2RCEA

Dfp modified degs delta pdz
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
215
structure length
204
Chain Sequence
b'DSTDETPASYNLAVRRAAPAVVNVYNRGLNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRTGRQNFLQTDASINHGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title DFP modified DegS delta PDZ
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 43
structure length 204
sequence length 215
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rceA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rceA02
1WYKA 4INHA 2WPJS 1TWXB 3EQ0H 2FEQH 3NXPA 1G37A 3ZVBA 2BX3A 1TABE 1SGRE 3S9BA 1C1UH 4NCYA 5EQSA 1SB1H 2UUKB 1NM6A 3UFAA 3UPEA 1UTOA 1G3BA 5E8EH 2BD9A 1O32A 2GV6A 1ELGA 3PMJA 1DSTA 2GDDA 2PHBA 1GI7B 1Y5AT 1ZSLA 4CRCA 1GVLA 1O38A 1MTUA 3E0PB 6GCHG 3PTNA 1DICA 4B74A 2GMTC 4OS5A 3LGUA 2KAIB 1PFXC 1PPFE 1S6HA 2Z94A 4WH8A 2D1JA 1THPB 2R0LA 1DWEH 4E7NA 5T3HA 1Y3VA 4X8TH 5DP8A 1LHGH 1OWDA 2P8OB 1C5PA 1FY1A 1YLDA 4CRGA 1B0FA 5EW1H 2Z9GA 2Q1JA 4FUGA 5JBCS 1C5TA 3E6PH 3EGKH 1HBTH 4K8YA 5GIBA 2OUAA 2QGRA 1ARBA 2ZECA 2OCVB 3F9HA 5HXFA 1L4ZA 3SV9A 5DP7A 2Q6DA 3PMHB 2GDEH 1OPHB 3ZZBA 3MH4A 1OS8A 4OGYA 1O2MA 3MU0A 2PKSC 2FZZA 1RS0A 2A4QA 3KGPA 4M7GA 3Q3YA 1FV9A 1G2MA 1H9IE 2A4GA 4Q7XA 3SJIA 5A09A 3S69A 1NRQH 1WQVH 1ELAA 1QB6A 2ZCKP 1MCTA 1NRNH 1G2LA 1UO6A 1FJSA 1HJ8A 1L2EA 1SPJA 1YPJH 1W0ZU 5CE1A 1UK2A 2SGPE 3NCLA 1Z71A 2OXSA 3BTTE 2NWNA 2BLVA 9LPRA 4VGCB 4R0IA 4K8BA 3AASA 4B2CA 4ZUHA 4X8UH 1NRPH 1QL7A 1BBRK 2A4OA 1BMAA 1QL8A 3RU4E 3D23A 4Y6DA 1N6YA 5A2MH 3ZVEA 1JRSA 3S9CA 2AMPA 2CJIA 3QK1A 4GHTA 3UWJH 2TGDA 3LJOA 1YPKH 1AVXA 3RXRA 1BA8B 1PPHE 2H5CA 1PJPA 3MI4A 4UD9H 2QY0B 1TMUH 3RLWH 3BTGE 4FUEA 1O3KA 4X2YA 1SGDE 3EE0B 1TFXA 5LPFA 1C2LA 4ABGA 4D76A 3ZZDA 3TJUA 1JWTA 3TK9A 1QHRB 2VVUA 2H1UA 4GHQA 1C5YB 1TYNA 2K1QA 3JZ1B 2XYAA 3M36A 1C1VH 3UOPA 3SJ8A 4YLUA 4I8JA 1TX8A 1P2IA 2BQ6B 3MNBA 4WXVA 1O5CB 1S82A 3SNBA 2BQ7B 3C27B 2G5VA 1GG6C 1O3AA 3RXVA 2QV1A 1IQKA 1D3PB 1EP5A 1BRAA 1TA2A 5F8ZA 3BEUA 3UNRA 3QTVH 3U1IB 1MQ6A 3ATIA 1YPMH 2BD5A 1O35A 2JH5D 2A32A 2XBVA 3BTEE 1V2MT 3RP2A 1NU7B 4NSYA 5T6DA 1NU9A 5A0CA 1UTPA 4X1SU 3GDUA 3RXOA 1F5KU 1FMGA 5E0GA 2J2UA 2CF9H 2OQUA 1BBRE 1GBKA 1RD3B 1P01A 1YPLH 4TPIZ 3FP7E 3KHVA 1TBRH 3OY5U 4X2VA 2BQWB 1AGJA 1H9HE 3L33A 3ZZCA 1W11U 3RMOH 2XBWA 1FNIA 1RTKA 1ELBA 1MTNC 1ZMNA 1BDAA 1LHEH 1TMBH 1O2RA 1V2NT 4OS4A 3BTWE 1XX9A 1L1NA 1F0RA 2FESH 1SGTA 1CGJE 3P95A 2FOHA 4Z6AH 1TA6A 1QRWA 1AY6H 2GCTB 4Y8ZA 1MU6B 1GI5A 1GBBA 5E0JA 2Y80A 5DP9A 3P70B 4DIHH 1GHWH 1C1PA 4ISIH 3P8NA 2OC0A 1Z8IB 2HGTH 5GCHG 1GJDB 3M5MA 5DPAA 5H4IB 4KP0A 4Y79A 2FI4E 1K1MA 2ZG0H 1DWCH 1O2YA 1XKAC 4K1TA 4KTUA 5ETXA 1RIWB 2OC7A 2TIOA 2AYWA 3BTHE 2ZP0H 1GJ7B 4LZ4B 1P2KA 4X6PA 3LONA 1CA0B 2A2QH 5JBTA 2W26A 2ANYA 3FZZA 5JYIA 4ABHA 1EAIA 1K28D 1Y59T 1LPKB 5HGGA 2FPZA 4K69A 3WY8A 1BHXB 1UMAH 1LVYA 1DSUA 2VGCB 1JXPA 1QB1A 1T7CA 1WBGB 2V3OH 1SGQE 4X1QU 3LIWA 2ZFRH 4ZKSU 5L6NH 3PWBA 4O97A 2Z9IA 1G3EA 1LKAA 2RCEA 3ODFA 2ZI2H 2A5AA 2P95A 2V35A 4FUBA 4JK5A 5DK1A 2FOGA 1TE0A 2V3HH 1O33A 4JYTA 3LGVA 1BMNH 3CS0A 1S84A 4OS6A 4ABAA 1CT0E 1QJ1B 2BY7X 2ANMH 7LPRA 2FYQA 3VB5A 1BTZA 2KAIA 3HK6B 1FUJA 4FUDA 1W13U 3AVZA 1P2JA 4FU7A 1IQEA 2A31A 3LGWA 4IBLH 4YESB 3A83A 2HLCA 2UWPA 2VU8E 5DJ7A 3TLOA 1LO6A 1WSSH 2VIVA 2TRMA 1FIZA 1TPPA 4DT7B 3MO9A 5EQQA 4YT7H 2NU4E 3RXKA 1D3QB 3V13A 1V2TT 1Q3XA 4AOQA 2HNTC 3A8CA 1C2EA 4CR5A 1V2WT 1PYTC 1J14A 1ELDE 3T28A 1ZPCA 1FN6A 2HWLB 3ATLA 2FOCA 4O03A 4ZKOU 2A4RA 5FHTA 2WV4A 3EA9A 2IJOB 1ABIH 1WUNH 2OLGA 1TGTA 3RXLA 1MTWA 1CGHA 4TPYA 8GCHF 1O2SA 2QXGA 3F6UH 1O2KA 5HM9A 1MAYA 1OWHA 4MNYA 4O3TA 1JMOH 2FYRA 3RM2H 1J17T 4MNXA 4TYDA 2WV5A 2BY8X 1EAWA 1O3BA 4ABFA 3O8CA 1CU1A 1DOJA 3M7TA 3MU4A 3UQVA 1MMJN 2R3YA 1Z6EA 1Y3WA 1OWKA 1GHAG 3R0FA 1CO7E 2VJ1A 3SQEE 2OP9A 1DUEA 1HGTH 3W95A 4NA7A 1CA8B 