O3EA 2O8MA 1YPHE 1WTGH 2ZGCA 3LC3A 1BHXB 1OWEA 1EKBB 4X1PU 1O33A 1PPHE 4JYVH 4D76A 4AB8A 1GJ9B 2Z9JA 3KIDU 2C8YB 4X2YA 3MWIU 1O3CA 3PTNA 3BEIB 3SGAE 5G4BA 3Q3KA 1H1BA 1QCPA 2H1UA 2XNIA 1KXEA 1TNIA 4IS5A 1QJ1B 1LHEH 3VPKA 4ZXXH 1GG6C 4FVBA 3DHKH 3L33A 4HGCA 1TONA 1EJNA 1QIXB 5AHGH 2A5KA 3FAOA 3M3TA 5EJZA 2C3SA 1SL3A 1O3AA 1C5QA 1XXDA 2ALVA 1SOTA 3BIUH 2IOTA 2WPIS 1WBGB 1GDNA 1P2QA 1UVOA 4A92A 2XWAA 1ZJKA 4I8HA 2ZDVH 1GBIA 1O3HA 2BQ7B 2NWNA 3V0XA 1OOKB 1G3EA 1HJ9A 2FX6A 3MNSA 4NSYA 1V2RT 1QA0A 4XBBA 1W7GH 1PPEE 3STIA 5JDUB 3SU5A 3PM3A 2VIQA 3BTEE 1FI8A 2HPQH 3D23A 1UVTH 2FOMB 2BYAX 4OGXA 1YF4A 2OCVB 4KELA 1YWUA 4X8SH 1EPTB 3PO1B 1LPZB 1C2IA 5DP6A 2QE7D 2KX4A 2QXJA 2BLVA 3T62A 4J2YB 3HGNA 5DP3A 2A31A 3F9FA 5DN6D 1LQEA 2CN0H 1A61H 2KR7A 4HZHA 5F8TA 3VGCB 2ZECA 3AAVA 1QB9A 3KQ5A 4A5TS 4NIVA 2SGFE 2C8WB 3MH5A 1HFDA 3GCHC 3P8FA 5CHBA 3D62A 3SU6A 3RMNH 1BOQA 4DVAU 3E90B 3F9GA 1YBWA 1DUAA 5EQSA 3WWFA 5FPTA 1ZMJA 1DT2A 4RI0A 2FI4E 1FY8E 1KSNA 1ZHMA 2BTCE 1C5MD 4RSPA 4DGJA 1EPTA 1YPHC 2XBYA 1MBQA 4YOGA 1MTVA 3A81A 4XRNA 1V2LT 1EZXC 4BAHB 2FS9A 4MVNA 3GDVA 1QY6A 5TCCA 4B6EA 1ZSLA 1NRNH 4P02A 4CREA 1F5RA 3K2UA 1XUJA 4AZ2B 3QDZB 2AEIH 5GNDA 2XBXA 1CHOF 3SYJA 1K22H 3RXGA 3SGQE 2AHME 2STBE 3UOPA 5C0UA 2ZPSA 4D7FA 2HNTF 4Y0YE 3V3MA 1ID5H 2VWMA 1T8OA 1W0ZU 4OS6A 2F9BH 2FS8A 2VWOA 4FU7A 1SGNE 4Y8YA 1YPLH 5EOKA 4MPUA 1QBNA 1TMTH 1KXFA 4Y8XA 4B74A 4HTCH 1A0LA 1F5KU 1SFIA 4ABFA 1HJ8A 3DUXH 1DX5M 3ODFA 4IN1A 4NG9H 1GL0E 1P01A 1SQRA 4GCHF 2QF0A 3T27A 4TPIZ 1QBVH 1HAGE 1AKSB 3BSQA 3H5CB 1KXCA 3TJVA 2GV7A 5TJXA 4AG1A 2IPHA 1YCPH 2O9QA 1FY4A 2J5UA 1QL8A 2AMQA 2BD4A 1X7AC 3GY4A 4YTAA 1L0ZA 3EGKH 3ZV8A 4FVDA 3V7TA 5HIYA 1CT4E 1CBWC 2LP6A 1O2NA 1D6WA 3W94A 2WUCA 4ISNA 3BG4B 1KXDA 4OS2A 3SV8A 