4JZEH 5FCKA 3L3TA 1EAUA 1NFYA 4AG2A 1QY6A 1ZJDA 2H6MA 2A5KA 4CBNA 3LC3A 4O3UA 1O5GH 3VB6A 2A7JA 4DG4A 1MTSA 1SLVB 2BX4A 2ZU3A 3NWUA 2HNTE 3I29A 1CHOF 1GGDB 4I8HA 4SGBE 2A0QB 3MO3A 1O3OA 2OC8A 3RXIA 1GBHA 5E2OA 1C5LH 3HK3B 3RC4A 3EA8A 2J95A 5E0HA 1HAYB 5EODA 1H9LB 4JCNA 2F83A 3N7OA 1EQ9A 3H7OA 4DJZB 2WPHS 1GCTC 3KIDU 1EKBB 1AFEH 1EATA 4UFFH 1E37B 1W3CA 4O9VA 1MBMA 1HDTH 1CSOE 1NO9H 4I7YH 3ZZ9A 1RJXB 2BDYA 4JMYA 3C1KA 3RLYH 4BXWA 4PROA 5HMAA 2NU3E 2XRCA 2JH6D 4AYVB 1GVZA 3FANA 5FAHA 2QN5T 1V2PT 4UFEH 1XMNB 2GMTB 3TK6A 1O3IA 2XCFA 1MTVA 1FDPA 4IGDA 2RA0A 1O3EA 5ABWA 2BY6X 4Q80A 3A82A 2Q6GA 3DUXH 1XVOA 1TX6A 4UDWH 1EZUC 1XUGA 3UTUH 1FY8E 5B6OA 1FI8A 3K6YA 4JZ1A 2ZFSA 1WQSA 2A1DB 2BXUH 1C5VA 1Y5BT 3GCTG 4I33A 2PFEA 1P03A 4NIVA 1O2LA 4BTIB 1Z8RA 3SJ9A 2ZQ1A 4HZHA 1SGCA 1DX5M 1SGIB 3A87A 1QBNA 2FP7B 5EOKA 4HI3A 2PTNA 4FU9A 1QA0A 3UY9A 4A6LA 1TNHA 1A5GH 1RFNA 1HPGA 1N6XA 1WAYB 2XWBI 1C9TA 5EQRA 2ZGXH 3RU4T 1DANH 3GY2A 1A3EH 1A0HB 7GCHF 1TPSA 1O3CA 3RXQA 1UTJA 3M7QA 1QJ7B 1P10A 1MD8A 3IG6B 2BD4A 2JH0D 1DDJA 2C93B 3FFGA 1C5QA 2ZHWH 3A7YA 1YPHC 4X1RU 4UFGH 1L1GA 1AVGH 1HCGA 4AFSA 1N1LA 4FUIA 5EXMA 1GJ8B 2C8ZB 3VB3A 2Z9LA 2W3IA 1MU8B 2Y5HA 4MG3A 3KF2A 1DPOA 4F49A 1AZZA 4B1TA 3TPIZ 2ALPA 2FLRH 5TCCA 1FONA 1AE8H 1MUEB 3M5NA 2ZFPH 5SGAE 2Y5FA 1BQYA 3GY7A 2XCNA 2FLBH 3SZNA 1NY22 1O3MA 1RTLA 2GT8A 1GI3A 3BG8A 2D2DA 1C1QA 5IDKA 1O2UA 2XC5A 5DP6A 1SLUB 1VR1H 4X2WA 1TQ0B 4BOHA 4DVAU 5GJ4B 4I32A 1C9PA 3UQOA 2GCHF 4NZLA 2FIRH 4FU8A 1GJBB 3STJA 5L2ZH 5GWZA 1A61H 2AMDA 5JB8S 1HB0B 1NRSH 2W7SA 5LGOA 1GG6B 4AX9H 4CRDA 3DHKH 4ZKRU 3HPTB 2PW8H 3NUMA 3RXTA 1OP0A 1P2QA 1YPHE 2TGAA 1PQ7A 1GHYH 1IHTH 4K5ZA 5C1XA 1T4VH 1P57B 2TBSA 1D6RA 2SNWA 4JZFH 4X8VH 4CH2B 3F1SB 1TMTH 1Y3UA 1MKXK 1SQOA 2C8XB 2O8LA 5GXPA 1SC8U 5JBBS 1G3DA 4Y71A 2VWMA 4ABBA 1TGBA 1DY8A 1SGYE 1ZLRA 3W94A 3VPKA 1G9IE 1ZGIA 3RXSA 3SU6A 1GI2A 2WPIS 3E90B 1H8DH 2DUCA 1EAXA 1XUJA 1EXFA 1HJ9A 2IN2A 2R2MB 1PYTD 1A3BH 5I25A 2C3SA 4BXSA 3LGTA 5C5NA 4D9QA 1GMHG 2ZU2A 1SOZA 1FXYA 1W7XH 1OWEA 2WUBA 4R8TB 1BTYA 1YCPH 3A85A 3U8RH 5K0HA 1VITF 2G5NA 4KTSA 3ZZ6A 3RXPA 1UTLM 5JB9S 3UNQA 2EI8A 3GY6A 4K3JA 3BN9A 2AGEX 1OWIA 1T32A 4ZAEA 4K1EA 2ZO3H 2AGIX 4UEHH 1N8OC 4U01A 1P0SH 2ZHEH 4WWYA 1FAKH 1V2JT 1OOKB 2FXRA 1H1BA 3TGKE 1JIMA 2UWLA 1HAIH 1LVBA 3H7TA 4Y0ZE 1B5GH 3RMLH 2I6QA 3I78A 2R2WU 1HNEE 2WYGA 1P2NA 1BRUP 1GJ6A 4IMQA 1C2IA 3OTJE 3K9XB 1ZHMA 3M37A 1A5HA 3OYPA 1DLEA 4DGJA 2EI7A 1HJAC 2VIOA 4CREA 1PPBH 1S0RA 2VB0A 3U69H 1BTHH 1GJCB 2UUYA 4INLA 4BANB 1BOQA 2AMQA 1FZZA 1SGFG 1SOTA 1GHVH 1TOMH 1VGCC 1WCZA 4X6OA 4AZ2B 2C4FH 1H4WA 1K21H 1GBLA 3FP6E 1XM1A 5LPRA 1O34A 5HYOA 2Z9KA 5BRRE 1ELCA 2F9BH 1ZHPA 4DOQA 4JYUH 1J9CH 1TONA 5AFZH 1T4UH 3QO6A 2G8TA 2ZHQH 1HYLA 4E05H 1KTSB 3D49H 1PPGE 1GI8B 1C1RA 4GCHG 1F5LA 1LHCH 1YYY1 2YNAA 4THNH 2ZA5A 3VEQB 2JKHA 5ESTE 1ZJKA 2BOKA 2VH6A 1HXFH 3RXAA 2TPIZ 2F9OA 1EP6A 2Z3DA 1EJAA 4GPGA 1XXFA 1S85A 1AFQC 4YLQH 1GHBF 3PYHA 1EJNA 5TJXA 1P09A 1C2JA 2FI3E 3SUFA 1HAXB 1U6QA 1O0DH 4AG1A 4NFEA 4YM9A 1Y3XA 5TCAA 1PQ5A 4B75A 1T8MA 5FPYA 4UONA 2XBXA 1ZPBA 4ISHH 1CT4E 3URCA 2QXHA 3P6ZB 1UTMA 1SQTA 2Z6BD 3M35A 1TRYA 1GJAB 5JPMH 3HKJB 3A7VA 1BTXA 4MLFB 3UREA 1K1LA 3VGCC 1GVKB 3FP8E 3PV4A 9ESTA 1TX7A 3LT3A 4JK6A 1NT1A 1RGQA 1MBQA 1QTFA 1THSH 3LH3A 3QX5H 1QB9A 1C2MA 4YO9A 4XE4A 4WJG2 1C4Y2 4ZXYH 2G4UA 1EOLA 2BLOA 2BD2A 4X6MA 1GL0E 1GBAA 1UK4A 3F9GA 1ABJH 2Z9JA 1O2IA 3GCHC 3KCGH 1RRKA 4ZMAH 1V2LT 3GDVA 2ZTZA 1T31A 3SN8A 1LCYA 5A0BA 1J15A 1O2XA 1BT7A 1O3LA 4D8NA 4XBBA 1Z7KA 4WXIA 1TBQH 1FQ3A 1ZYOA 3RC6A 3GYLB 2SGEE 3O8DA 3OX7U 4X1PU 3RXJA 1GCTB 2SGAA 4KTCA 4Y8XA 3TH4H 4BNRA 3LDXH 1TPOA 1BUIA 3EDXB 4AB9A 3V0XA 4K1SA 2G4TA 4NA9H 3SHAH 5F8XA 3BEIB 1X7AC 3ODDA 2AERH 1ZTJA 1GL1A 2BDHA 1OYQA 1ZMJA 2P16A 1TGNA 3V7TA 3QDZB 1ETSH 3LGIA 4F4OC 2AH4X 3LGYA 1KLIH 4I31A 1OX1A 3A7XA 3S9AA 5FXLA 1OWJA 3VB7A 5C2ZA 2PKAA 2IOTA 4KELA 4U30A 1KIGH 1SGPE 1GJ5H 3ZVAA 1DITH 2GZ9A 2J34A 3OY6U 3GCNA 1IQJA 5C1UA 2YNBA 1WV7H 4NIWA 1GBDA 1IQFA 2ZU5A 1P11E 4ZHLU 1ELVA 2PWXA 3SGAE 2GKVE 3V12A 4LXBH 1IQMA 1GI0A 1UCYK 3TIUA 4AGKA 4MDSA 2FOBA 1ELFA 2ZDNA 1AHTH 4WY3A 2WPMS 1G32B 2BZ6H 2ZWLH 1C1TA 1AUJA 1OXGA 3LU9B 1KXCA 4ZHAA 4DW2U 2A5IA 2OD3B 1F0TA 1SI5H 1GMDF 1DWBH 1Q2WA 3VFEA 2ZPRA 1HAGE 3UWIA 1IQLA 4BAHB 1FIWA 3QZQA 2CHAC 1EX3A 2BYAX 4GLYA 2VWOA 3LH1A 4BTTB 2ZU1A 1O2TA 3S0NA 2FOEA 2GGVB 3TJOA 4BAMB 2F3CE 2P3FH 3A88A 1ANCA 3S7KB 4X8SH 1VZQH 4FUJA 3VXFH 4AFUA 4K2YA 4MPVA 1FY4A 2BXTH 4ASHA 5L2YH 1MKXH 3ATKA 1WTHD 1QNJA 1GWAA 4FVBA 1FPHH 1KXEA 4IW4E 2HNTF 3LPRA 4YOGA 1V6DA 3HGNA 2QXIA 1UVOA 2R3UA 2ZEBA 1IQGA 3M7UA 1UCYE 1EPTC 1EZSC 2W5EA 4CHAC 3L6PA 4IMZA 2VH0A 2Z3CA 4GAWA 1C1MA 4CRAA 3RU4D 1K2I1 3B23B 1K22H 2F9UA 1K1NA 4D9RA 1LVOA 3R3GB 1YP9A 4SGAE 3NKKA 1DXPA 1YCPM 4E7RG 1EB2A 1HAZB 2QF3A 1FY5A 1GI6A 3VXEH 3RM0H 1VITH 3SV8A 2AFQB 3MO6A 1TQ7B 1S5SA 1O39A 1EZXC 1UVSH 5AVDA 1UTQA 4ESTE 3TU7H 2BY9X 3A84A 2WYJA 3U98H 1KSNA 4YZUA 1BRCE 1BJUA 1SHHB 2FS8A 3ZZ7A 1CQQA 2BMGB 5CHAC 1QURH 2DE9A 3RXDA 6ESTA 1A5IA 1V3XA 3O8BA 5C67A 3FVFB 3DFLA 1LVMA 3K65B 4X0WU 2ZU4A 1EZQA 1A46H 2GD4B 3PLKA 1EPTA 2O8UA 1GDUA 4Q7ZA 8GCHG 2F9NA 3B8JA 1W12U 5DG6A 4XFQA 1O2OA 1AU8A 5E2PA 2RG3A 4WVPE 3SNEA 3SV2H 3SUGA 5LH8A 1SFQB 2AS9A 2Z7FE 1W10U 1ZTKA 1D9IA 2BZAA 5HM2A 1XXDA 3D62A 3UUZA 4YTAA 3URDA 1O2JA 3TGIE 1YM0A 1CE5A 3A89A 3ZV8A 3KQCA 3MU1A 1LPGB 2I6SA 3Q77A 3RMMH 1C2DA 3G01A 2B5TB 3QGNB 4ABJA 4ZXXH 3BG4C 2C8YB 4FVDA 3SNDA 2EA3A 1EASA 4TY6A 2EEKA 1C5NH 1ETRH 8LPRA 4Q7YA 1Y5UT 2XXLA 3U1JB 5L30H 1N8OB 1DLKB 2AEIH 3FAOA 2FWWA 1PQAA 3ELAH 3Q3KA 1EUFA 1LMWB 3ZYDA 3GCTF 1BTUA 1PQ8A 1KXBA 4ABIA 5ESBA 1ARCA 2J92A 4WMDA 1O2HA 3MTYA 1GDNA 1BJVA 1BBRH 2SGQE 1O2VA 1S0QA 4JZIA 1PPZA 3MNCA 4Y0YE 2QXJA 2THFB 3ZVFA 2BVXH 1IQHA 2PUQH 2VWNA 4X6NA 1HJAB 1NPMA 5FBEA 1QFKH 1ID5H 4ABEA 1XUKA 2PLXA 2ZNKH 3QWCH 1UVPA 1ZMLA 2WPKS 1ESAA 3MH5A 3T25A 1VGCB 2PKSB 4CBOA 2ZF0H 3RXHA 5AFYH 1TOCB 5FPSA 1RTFB 5C5OA 3U9AH 1A4WH 2BVRH 1P06A 1GMCF 5A8YA 3BTQE 1CBWC 1C5XB 2UUFB 1TBZH 3M3SA 1KXDA 1C5ZB 1Q31A 1ESBA 2GVFA 2ZCHP 1O3NA 3PB1E 3UNSA 4BAKB 1HRTH 3MFJA 1ELEE 1SGEE 3F9EA 3EAJA 2BM2A 3QTOH 4H42U 5DP4A 1E34B 2Y6TA 4FUHA 1HXEH 3JZ2B 1O2QA 3LOXA 2SGFE 2VVVA 4IS5A 1SHYA 3TJNA 3ZZ8A 4D7GA 2PV9B 2BB4A 1OYTH 4AGJA 5FX5A 2BLWA 1K9OE 1F2SE 1S81A 1LHDH 1AKSB 1ZZZA 2BDCA 2TGPZ 3SU5A 1AFQB 1GBEA 3PLPA 1QRZA 2DE8A 4H6SB 1HAOH 3SI3H 3SV7A 1O5FH 1Z1JA 1LQEA 3RUOA 3ZZ3A 4JZDH 4OS1A 2HRVA 4NIYA 1WTGH 1SMFE 1W14U 2EC9H 1ZR0A 1Y8TA 5DKMA 5DGJA 7GCHG 5K7RA 1HIAA 5EW2H 1KXFA 3T26A 3BTDE 3ZZ4A 1A7SA 5EG4A 1QCPA 2CV3A 4UFDH 5A8XA 1UHBA 2ZQ2A 3OU0A 2M5TA 1UTNA 3SV6A 2XBYA 4HTCH 3SW2B 3SU0A 4CH8B 1MZAA 2ZCLP 3SU4A 3VGCB 3SOSA 1UK3A 2H9EH 3U8TH 1W0YH 1QBOA 1DT2A 4AYYB 1J16A 2G00A 5C1YA 5C3NA 1JIRA 2HPQH 2WPLS 1F7ZA 1NZQH 1MQ5A 2ULLA 2ZTXA 1AN1E 5EPNA 3RXEA 2PR3A 1IHSH 2ZGBH 5G4BA 3GCHB 1NS3A 2PKAB 2FDAA 1GBMA 2RDLA 2OQ5A 2D8WA 1VJAU 1F92A 1SG8B 2STAE 2JETC 3KN2A 4NG9H 1DXWA 3SO3A 2VINA 1T8LA 5F8TA 3ZZAA 1MZDA 2ILNA 4KKDA 1TRNA 1C5WB 4QT8C 3SNAA 3SQHE 1MTNB 3ENSB 5JBAS 2G52A 1V2ST 3RXUA 3A80A 1Z1IA 1G36A 2W7UA 2GCHG 1TNLA 4Y7AA 1EJMA 1QQUA 1A2CH 3TGJE 2BY5X 3KQEA 2NU2E 1V2QT 4Z0KA 2LNCA 3K2UA 3BSQA 1B7XB 1NTPA 6GCHF 5J4QA 2BVSH 1ZSJA 2Y5GA 4YOIA 1RXPA 7KMEH 3NK8A 2AIPA 3DA9B 3E8LA 1ANEA 2A2XH 3DD2H 2FOFA 2O8MA 4HGCA 3BIUH 3RC5A 3CP7A 1B0EA 3F9FA 1P2MA 3SUEA 5T6FA 3RXBA 2PGBB 1YC0A 3RXCA 2C90B 1DVAH 1O3JA 3A86A 1GHZA 3QUMP 4FUCA 1ORFA 2W3KA 1ZRBA 3SU3A 2ODPA 3QGJA 3T27A 2QAAA 4B71A 1QJ6B 1O2ZA 5IYTA 1HFDA 1K1JA 1ELTA 2UUJB 3AAUA 1QR3E 3U8OH 1J8AA 3RDZA 1TNIA 3ZYEA 5T6GA 4HFPB 3MMGA 1LHFH 4XSKU 4Y76A 1VITG 4GUXA 2H5DA 2P59A 1VCQA 2GTBA 3UOUA 2QIQA 1C1OA 1NFUA 2RA3A 2ASUB 2FMJA 