1O3OA 1SVPA 2OBQA 1FMGA 2Q1JA 1GDQA 1V2KT 1DS2E 4KKDA 2PHBA 1N8OB 5FBEA 1HAVA 1V3XA 3LKWA 1CT2E 5K7RA 3SW2B 4CHAC 3T29A 3MNXA 4TY6A 5L30H 4WY3A 3ZIAD 1CA0C 1P02A 1KDQB 4NA8A 4CRFA 1BRBE 4X2XA 3SJOA 2OC0A 2STAE 3OEHD 5PTPA 4X0WU 1MU8B 1WSSH 1LVBA 5I25A 3UY9A 2IN2A 1WOFA 4CBOA 1HPGA 3U8RH 1CU1A 1TABE 1FZZA 1TMBH 4BANB 1FLEE 4Y11E 3QO6A 3SNDA 4X8VH 4Y10E 1ELCA 2AGIX 3RXAA 2W26A 3FFGA 4TWWA 2J98A 3OU0A 1P2OA 2SGEE 2F9VA 4WMFA 3LPRA 1SLUB 1UCYE 5T3HA 1D4PB 1FPCH 1TNJA 1XVMA 3A8BA 2ZG0H 3M5NA 1LCYA 2M2AA 1GBFA 1G36A 1MD8A 2HOBA 2O8WA 3S9AA 1ZRKA 1SPJA 4ZH8A 4AX9H 2A5AA 3DSGA 1GDUA 4K8BA 3GY2A 4YXWD 4XOJA 3BTDE 3M7QA 3A7TA 4AG2A 2PTCE 3BTGE 1GI4A 1SGDE 1J8AA 1YYY1 3TGIE 4XBDA 1RIWC 1EP6A 1HJAB 1TRMA 3AW1A 2FYQA 1ETTH 1XUIA 1O5FH 3KQDA 3FZDA 1O3KA 2QF3A 1ZR0A 2GT8A 2ZDAH 2I6QA 2R2WU 1HNEE 1G2MA 1UTNA 2QYIA 1V2QT 1W12U 1ZTLA 3A8CA 4ASHA 3SZNA 1L1JA 1IQHA 1VKYA 2VGCC 5E0GA 1LVYA 3MU8A 3TK6A 4WJG2 1AO5A
chains in the Genus database with same CATH topology
1FY5A 5A8YA 1SSXA 1MCVA 3PYHA 4NA9H 2TBSA 2QGRA 1S5SA 1ELGA 1C5SA 3KGPA 1NRPH 4ZKSU 1NFXA 3SI4H 5C3NA 2ZHQH 1CGIE 1OYQA 4YOIA 1ZZZA 2A45B 1Z8IB 3ZV9A 1O2GH 4ABBA 1Q2WA 5C5OA 1V2UT 1IQNA 3VB7A 1Z8RA 1TGCA 4UEHH 3UFAA 1GJ5H 2ESTE 1O36A 1P06A 3RXUA 2FPZA 1BTXA 4MNYA 3QN7A 1P12E 1THPB 2CMYA 2I6SA 3ZZ9A 4B2CA 1K1OA 1PJPA 1RTFB 1UK3A 3S9BA 1ACBE 3UTUH 1VITG 3ATMA 1DM4B 2G81E 1EJMA 3UQOA 2ZFTA 3M5MA 1C9TA 5L2YH 4Q7ZA 2VIWA 1T8NA 1ARCA 3T25A 9ESTA 1MKWH 1SQAA 3VGCC 1ANEA 4BAKB 1VCQA 2FTLE 5EW1H 2UUJB 4U30A 4INHA 2KAIB 2R3UA 3AVZA 1BTPA 2JH5D 4IC6A 2VIVA 2G55A 1PPZA 1O2IA 2BD9A 2BQ6B 1PYTC 2XXLA 3RXLA 2OINA 1AMHA 3KQEA 1CO7E 1ELAA 1V2VT 2YNBA 4OS1A 1VJ9U 3U69H 1JIMA 4K5ZA 1E37B 1C5YB 2DUCA 4KTUA 4SGAE 1S0RA 3P70B 1RJXB 3ATKA 5ABWA 