1QIXB 2XW9A 4RKOB 1TALA 1HLTH 2A45B 1GBJA 1GBFA 3PTBA 4JYVH 1IQIA 2CHAB 5PTPA 1EB1H 3SGQE 6CHAC 1XUHA 1XUIA 1BMLA 1MKWK 2F9VA 3BTKE 2SNVA 2Y82A 2ZTYA 3K6ZA 4GCHF 1HAPH 2ZDMA 1AWHB 2ZDKA 4IC5A 1CHGA 1DS2E 1K1OA 3P8OA 1AMHA 2CXVA 1S83A 1O3DA 3PMBB 3PLBA 1W7GH 1ZHRA 1FPCH 3E91A 1C4U2 1O2WA 1L1JA 1WU1A 1A1RA 3BTFE 1ANDA 2XC0A 1KDQA 1ZSKA 4NZQA 4BAQB 1SGFA 3A7TA 1P02A 1S6FA 1E36B 2ANKH 1FAXA 3SJOA 3T62A 5JDUB 1HV7A 1VCWA 1GBCA 3SU2A 3AW1A 8ESTE 1EPTB 4CHAB 4WMFA 4AB8A 1MH0A 1AB9C 2GX4A 2ANWA 3MH6A 1Z8GA 2V6NA 5FCRA 3TH2H 2R9PA 1BCUH 1TGSZ 2O9QA 3PWCA 3UIRA 2BD7A 3SORA 1D4PB 2VNTA 1E35B 1F5RA 2XTTB 4H4FA 1BIOA 2ZFTA 1SGNE 1ZRKA 1AZ8A 1GCDA 4B2AA 1HAVA 3QN7A 3VB4A 1JRTA 3BIVH 1THRH 4H6TA 3T5FH 5CHAB 1GI4A 2CN0H 2OTVA 5F03A 1P3EA 1AO5A 1SL3A 4MTBA 1XKBC 2ALVA 3A8AA 1SFIA 2B0FA 2ZIQH 4OS2A 1SVPA 3M5LA 2VIWA 4MQAA 1AKSA 2PSXA 3MYWA 1GHBG 1ZPZA 1TAWA 1V2UT 4YT6H 5FBIA 6LPRA 1V2RT 2UWOA 3RXFA 2Y81A 2ZPQA 4ZHMU 1LPZB 1FLEE 2STBE 1JBUH 1O31A 1C2FA 2BDBA 2J4IA 1C5SA 2ZC9H 1KLTA 1W8BH 3SUDA 1O2PA 1UVTH 1TGCA 5GCHF 1G3CA 1CT2E 2G51A 4I8GA 3TJVA 3ATMA 2D26C 1C2GA 4NFFA 1OP2A 1O2GH 1O36A 3M3VA 1O5BB 3BG4B 2Q6FA 1NROH 1GI9B 1ESTA 4DIIH 3PO1C 2ZGJA 4WF8A 1L0ZA 1LDTT 1PPCE 2G81E 4MNVA 5DP3A 2FS9A 1NC6A 3TITA 2ZHFH 2YOLA 5DP5A 3PM3A 3M61U 3GOVB 3MU8A 1AD8H 2P94A 1SR5C 1DM4B 1A0JA 5EXNA 2B7DH 1DFPA 1IAUA 1D3TB 1JOUB 1P8VC 1OP8A 3ZV9A 2XWAA 4Y8YA 1V2VT 3NZIA 5DO4H 3SJKA 1AVWA 3CENA 1HUTH 1LTOA 3A7ZA 3MU5A 2QYIA 2ZHDA 1O3FA 2HALA 2ZDVH 1ACBE 4GSOA 1AUTC 3GDSA 2PUXB 1MCVA 3S7HB 2QC2A 1LKBA 2J94A 3SHCH 3Q76A 3MH7A 1C5RA 5FX6A 2ZGHA 2IPHA 4INKA 3Q00A 1O30A 2FO9A 2H9TH 1TIOA 1NN6A 3HATH 1XUFA 2ZDAH 2P8OC 2BDAA 1GBTA 3DFJA 4OS7A 1HIAB 4J2YB 1CBWB 3ZVCA 4MPWA 2HPPH 2C8WB 1UHBB 1MD7A 2J38A 2FM2A 4ZKNU 4RN6A 2ESTE 3CS7A 4KGAA 1ZOMA 4Q2KA 4A1XA 1H8IH 1WOFA 2BDGA 3GICB 1C1NA 2A7HA 1D6WA 1EOJA 1F0UA 4RKJB 3AAVA 1E38B 2OBOA 3A81A 1T8OA 1YCPK 1CGIE 2A7CA 4B76A 3HKIB 1ANBA 2VIDA 3IITA 2FX6A 1P04A 5EXLA 5A0AE 3HGPA 1Y3YA 1ZGVA 3ZVDA 8KME2 4B73A 1GMDG 1SQAA 3RXMA 4BTUB 5BPEA 2H9HA 3H5CB 4LZ1H 3MNXA 1C2HA 1AIXH 4UE7H 2B8OH 1AE5A 1UJ1A 2VWLA 1G30B 2VIQA 1GHAF 3B9FH 1O3HA 1DWDH 4DY7B 4XBCA 1ZTLA 4GVUA 3QLPH 3A8DA 4VGCC 1ETTH 4MPUA 1VCPA 2ZPSA 5CMXH 2ODYB 1O5DH 1A0LA 5GDSH 3OSYA 3LKWA 1C4V2 2OINA 3T29A 2TGTA 2NU0E 2GZ7A 1AI8H 3FZDA 1YPGH 1FY3A 3A8BA 1E0FD 4A1TA 4XDEA 1SSXA 4A7IB 1V2KT 1BTPA 2GP9B 2BHGA 3MNSA 1NESE 3MWIU 2JETB 1O3GA 3SBKA 4ISOA 2OC1A 2Y7XA 2WUCA 1KY9A 1UVUH 3I77A 3KQBA 2QCYA 1K1PA 1BB0B 1INCA 1KTTB 1NFXA 2R0KA 1Z6JH 1AWFH 1KYNA 1W2KH 2VIPA 5EU8A 4AFQA 4Y11E 4YOJA 3GISB 3QZRA 1P12E 3NPSA 3GY3A 4TY7A 2B9LA 3V3MA 2NU1E 4A92A 1VJ9U 2HVXA 2ZFQH 5AHGH 4B2BA 1CVWH 1DE7H 1UTKA 4DCDA 1MKWH 2OBQA 1P2OA 1DUAA 2GZ8A 1Z8JB 3GYMA 3GY8A 3LJJA 4MNWA 2H2ZA 1OSSA 2FOMB 2O8WA 2AGGX 1V2OT 2BDIA 2PSYA 4CRBA 3F68H 2J9NA 4WMEA 1YLCA 4NSVA 1XVMA 3AW0A 2GCTC 3KQDA 4ABDA 4OGXA 2Z3EA 1CHOG 1BRBE 5EGMA 4E06H 4U2WA 5FPTA 2ODQA 2WINI 4MVNA 3GCOA 1O2NA 3RXGA 1KDQB 1L4DA 3EYDA 1HAHH 1D3DB 4AORA 4ISNA 4AFZA 1DY9A 2LPRA 3EA7A 3A7WA 3KEEA 1P9UA 3KL6A 4LK4A 4CRFA 1RIWC 2BOHB 3SU1A 1BZXE 1P05A 1TRMA 3LC5A 2F91A 1C5MD 1FN8A 2ZKSA 3PROA 3TNSA 3MHWU 1KLJH 4BAOB 3DT0H 3PMAB 1CA0C 2ZZUH 1NRRH 3KNXA 1PPEE 2QA9E 2PTCE 4XOJA 3UR6A 1QBVH 3D65E 3MOCA 4NA8A 5F6MA 2GV7A 1GJ4H 1P3CA 6CHAB 2AIQA 1TNKA 1BHXF 2Y7ZA 2HOBA 4ZROA 1IOEA 1SLXB 2VGCC 4XBDA 3P8GA 3T2NA 1OKXA 4D7FA 2SGDE 1F0SA 1YGCH 1C1SA 5GPIB 4X2XA 1GI1A 2ZDLA 3ITIA 1BTWA 1GJ9B 3BV9B 1HAVB 2BD8A 3ZZ5A 3ATWA 4CR9A 4J1YA 1YF4A 1MAXA 5LPEA 5C20A 3IWMA 3O8RA 1O3PB 2SFAA 3M3TA 1GDQA 3SI4H 4MPXA 2EI6A 1YPEH 2BTCE 3BTME 3BEFB 1SLWB 3Q3XA 4AN7A 1QL9A 1QQ4A 2O8TA 1YBWA 4A1VA 1P9SA 1YKTA 3GY5A 2V0BA 1AB9B 2XNIA 1TNJA 2VVCA 4U32A 5EPYA 1C1WH 4IC6A 2FI5E 2BLQA 3RMNH 4RSPA 5A8ZA 1SBWA 4TWWA 1TNGA 1BMMH 1TB6H 1GMCG 5J4SA 2PGQB 3UR9A 3P17H 1O5EH 3TK5A 3E3TA 3E1XB 3ZVGA 2QF0A 1QGFA 4NIXA 2FX4A 1AQ7A 2FTLE 1M9UA 1O5AB 4NGAH 4FUFA 2P3TB 5AF9H 3TVJB 1O37A 1T8NA 2ZGCA 4Y7BA 2F9PA 4TWYA 7ESTE 1TPAE 3ESTA 1IQNA 2CGAA 3P8FA 2CMYA 1BITA 2ZFFH 2GT7A 1QRXA 4LOYH 1TLDA 4X1NU 1GMHF 1K1IA 1GPZA 3GY4A 1LQDB 1UCYH 2FODA 1QA7A 4Y10E 1C2KA 4NWKA 4A5TS 3BF6H 3TH3H 2P3UB 1C5OH 4DURA 3TNTA 2P93A 4FXGH 3M5OA 3STIA 1C5UA 2CF8H 4I8LA 2BD3A 1NFWA 2G55A 4WH6A 2XC4A 5I46H 3SNCA 3E16B 2FTMA 3SGBE 3E0NB 4I8KA 1KXAA 3PO1B 1GBIA 4NWLA 4ZH8A 1GHXH 3P92A 4K60A 4IN2A 4IN1A 2FOAA 4ISLA 1GGDC
chains in the Genus database with same CATH superfamily
1WYKA 2XNDD 4INHA 2WPJS 1TWXB 3EQ0H 2FEQH 3NXPA 1G37A 3ZVBA 2BX3A 1TABE 1SGRE 3S9BA 1C1UH 4NCYA 5EQSA 1SB1H 2UUKB 1NM6A 3UFAA 3UPEA 1UTOA 1G3BA 5E8EH 3EE7A 2BD9A 1O32A 2GV6A 1ELGA 3PMJA 1DSTA 2WHXA 2GDDA 2KCOA 2L74A 2PHBA 1GI7B 1MABB 1Y5AT 1ZSLA 4CRCA 1GVLA 1O38A 1OHHD 1MTUA 3E0PB 6GCHG 3PTNA 1DICA 4B74A 2GMTC 4OS5A 3LGUA 2KAIB 1PFXC 1PPFE 1S6HA 2Z94A 4WH8A 2QF4A 2D1JA 1THPB 2R0LA 1DWEH 4E7NA 5T3HA 1Y3VA 4X8TH 5DP8A 1LHGH 1OWDA 2PP6A 2P8OB 1C5PA 1FY1A 1YLDA 4CRGA 1B0FA 5EW1H 2Z9GA 2Q1JA 4FUGA 5JBCS 1C5TA 3E6PH 3EGKH 2RFKC 1HBTH 4K8YA 5GIBA 2OUAA 2QGRA 1ARBA 2ZECA 2OCVB 3F9HA 5HXFA 1L4ZA 3SV9A 5C94A 5DP7A 2Q6DA 3PMHB 2GDEH 1OPHB 3ZZBA 3MH4A 1OS8A 4OGYA 1O2MA 3MU0A 2IPQX 2PKSC 2FZZA 1RS0A 2A4QA 3KGPA 4M7GA 3Q3YA 1FV9A 1G2MA 1H9IE 2A4GA 4Q7XA 3SJIA 5A09A 3S69A 1NRQH 1WQVH 1ELAA 1QB6A 2ZCKP 1MCTA 1NRNH 1G2LA 1UO6A 1FJSA 1HJ8A 3KQ5A 1L2EA 2J98B 4Q4LA 1SPJA 1YPJH 1W0ZU 5CE1A 1UK2A 2SGPE 3NCLA 1Z71A 2OXSA 3BTTE 2NWNA 2BLVA 9LPRA 4VGCB 4R0IA 4K8BA 3AASA 4B2CA 4ZUHA 4X8UH 1NRPH 1QL7A 1BBRK 2A4OA 1BMAA 1QL8A 3RU4E 3D23A 4Y6DA 1N6YA 5A2MH 3ZVEA 1JRSA 3S9CA 2AMPA 2CJIA 3QK1A 4GHTA 3UWJH 2TGDA 3LJOA 1YPKH 1AVXA 3RXRA 1BA8B 1PPHE 2H5CA 1PJPA 3MI4A 4UD9H 2QY0B 1TMUH 3RLWH 3BTGE 4FUEA 1O3KA 4X2YA 1SGDE 1H8ED 1YWUA 3EE0B 1TFXA 5LPFA 1C2LA 4ABGA 4D76A 3ZZDA 3TJUA 1JWTA 3TK9A 1QHRB 2VVUA 2H1UA 4GHQA 1C5YB 1TYNA 2K1QA 3JZ1B 2XYAA 3M36A 1C1VH 3UOPA 3SJ8A 4YLUA 4I8JA 1TX8A 1P2IA 2BQ6B 3MNBA 4WXVA 1O5CB 1S82A 3SNBA 2BQ7B 3C27B 2G5VA 1GG6C 1O3AA 3RXVA 2QV1A 4HG6A 1IQKA 1D3PB 1EP5A 1BRAA 1TA2A 5F8ZA 3BEUA 3UNRA 3QTVH 3U1IB 1MQ6A 2V7QD 3ATIA 1YPMH 2BD5A 1O35A 2JH5D 2A32A 2XBVA 3BTEE 1V2MT 3RP2A 1NU7B 4AC9A 4NSYA 5T6DA 1NU9A 5A0CA 1UTPA 4X1SU 3GDUA 3RXOA 1F5KU 3DSGA 1FMGA 5E0GA 2J2UA 2CF9H 2OQUA 1BBRE 5EIYA 1GBKA 1RD3B 1P01A 1YPLH 4TPIZ 3FP7E 3KHVA 1TBRH 3OY5U 4X2VA 2BQWB 1AGJA 1H9HE 3L33A 3ZZCA 1W11U 3RMOH 2XBWA 1FNIA 1RTKA 1ELBA 1MTNC 3W1EA 1ZMNA 1BDAA 1LHEH 1TMBH 1O2RA 1V2NT 4OS4A 3BTWE 1XX9A 1L1NA 1F0RA 2FESH 1SGTA 1CGJE 3P95A 2FOHA 4Z6AH 5HIYA 1TA6A 1QRWA 1AY6H 2GCTB 4Y8ZA 1MU6B 1GI5A 1GBBA 5E0JA 2Y80A 5DP9A 3P70B 4DIHH 1GHWH 1C1PA 4ISIH 3P8NA 2OC0A 2LELA 1Z8IB 2HGTH 5GCHG 1GJDB 3M5MA 5DPAA 5H4IB 4KP0A 4Y79A 2FI4E 1K1MA 2ZG0H 1DWCH 1O2YA 1XKAC 4K1TA 4KTUA 5ETXA 1RIWB 5EJLA 2OC7A 2TIOA 2AYWA 3BTHE 2ZP0H 1GJ7B 4LZ4B 1P2KA 4X6PA 3LONA 1CA0B 2A2QH 5JBTA 2W26A 2ANYA 3FZZA 5JYIA 4ABHA 1EAIA 1K28D 1S6LA 1Y59T 1LPKB 5HGGA 2FPZA 4K69A 3WY8A 1BHXB 1UMAH 1LVYA 1DSUA 2VGCB 1JXPA 1QB1A 1T7CA 1WBGB 2V3OH 1SGQE 4X1QU 3LIWA 2ZFRH 4ZKSU 5L6NH 3PWBA 4O97A 2Z9IA 1G3EA 1LKAA 2RCEA 3ODFA 2ZI2H 2A5AA 2P95A 2V35A 4FUBA 4JK5A 5DK1A 2FOGA 4RT0A 1TE0A 2AHME 2V3HH 1O33A 4JYTA 3LGVA 1BMNH 3CS0A 1S84A 4OS6A 4ABAA 1CT0E 1WXRA 1QJ1B 2BY7X 2ANMH 7LPRA 2FYQA 3VB5A 5DSFA 1BTZA 2KAIA 3HK6B 1FUJA 4FUDA 1W13U 3AVZA 1P2JA 4FU7A 1IQEA 2A31A 3LGWA 4IBLH 4YESB 3A83A 2HLCA 2UWPA 2VU8E 5DJ7A 3TLOA 1LO6A 1WSSH 2VIVA 2TRMA 1FIZA 1TPPA 4DT7B 3MO9A 5EQQA 4YT7H 2NU4E 3RXKA 1D3QB 3V13A 1V2TT 1Q3XA 4AOQA 2HNTC 3A8CA 1C2EA 4CR5A 1V2WT 1PYTC 1J14A 1ELDE 3T28A 1ZPCA 1FN6A 2HWLB 3ATLA 2FOCA 4O03A 4ZKOU 2A4RA 5FHTA 2WV4A 3EA9A 2IJOB 1ABIH 1WUNH 2OLGA 1TGTA 3RXLA 1MTWA 1CGHA 4TPYA 8GCHF 