1BTZA 4DY7B 4NIXA 1KYNA 5EODA 1O2JA 1MD7A 3UR6A 3B8JA 2TGDA 1O2MA 2GKVE 3QZRA 1FJSA 3RXKA 3ZZAA 1GHAF 2ZFPH 1HXEH 1F5LA 1NFWA 5GIBA 5F03A 1BITA 1CE5A 2GMTB 3C1KA 3IITA 2PKAB 1O37A 1HAHH 1MCTA 1SR5C 3P8GA 2TRMA 4FUBA 3TH2H 1J15A 2CJIA 4X2VA 1GBJA 1VR1H 3GCOA 1EOLA 3PWBA 1B0EA 4K1TA 1UVSH 1XKBC 2A0QB 2UWLA 3LONA 1JWTA 4X8TH 1LTOA 1K1MA 1E38B 1E35B 4R8TB 2EEKA 4A1XA 2VGCB 3TVJB 1KLIH 4A1VA 1BTHH 1SOZA 1GHXH 1DFPA 2Z9IA 1ZMNA 1EB2A 1SGFG 1DLEA 1NRRH 3ATLA 2ASUB 2FWWA 2F9UA 4WF8A 3A80A 1AB9B 3M36A 3BTKE 2JH6D 2M5TA 5BRRE 1YPJH 2GMTC 1AE8H 4BTTB 4DOQA 1MQ6A 2FO9A 5EW2H 2P3UB 1TPOA 1ETSH 1ANCA 2G51A 4AN7A 1UCYK 3MO3A 2FOEA 4FUIA 2BVXH 4DJZB 1QRZA 2P93A 3GYLB 2DE8A 1FAKH 2P8OC 1Z8JB 3TJOA 1SG8B 2FESH 1A1RA 1P2MA 3MU0A 1UTPA 2A7CA 1SGEE 4ESTE 1T8LA 1IHTH 6GCHF 3A89A 2OD3B 4U32A 1DLKB 1QRWA 2FDAA 4BTUB 1MTNC 4MPXA 1HIAA 1AZ8A 2P8OB 3IWMA 4MQAA 3WY8A 1QB1A 4LOYH 1OWHA 1O3NA 2ZPQA 3SNEA 1AUJA 5C1XA 1KXAA 4GCHG 1OXGA 5DP7A 4OS4A 1QR3E 2ZTZA 4B2BA 3TJNA 2Y82A 3RUOA 4QT8C 4LK4A 4ZROA 1Z7KA 1TQ7B 3PMJA 3MMGA 3S7KB 2BOHB 1C1UH 4ZHMU 7GCHG 1AB9C 1Y3XA 2ALPA 4FUJA 1TNKA 2OQ5A 2ZIQH 3SO3A 1HBTH 4YO9A 3UNQA 1GVZA 1NFYA 3AW0A 1IAUA 3RXOA 1XKAC 3QK1A 2BD2A 4X6NA 2ZP0H 1C5VA 4B75A 2QV1A 3GCTG 1UTMA 3ZYDA 1S0QA 3PB1E 4JZDH 3BEFB 4BAMB 1TAWA 4X1QU 1Q31A 3ENSB 1TGTA 2CV3A 2BXUH 2CHAB 4CRBA 1NT1A 3SI3H 2GTBA 2F9NA 1TOCB 2EI6A 3A7WA 1UO6A 1K1JA 3UWIA 2Y5GA 4R0IA 1ZLRA 1BMAA 2AIPA 3BTWE 1OWDA 1GHWH 2VIDA 5HM2A 2P3FH 2PFEA 3TITA 1BB0B 2W5EA 3K6ZA 1H9IE 1J14A 8KME2 4A6LA 1DE7H 1YLDA 1MUEB 2Z3DA 1UTLM 3NZIA 1ESBA 5EPNA 3GYMA 4MNWA 2GCHG 2J92A 1GI1A 1D3QB 1CA0B 4BNRA 4AYYB 1ZYOA 3SV6A 1GMHF 2BVRH 1CA8B 1GL1A 1GHZA 1SBWA 3GCNA 4B76A 3LGWA 1C2LA 4LZ1H 1MH0A 2GVFA 3KNXA 4AFZA 4CRGA 4HFPB 2BZAA 3TNSA 