1O2SA 2QXGA 3F6UH 1O2KA 5HM9A 1MAYA 1OWHA 4MNYA 4O3TA 1JMOH 2FYRA 3RM2H 1J17T 4MNXA 4TYDA 2WV5A 2BY8X 3OTPA 1EAWA 1E1QD 1O3BA 4ABFA 3O8CA 1CU1A 1DOJA 3M7TA 3MU4A 3UQVA 1MMJN 2R3YA 1Z6EA 1Y3WA 1OWKA 1GHAG 3R0FA 4RT1A 1CO7E 2VJ1A 3SQEE 2OP9A 1DUEA 1HGTH 3W95A 4NA7A 1CA8B 4JZEH 5FCKA 3L3TA 1EAUA 1NFYA 4AG2A 1QY6A 1ZJDA 2H6MA 2A5KA 4CBNA 3LC3A 4O3UA 1O5GH 3VB6A 2A7JA 4DG4A 1MTSA 1SLVB 2BX4A 2ZU3A 3NWUA 2HNTE 3I29A 1CHOF 1NBMD 1GGDB 4I8HA 4SGBE 2A0QB 3MO3A 1O3OA 2OC8A 3RXIA 1GBHA 5E2OA 1C5LH 3HK3B 3RC4A 3EA8A 2J95A 5E0HA 1HAYB 5EODA 1H9LB 4JCNA 2F83A 3N7OA 4XRNA 1EQ9A 3H7OA 4DJZB 2WPHS 1GCTC 3KIDU 1EKBB 1AFEH 1EATA 4UFFH 1E37B 1W3CA 4O9VA 1MBMA 1HDTH 1CSOE 5EJ1A 1NO9H 4I7YH 3ZZ9A 1RJXB 2BDYA 4JMYA 3C1KA 3RLYH 4BXWA 4PROA 5HMAA 2NU3E 2XRCA 2JH6D 4AYVB 1GVZA 3FANA 5FAHA 2QN5T 1V2PT 4UFEH 1XMNB 2GMTB 3TK6A 1O3IA 2XCFA 1MTVA 1FDPA 4IGDA 2RA0A 1O3EA 5ABWA 2BY6X 4Q80A 3A82A 2Q6GA 5C0TA 3DUXH 1XVOA 1TX6A 4UDWH 1EZUC 1XUGA 3UTUH 1FY8E 5B6OA 1FI8A 3K6YA 4JZ1A 2ZFSA 1WQSA 2A1DB 2BXUH 1C5VA 1Y5BT 3GCTG 4I33A 3N99A 2PFEA 1P03A 4NIVA 1O2LA 4BTIB 1Z8RA 3SJ9A 2ZQ1A 4HZHA 1SGCA 1DX5M 1SGIB 3A87A 1QBNA 2FP7B 5EOKA 4HI3A 2PTNA 4FU9A 1QA0A 3UY9A 4A6LA 1TNHA 1A5GH 1RFNA 1HPGA 1N6XA 1WAYB 2XWBI 1C9TA 5EQRA 2ZGXH 3RU4T 1DANH 3GY2A 1A3EH 1A0HB 7GCHF 1TPSA 2V3MA 1O3CA 3RXQA 1UTJA 3M7QA 1QJ7B 1P10A 1MD8A 3IG6B 3SZEA 2BD4A 2JH0D 1DDJA 2C93B 3FFGA 3KYGA 1C5QA 2ZHWH 3A7YA 1YPHC 4X1RU 4UFGH 1L1GA 1AVGH 1HCGA 4AFSA 1N1LA 4FUIA 5EXMA 1GJ8B 2C8ZB 3VB3A 2Z9LA 2W3IA 1MU8B 2Y5HA 4MG3A 3KF2A 1DPOA 4F49A 1AZZA 4B1TA 3TPIZ 2ALPA 2FLRH 5TCCA 1FONA 1AE8H 1MUEB 3M5NA 3AK5A 2ZFPH 5SGAE 2Y5FA 1BQYA 3GY7A 2XCNA 2FLBH 3SZNA 1NY22 1O3MA 1RTLA 2JJ2D 2GT8A 2KFWA 1GI3A 3BG8A 2D2DA 1C1QA 5IDKA 1O2UA 2XC5A 5DP6A 1SLUB 1VR1H 4X2WA 3UB0A 1TQ0B 4BOHA 4DVAU 4FETA 2K0QA 5GJ4B 2IJD1 4I32A 1C9PA 3UQOA 2GCHF 4NZLA 2FIRH 4FU8A 1GJBB 3NRLA 3STJA 5L2ZH 5GWZA 1A61H 2AMDA 5JB8S 1HB0B 1NRSH 2W7SA 5LGOA 1GG6B 4AX9H 3WWBA 4CRDA 3DHKH 4ZKRU 3HPTB 2PW8H 3NUMA 3RXTA 1OP0A 1P2QA 1YPHE 2TGAA 2KZ4A 1PQ7A 1GHYH 1IHTH 1EFRD 4K5ZA 5C1XA 1T4VH 1P57B 2TBSA 1D6RA 2SNWA 4JZFH 4X8VH 4CH2B 3F1SB 1TMTH 1Y3UA 2JJ1D 1MKXK 1SQOA 2C8XB 2O8LA 5GXPA 1SC8U 2WZQA 5JBBS 1G3DA 4Y71A 2VWMA 4ABBA 1TGBA 1DY8A 1SGYE 1ZLRA 3W94A 3VPKA 1G9IE 1ZGIA 3RXSA 3SU6A 1GI2A 2WPIS 3E90B 1H8DH 2DUCA 1EAXA 1XUJA 1EXFA 1HJ9A 2IN2A 2R2MB 1PYTD 1A3BH 5I25A 2C3SA 4BXSA 3LGTA 5C5NA 3FO8D 4D9QA 1GMHG 2ZU2A 1SOZA 1FXYA 1W7XH 1OWEA 2WUBA 4R8TB 1BTYA 1YCPH 3A85A 3U8RH 5K0HA 1E79D 1VITF 2G5NA 4KTSA 3ZZ6A 3RXPA 1UTLM 3PRDA 5JB9S 3UNQA 2EI8A 3GY6A 4K3JA 3BN9A 2AGEX 1OWIA 1T32A 4ZAEA 4K1EA 2ZO3H 2AGIX 4UEHH 1N8OC 4U01A 1P0SH 2ZHEH 4WWYA 1FAKH 1V2JT 1OOKB 2FXRA 1H1BA 3TGKE 1JIMA 2UWLA 1HAIH 1LVBA 3H7TA 4Y0ZE 1B5GH 3RMLH 2I6QA 3I78A 2WSSD 2R2WU 1HNEE 2WYGA 1P2NA 1BRUP 1GJ6A 4IMQA 1C2IA 3OTJE 3K9XB 1ZHMA 3M37A 1A5HA 3OYPA 1DLEA 4DGJA 2EI7A 1HJAC 2VIOA 3DSPA 4CREA 1PPBH 5HKKD 1S0RA 2VB0A 1E1RD 3U69H 1BTHH 1GJCB 2UUYA 4INLA 4BANB 1BOQA 2AMQA 1FZZA 1SGFG 1SOTA 1GHVH 1TOMH 1VGCC 1WCZA 4X6OA 4AZ2B 2C4FH 1H4WA 1K21H 1GBLA 3FP6E 1XM1A 5LPRA 1O34A 5HYOA 2W6JD 2Z9KA 5BRRE 1ELCA 2F9BH 1ZHPA 4DOQA 4JYUH 1J9CH 1TONA 5AFZH 1T4UH 3QO6A 2G8TA 2ZHQH 1HYLA 4E05H 1KTSB 3D49H 1PPGE 1GI8B 1C1RA 4GCHG 1F5LA 1LHCH 1YYY1 2YNAA 4THNH 2ZA5A 3VEQB 2JKHA 5ESTE 1ZJKA 2BOKA 2VH6A 1HXFH 5KGOA 3RXAA 2TPIZ 2F9OA 1EP6A 2Z3DA 1EJAA 4GPGA 1XXFA 1S85A 1AFQC 4YLQH 1GHBF 3PYHA 1EJNA 5TJXA 1P09A 1C2JA 2FI3E 3SUFA 1HAXB 1U6QA 1O0DH 4AG1A 4NFEA 4YM9A 1Y3XA 5TCAA 1PQ5A 4B75A 1T8MA 5FPYA 4UONA 2XBXA 1ZPBA 4ISHH 1CT4E 3URCA 2QXHA 3P6ZB 1UTMA 1SQTA 2Z6BD 3M35A 1TRYA 1GJAB 5JPMH 3HKJB 1W0JD 1BTXA 3A7VA 4MLFB 1K1LA 3UREA 5EJZA 1GVKB 3VGCC 3FP8E 3PV4A 3F3BA 9ESTA 1TX7A 3LT3A 4JK6A 1NT1A 1RGQA 1MBQA 1QTFA 1THSH 3U28C 3LH3A 3QX5H 1QB9A 1C2MA 4YO9A 4XE4A 4WJG2 1C4Y2 4ZXYH 2G4UA 