5LPFA 4NZQA 5T6GA 1C1QA 3K65B 3F9EA 1Z1IA 1PPCE 2VJ1A 3PLPA 1AWHB 4YZUA 2WPKS 1V2NT 3SU2A 4CH8B 2V3OH 1P09A 1NU7B 1G32B 4A1TA 4E06H 1YCPM 1IHSH 1ZSJA 1KTSB 1FN6A 4JK6A 2WV5A 3AAUA 2H5DA 4UFGH 1TGBA 2R3YA 1O2TA 3PO1C 2VNTA 1JRTA 1HGTH 1FPHH 4UFEH 1EAUA 1QRXA 1TB6H 3ELAH 1MKXK 2AFQB 2TGAA 2OLGA 1GJ8B 1AVWA 1C5XB 3GY3A 3RXCA 4X8UH 3HPTB 5E2OA 5CE1A 1OP2A 4CRAA 1C1MA 1MZDA 5JYIA 1DDJA 3LGIA 4VGCB 1W2KH 2FX4A 5FPSA 3RU4E 2OC8A 2RDLA 1RRKA 1WAYB 4WMDA 1O5CB 1AFEH 1RS0A 1D3PB 2Z9KA 1ZGVA 1UCYH 3MO9A 5A0AE 1C4V2 5FCRA 2ZGJA 4UFDH 1A3BH 1GI7B 1CSOE 2PR3A 3VEQB 1HV7A 1P04A 3M37A 3JZ2B 2ILNA 3PROA 1GHVH 3LDXH 3U1JB 3A7YA 1S85A 4A7IB 4FU8A 1O2LA 2XBWA 4DT7B 4LXBH 1ZPBA 1GCDA 1FN8A 4X6PA 1AWFH 1O38A 2VWNA 1N6XA 3ATIA 1HJAC 1O5EH 3HATH 3F6UH 4Y79A 3TPIZ 3A7ZA 4KTCA 1GBEA 1HAIH 2FI3E 1GVLA 3MOCA 3UUZA 1BBRK 3RXPA 1EQ9A 5J4QA 1LO6A 3LOXA 2OC1A 2BDGA 2FM2A 1W13U 1C9PA 2D8WA 3MFJA 3SU4A 3EE0B 2HNTC 3NK8A 3LGYA 5AFZH 3RC6A 2DE9A 4Q7YA 4YT6H 5E2PA 9LPRA 1QL7A 1XVOA 2H9HA 2FLRH 3E91A 3UOUA 4AFSA 1SMFE 1O3FA 1LHFH 1TLDA 1SLWB 3Q3XA 4Y76A 2F83A 3TLOA 3SNCA 3TNTA 4JZFH 2ZU3A 4ABHA 1VZQH 1ESTA 2BY8X 4DIIH 4ISLA 3PLKA 2VVUA 1RXPA 3A83A 4NFFA 3OYPA 5J4SA 1O2XA 1RIWB 4BAOB 4ZUHA 1MU6B 1THSH 3ZZCA 1V2TT 2YNAA 1DY8A 4IC5A 2OUAA 5HGGA 2JETC 1BRCE 1AY6H 2J94A 1A5HA 2P3TB 4YLQH 3GCHB 1C2EA 1G9IE 2XWBI 1NTPA 3G01A 1DICA 5DGJA 2Y80A 2FOCA 4NZLA 1IQGA 3HK3B 1PPFE 1EAXA 2VU8E 1FDPA 4MPVA 3QTOH 1YKTA 1AU8A 3U1IB 2BD8A 1ABIH 3M7TA 4ZKRU 3ZZ4A 4DW2U 1BMLA 1E34B 1GJ7B 4I8KA 1Q3XA 5IDKA 2AGEX 2Y7ZA 1TBZH 4I32A 4ISOA 3GY8A 4ZAEA 1N1LA 3RC5A 1DWCH 1A5IA 4H42U 2PKSC 5GWZA 1GMDG 1NN6A 3SN8A 1NRQH 4ABEA 5FAHA 4YOJA 3DT0H 6CHAC 4AORA 2PGBB 1HB0B 5A2MH 1HXFH 1WV7H 1XUFA 3BTHE 5ETXA 4DIHH 1ZPCA 1C5NH 3Q76A 