1EOLA 2BLOA 2BD2A 4X6MA 1GL0E 1GBAA 1UK4A 3F9GA 1ABJH 2Z9JA 1O2IA 3GCHC 3KCGH 1RRKA 4ZMAH 1V2LT 3GDVA 2ZTZA 1T31A 3SN8A 1LCYA 5A0BA 1J15A 1O2XA 1BT7A 1O3LA 4D8NA 4XBBA 1Z7KA 4WXIA 1TBQH 1FQ3A 1ZYOA 3RC6A 3GYLB 2SGEE 3O8DA 3OX7U 4X1PU 3RXJA 1GCTB 2SGAA 4KTCA 4Q63A 4Y8XA 3TH4H 4BNRA 3LDXH 1TPOA 1BUIA 3EDXB 4AB9A 2QF5A 3V0XA 4K1SA 2G4TA 4NA9H 3SHAH 5F8XA 3BEIB 1X7AC 3ODDA 2AERH 1ZTJA 1GL1A 2BDHA 1OYQA 1ZMJA 2P16A 1TGNA 3V7TA 3QDZB 1ETSH 3LGIA 4F4OC 2AH4X 3LGYA 1KLIH 4I31A 1OX1A 3A7XA 3S9AA 5FXLA 1OWJA 3VB7A 5C2ZA 2PKAA 2IOTA 4KELA 4U30A 1KIGH 1SGPE 1GJ5H 3ZVAA 1DITH 2GZ9A 2J34A 3OY6U 3GCNA 1IQJA 5C1UA 2YNBA 1WV7H 4NIWA 1GBDA 2KR7A 1IQFA 3WW7A 2ZU5A 1P11E 4ZHLU 1ELVA 2PWXA 3SGAE 2GKVE 3V12A 4LXBH 1IQMA 1GI0A 1UCYK 3TIUA 4AGKA 4MDSA 2FOBA 1ELFA 2ZDNA 1AHTH 4WY3A 2WPMS 1G32B 2BZ6H 2ZWLH 2EQNA 1C1TA 1AUJA 1OXGA 3LU9B 1KXCA 4ZHAA 4DW2U 2KCYA 4YXWD 2A5IA 2OD3B 1F0TA 1SI5H 1GMDF 1DWBH 1Q2WA 3F0PA 3VFEA 3OE7D 2ZPRA 1HAGE 3UWIA 1IQLA 4BAHB 1FIWA 3QZQA 2CHAC 1EX3A 2BYAX 4GLYA 2VWOA 3LH1A 4BTTB 2ZU1A 4ACBA 1O2TA 3S0NA 2FOEA 2GGVB 3TJOA 4BAMB 2F3CE 2P3FH 3A88A 1ANCA 2YMSC 3S7KB 4X8SH 4M9FA 1VZQH 4FUJA 3VXFH 4AFUA 4K2YA 4MPVA 5C0UA 1FY4A 2BXTH 4ASHA 5L2YH 1MKXH 3ATKA 2LP6A 1WTHD 1QNJA 1GWAA 4FVBA 1FPHH 1KXEA 4IW4E 2HNTF 3LPRA 4YOGA 1V6DA 3HGNA 2QXIA 1UVOA 2R3UA 2ZEBA 1IQGA 3M7UA 1UCYE 1EPTC 1EZSC 2W5EA 4CHAC 3L6PA 4IMZA 2VH0A 2Z3CA 4GAWA 1C1MA 4CRAA 3RU4D 1K2I1 3B23B 1K22H 2XOKD 2F9UA 1K1NA 4D9RA 1LVOA 3R3GB 1YP9A 4SGAE 3NKKA 1DXPA 1YCPM 4E7RG 1EB2A 1HAZB 2QF3A 1FY5A 1GI6A 3VXEH 3RM0H 1VITH 3SV8A 2AFQB 3MO6A 2EY4C 1TQ7B 1S5SA 1O39A 1EZXC 1UVSH 5AVDA 1UTQA 4ESTE 3TU7H 2BY9X 3A84A 2WYJA 3U98H 1KSNA 4YZUA 1BRCE 1BJUA 1SHHB 2FS8A 3ZZ7A 1CQQA 2BMGB 5CHAC 1QURH 2DE9A 3RXDA 3H09A 6ESTA 1A5IA 4DT4A 1V3XA 3O8BA 5C67A 3FVFB 3DFLA 1LVMA 3K65B 4X0WU 2ZU4A 1EZQA 1A46H 2GD4B 3PLKA 1EPTA 2O8UA 1GDUA 5HIZA 4Q7ZA 8GCHG 2F9NA 3B8JA 1W12U 5DG6A 4XFQA 1O2OA 1AU8A 5E2PA 2RG3A 4WVPE 3SNEA 3SV2H 3SUGA 5LH8A 1SFQB 2AS9A 5DN6D 2Z7FE 1W10U 1ZTKA 1D9IA 2BZAA 5HM2A 1XXDA 3D62A 3UUZA 4YTAA 3URDA 1SKYE 1O2JA 3TGIE 1YM0A 1CE5A 3A89A 3ZV8A 3KQCA 3MU1A 1LPGB 2I6SA 3Q77A 3RMMH 1C2DA 3G01A 2B5TB 3QGNB 4ABJA 4ZXXH 3BG4C 2C8YB 4FVDA 4XD7D 3SNDA 2EA3A 1EASA 4TY6A 2EEKA 1C5NH 1ETRH 8LPRA 4Q7YA 1Y5UT 2XXLA 3U1JB 5L30H 1N8OB 1DLKB 2AEIH 3FAOA 1FX0B 2FWWA 1PQAA 3ELAH 3Q3KA 1EUFA 1LMWB 3ZYDA 3GCTF 1BTUA 1PQ8A 1KXBA 4ABIA 5ESBA 1ARCA 2J92A 4WMDA 1O2HA 3MTYA 1GDNA 1BJVA 5IK2D 1BBRH 2SGQE 1O2VA 1S0QA 4JZIA 1PPZA 3MNCA 4Y0YE 5CDFE 2QXJA 2THFB 3ZVFA 2BVXH 4FOUC 1IQHA 2PUQH 2VWNA 4X6NA 1HJAB 3OFND 1NPMA 5FBEA 1QFKH 1ID5H 4ABEA 1XUKA 2PLXA 2ZNKH 3QWCH 1UVPA 1ZMLA 2WPKS 1ESAA 2CK3D 3MH5A 3T25A 1VGCB 2PKSB 4CBOA 2ZF0H 3F2GA 3RXHA 5AFYH 1TOCB 3OAAD 5FPSA 1RTFB 5C5OA 3U9AH 1A4WH 2BVRH 1P06A 1GMCF 5A8YA 3BTQE 4I86A 3PV2A 5C17A 1CBWC 1C5XB 2VBCA 2UUFB 1TBZH 3M3SA 1KXDA 1C5ZB 1Q31A 1ESBA 2GVFA 2ZCHP 1O3NA 3PB1E 3UNSA 4BAKB 1HRTH 3MFJA 1ELEE 1SGEE 3F9EA 3EAJA 2BM2A 3QTOH 4H42U 5DP4A 1E34B 2Y6TA 4FUHA 1YY3A 1HXEH 3JZ2B 4B6FA 1O2QA 3LOXA 2SGFE 2VVVA 4IS5A 1SHYA 3TJNA 3ZZ8A 4D7GA 2PV9B 2BB4A 1OYTH 4AGJA 5FX5A 4ASUD 2F4LA 2BLWA 1K9OE 1F2SE 1S81A 1LHDH 1AKSB 1ZZZA 2BDCA 4B6EA 2TGPZ 3SU5A 1AFQB 1GBEA 3PLPA 1QRZA 2DE8A 4H6SB 1HAOH 3SI3H 3SV7A 1O5FH 1VKYA 1Z1JA 2K8IA 1LQEA 3RUOA 3ZZ3A 4JZDH 4OS1A 3VG8A 2HRVA 4NIYA 1WTGH 1SMFE 1W14U 2EC9H 2HLDD 1ZR0A 1Y8TA 5DKMA 4TT3D 5DGJA 7GCHG 2HVYB 5K7RA 1HIAA 5EW2H 1KXFA 3T26A 3BTDE 3ZZ4A 1A7SA 5EG4A 1QCPA 2CV3A 3F0OA 4UFDH 5A8XA 1UHBA 2ZQ2A 3OU0A 2M5TA 1UTNA 3SV6A 2XBYA 4HTCH 3SW2B 3SU0A 4CH8B 1MZAA 2ZCLP 3SU4A 3VGCB 3SOSA 1UK3A 2H9EH 3U8TH 1W0YH 1QBOA 1DT2A 4AYYB 1J16A 2G00A 5C1YA 5C3NA 1JIRA 2HPQH 2WPLS 1F7ZA 1NZQH 1MQ5A 2ULLA 2ZTXA 1AN1E 5EPNA 3RXEA 2PR3A 1IHSH 3DSOA 2ZGBH 5G4BA 3GCHB 1NS3A 2PKAB 2FDAA 1GBMA 2RDLA 2OQ5A 2D8WA 1VJAU 