1INCA 1KLJH 3JZ1B 4Y7BA 1DVAH 1G3CA 2OP9A 3QWCH 2HGTH 1BHXF 3R3GB 1L4DA 1TPSA 2TGTA 5A0CA 1LQDB 3RMMH 5EXMA 1O3JA 3D65E 1WUNH 3TGJE 3SGBE 2F9OA 2BX3A 1GBMA 2P59A 5F8ZA 1K21H 4D9RA 4FUHA 5K0HA 1JBUH 4IGDA 3E6PH 2H9TH 1S6FA 5DPAA 1T31A 1UK2A 5L2ZH 2J9NA 1P57B 1TX6A 1O2HA 1RD3B 1XUGA 3NPSA 1NROH 2ODYB 4UE7H 2PWXA 4ZKNU 1FIZA 1K2I1 2ZHEH 1L4ZA 2SNWA 2ZZUH 4I8GA 2RA3A 3CENA 1ELDE 1IQMA 2A1DB 2FYRA 3PMAB 3RXBA 5DK1A 4ABJA 2O8LA 1T4UH 1TBQH 1V2MT 2XCNA 1GHBG 1EZSC 4OS5A 1ESAA 3KF2A 2GGVB 3RM0H 2GDDA 3P92A 4OS7A 3MU1A 4Y8ZA 3LT3A 2Z3EA 5C20A 2A32A 1SGCA 1V2ST 2CF9H 3NXPA 1OX1A 2J4IA 5LPRA 2BDHA 3M5OA 4MNVA 3NWUA 4X2WA 3D49H 4GHQA 1H8IH 2ZHFH 1DY9A 3QTVH 2Q6GA 1AVGH 2ZQ2A 4UFFH 1CVWH 1HLTH 3RXIA 5A0BA 2B0FA 2ZGXH 2R2MB 4GPGA 2RG3A 1C2KA 1HCGA 1P10A 2CHAC 2WYJA 1NFUA 1QA7A 4D7GA 1IQEA 1C1WH 4MG3A 2BB4A 3SQEE 1F92A 3UR9A 5AF9H 3VXEH 1MBMA 1O34A 4JZIA 1ELVA 1GVKB 1PPGE 1EOJA 2VH6A 3VB5A 2G8TA 5T6FA 2ANWA 4FUCA 4NIYA 2J34A 1EPTC 1G3BA 4NIWA 2ZPRA 3MHWU 1DXWA 1GBHA 3SORA 2Z7FE 2PLXA 1EASA 2CGAA 1F2SE 1GI5A 1DSTA 2JH0D 1XM1A 1U6QA 1GJCB 4TWYA 1GHYH 3B9FH 2BY9X 3MNBA 1WU1A 4ZMAH 3FZZA 2V0BA 4ZXYH 2HRVA 3SBKA 1Z6JH 2FMJA 5E0HA 3RU4T 3KEEA 4MDSA 2EA3A 8GCHF 3M5LA 3T26A 2Z6BD 2EI7A 2WPJS 4ISHH 1PQ8A 3LH3A 1T4VH 2FI5E 1LHCH 2GCTC 4GSOA 1MTUA 4NGAH 5DO4H 1SB1H 1YPKH 3URDA 1SFQB 2PKSB 2BLWA 1TGNA 4THNH 1HAOH 2H5CA 1TPPA 3ZZ7A 4UDWH 1Y8TA 3BF6H 1BDAA 3EDXB 1HDTH 5DP5A 1YM0A 2TPIZ 1F0UA 1O39A 3F1SB 3RC4A 2HWLB 2FOAA 1T8MA 1P3CA 3O8RA 3QUMP 3SU0A 3MU4A 2A2XH 2EI8A 1C1OA 4K8YA 3LGUA 2AH4X 2ODPA 1GJDB 3UREA 2SGDE 1XUHA 1A46H 5GCHG 3GOVB 3FVFB 3RXEA 2P95A 1P2KA 1GBTA 5LH8A 2WYGA 1N8OC 1GBCA 1DITH 1O5BB 1TIOA 5EXLA 1B0FA 1GJAB 1Z71A 2FOFA 1L1NA 3HGPA 1C5RA 1TQ0B 3BG4C 1VCPA 3DFJA 4NA7A 1SGRE 1NZQH 3EYDA 2ULLA 1V2WT 1DWDH 1O2PA 1O2QA 3QGNB 3TH3H 1BTWA 1ZMLA 1TRYA 3SUDA 1CHGA 1Y3VA 2O8UA 2WINI 1C1RA 1ZTJA 2QY0B 1FV9A 1O2ZA 4GAWA 2UWPA 3SV9A 1W0YH 3MYWA 2BVSH 4O3TA 4NWKA 4BXSA 3GISB 3ZVDA 2VH0A 2B9LA 2RCEA 1O3BA 1LHGH 1ANDA 1QJ6B 4H6TA 4I31A 1W14U 2HLCA 4INKA 1O32A 2W3IA 3OX7U 3TIUA 1MKXH 1UK4A 2QCYA 5A8ZA 2GDEH 2K1QA 1DSUA 2G4TA 1Y3UA 4MNXA 4B73A 1M9UA 1SLVB 3L6PA 3QX5H 2PSXA 1FY1A 1HIAB 4WWYA 3A7XA 1JXPA 1WQVH 3I29A 2BX4A 4KTSA 3ZVFA 2H9EH 2GD4B 4ABIA 2XRCA 1A7SA 1W11U 2VVVA 1AVXA 1IQFA 4J1YA 3ZYEA 1HRTH 4BTIB 3DD2H 1CGHA 3IG6B 1G2LA 1H9HE 1P8VC 5E8EH 3Q00A 5FBIA 1VITH 2Y5FA 2F91A 1J17T 5GCHF 2P16A 4MPWA 4FXGH 3TJUA 5DG6A 2ZCLP 2ZU4A 1QBOA 3E0PB 1QGFA 4AYVB 3ZZ6A 2SGQE 4Z6AH 2R0KA 1F0SA 2BDCA 3T2NA 3SJIA 3SUEA 1T7CA 1VCWA 2A7HA 3KQCA 2D2DA 4GLYA 1WCZA 4JMYA 3S9CA 3CS7A 1IOEA 3NKKA 5GDSH 2PW8H 1SGTA 2FOHA 2OBOA 3OTJE 4UD9H 5C1UA 4K1EA 1C4U2 1SGPE 1WYKA 1H4WA 3Q3YA 1L1GA 2BMGB 3O8DA 3KN2A 1V2OT 3GDUA 4CR9A 4I8JA 1YPEH 2AS9A 5BPEA 5A09A 4IW4E 1SC8U 5EGMA 2XBVA 1EB1H 2ZF0H 2XYAA 1OWJA 3U9AH 4MLFB 2Z3CA 2BLOA 1CT0E 3SOSA 1D3TB 1NY22 4IBLH 4Q7XA 1IQIA 5T6DA 1C2FA 1UTQA 1K1NA 3PMHB 5JBTA 1S84A 1BQYA 1K1IA 3RXDA 5GJ4B 3U8OH 1GI8B 1N6YA 1O30A 3V13A 1UJ1A 1SGIB 2QAAA 1TA6A 2NU2E 4JZEH 1BZXE 4TPYA 3AASA 2AERH 2VINA 1C1SA 2QA9E 5LPEA 1D6RA 1ZTKA 2V6NA 4JK5A 1DPOA 3W95A 1P9UA 2ZQ1A 3ZVEA 4GVUA 4E7NA 1S6HA 3K9XB 3SV7A 1FUJA 3EA8A 4K69A 1PPBH 4YT7H 2AMDA 1S82A 4XE4A 1C5TA 1ANBA 2BQWB 2XCFA 2J95A 3M3VA 3PWCA 2ZTXA 2A4RA 4AGJA 2KAIA 2BDIA 2FZZA 3ITIA 4XFQA 1RTLA 2OQUA 2F3CE 5FX5A 3UPEA 5CHAB 3SJKA 3RXMA 4CRDA 6GCHG 1GI0A 1C5PA 1EAWA 2BD5A 1VITF 2VVCA 4XBCA 1GMDF 1SLXB 3A7VA 5HMAA 1KXBA 1EAIA 3TU7H 3FP7E 5DP9A 3BN9A 4CHAB 1WQSA 3RXTA 1HAYB 1DXPA 1GJBB 4JZ1A 4M7GA 3B23B