1F92A 1SG8B 2STAE 2JETC 3KN2A 4NG9H 1DXWA 3SO3A 2VINA 1T8LA 5F8TA 3ZZAA 1MZDA 2ILNA 4KKDA 1TRNA 1C5WB 2JIZD 4QT8C 3SNAA 1MTNB 2KCAA 3ENSB 2G52A 3SQHE 1V2ST 5JBAS 3RXUA 3A80A 1Z1IA 1G36A 2W7UA 2GCHG 1TNLA 4Y7AA 1EJMA 1QQUA 1A2CH 3TGJE 2BY5X 3KQEA 2NU2E 1V2QT 4Z0KA 2LNCA 3K2UA 3BSQA 1B7XB 1NTPA 2JDID 6GCHF 5J4QA 2BVSH 1ZSJA 2Y5GA 4YOIA 1RXPA 7KMEH 3NK8A 2AIPA 3DA9B 1W0KD 3E8LA 1ANEA 2A2XH 3DD2H 5KECA 2FOFA 2O8MA 4HGCA 3BIUH 3RC5A 5FL7D 3CP7A 1B0EA 3F9FA 1P2MA 3SUEA 5T6FA 3RXBA 2PGBB 1YC0A 2L6OA 3RXCA 2C90B 1DVAH 1O3JA 3A86A 1GHZA 3QUMP 4FUCA 1ORFA 2W3KA 1ZRBA 3SU3A 2ODPA 3QGJA 3T27A 2QAAA 4B71A 1QJ6B 1O2ZA 5IYTA 1HFDA 1K1JA 1ELTA 2UUJB 3AAUA 1QR3E 3U8OH 1J8AA 3RDZA 3WWFA 1TNIA 3ZYEA 5T6GA 4HFPB 3MMGA 1LHFH 4XSKU 4Y76A 1VITG 4GUXA 2H5DA 2P59A 1VCQA 2GTBA 3UOUA 2QIQA 1C1OA 1NFUA 2RA3A 2ASUB 2FMJA 1QIXB 2XW9A 4RKOB 1TALA 1HLTH 2A45B 1GBJA 1GBFA 3PTBA 4JYVH 1IQIA 2CHAB 5PTPA 1EB1H 3SGQE 6CHAC 1XUHA 1XUIA 1BMLA 1MKWK 2F9VA 3BTKE 2SNVA 2Y82A 2ZTYA 3K6ZA 4GCHF 1HAPH 2ZDMA 1AWHB 2ZDKA 4IC5A 1CHGA 1DS2E 1K1OA 2YMSB 3P8OA 1AMHA 2CXVA 1S83A 1O3DA 3PMBB 3PLBA 1W7GH 1ZHRA 1FPCH 3E91A 3PRBA 1C4U2 1O2WA 1L1JA 1WU1A 1A1RA 3BTFE 1ANDA 2XC0A 3CNRA 1KDQA 1ZSKA 5B6LA 4NZQA 4BAQB 1SGFA 3A7TA 1P02A 1S6FA 1E36B 2ANKH 1FAXA 3SJOA 3T62A 5JDUB 1HV7A 1VCWA 1GBCA 3SU2A 3AW1A 8ESTE 1EPTB 4CHAB 4WMFA 4AB8A 1MH0A 1AB9C 3N7EA 2GX4A 2ANWA 3MH6A 1Z8GA 2V6NA 5FCRA 3TH2H 2R9PA 1BCUH 1TGSZ 2O9QA 2GJGA 3PWCA 3UIRA 2WV9A 2BD7A 3SORA 1D4PB 2VNTA 1E35B 1F5RA 2XTTB 4H4FA 1BIOA 2ZFTA 1SGNE 1QZ8A 1ZRKA 1AZ8A 1GCDA 4B2AA 1HAVA 3QN7A 3VB4A 1JRTA 3BIVH 1THRH 4H6TA 3T5FH 5CHAB 1GI4A 1KMHB 2CN0H 2OTVA 5F03A 1P3EA 1AO5A 1SL3A 4MTBA 1XKBC 2OK5A 2ALVA 3A8AA 3DCLA 1SFIA 2B0FA 2ZIQH 5KEDA 4OS2A 1SVPA 3M5LA 2VIWA 4MQAA 3F2FA 1AKSA 2PSXA 5F53A 3MYWA 1GHBG 1ZPZA 1TAWA 2J5UA 1V2UT 4YT6H 5FBIA 6LPRA 3SYJA 1V2RT 2UWOA 3RXFA 2Y81A 3MQKC 2ZPQA 4ZHMU 1LPZB 1FLEE 2STBE 1JBUH 1O31A 1C2FA 2BDBA 2J4IA 1C5SA 2ZC9H 1KLTA 1W8BH 3SUDA 1O2PA 1UVTH 1TGCA 5GCHF 1G3CA 1CT2E 2G51A 4I8GA 1NBME 3TJVA 3ATMA 2D26C 1C2GA 4NFFA 1OP2A 1O2GH 1O36A 3M3VA 1O5BB 3BG4B 2Q6FA 1NROH 1GI9B 3FN8A 1ESTA 4DIIH 3PO1C 2ZGJA 4WF8A 1L0ZA 1LDTT 1PPCE 2G81E 4MNVA 5DP3A 2FS9A 1NC6A 3TITA 2ZHFH 2YOLA 5DP5A 3PM3A 3M61U 5T1VA 3GOVB 3MU8A 1AD8H 2P94A 1SR5C 4Z1MD 1DM4B 1A0JA 5EXNA 2B7DH 1DFPA 1IAUA 1D3TB 1JOUB 1P8VC 1OP8A 3ZV9A 2XWAA 4Y8YA 1V2VT 3NZIA 5DO4H 3SJKA 1AVWA 3CENA 1HUTH 1LTOA 3A7ZA 3MU5A 2QYIA 2ZHDA 1O3FA 2HALA 2ZDVH 1ACBE 4GSOA 1AUTC 3GDSA 2PUXB 1MCVA 3S7HB 2QC2A 1LKBA 2J94A 1H8HD 3SHCH 3Q76A 3MH7A 1C5RA 3FOAA 5FX6A 2ZGHA 2IPHA 4INKA 3Q00A 1O30A 2FO9A 2H9TH 2KX4A 1TIOA 1NN6A 3HATH 1XUFA 2ZDAH 2P8OC 2BDAA 1GBTA 3DFJA 4OS7A 1HIAB 5GNDA 4J2YB 1CBWB 3ZVCA 4MPWA 2HPPH 2C8WB 1UHBB 1MD7A 2J38A 2FM2A 4ZKNU 4RN6A 2ESTE 3CS7A 4KGAA 1ZOMA 4Q2KA 4A1XA 1H8IH 1WOFA 2BDGA 3GICB 1C1NA 2A7HA 3OEHD 1D6WA 1EOJA 1F0UA 4RKJB 3AAVA 1E38B 2OBOA 3A81A 1T8OA 1YCPK 1CGIE 2A7CA 4B76A 3HKIB 3ZIAD 1ANBA 2VIDA 3IITA 2FX6A 1P04A 5EXLA 1WDIA 5A0AE 3HGPA 1Y3YA 1ZGVA 3ZVDA 8KME2 4B73A 1GMDG 1SQAA 3RXMA 4BTUB 5BPEA 2H9HA 3H5CB 4LZ1H 3MNXA 1C2HA 1AIXH 4UE7H 2B8OH 1AE5A 1UJ1A 1COWD 2VWLA 1G30B 2RDEA 2VIQA 1GHAF 3B9FH 1O3HA 1DWDH 4DY7B 4XBCA 1ZTLA 4GVUA 3QLPH 3A8DA 4VGCC 4P02A 1ETTH 4MPUA 1VCPA 2ZPSA 5CMXH 2ODYB 1O5DH 1A0LA 5GDSH 3OSYA 3LKWA 1C4V2 2OINA 3T29A 2TGTA 2NU0E 2KM0A 2GZ7A 1AI8H 3FZDA 1YPGH 1FY3A 3KYFA 3A8BA 4ACAA 1E0FD 4A1TA 4XDEA 1SSXA 4A7IB 1V2KT 1BTPA 2GP9B 2BHGA 3MNSA 1NESE 3MWIU 2JETB 1O3GA 3SBKA 4ISOA 2F43B 2OC1A 2J98A 2Y7XA 2WUCA 1KY9A 1UVUH 3I77A 3KQBA 2M2AA 1K1PA 1BB0B 2QCYA 4F48B 1INCA 1KTTB 1NFXA 2R0KA 5CHBA 1Z6JH 1AWFH 1KYNA 1W2KH 4P00A 2VIPA 5EU8A 1UW7A 4AFQA 4Y11E 4YOJA 3GISB 3QZRA 1P12E 3NPSA 3GY3A 4TY7A 2B9LA 3V3MA 2NU1E 4A92A 1VJ9U 2HVXA 2ZFQH 5AHGH 4B2BA 1CVWH 1DE7H 1UTKA 4DCDA 1MKWH 2OBQA 1P2OA 1DUAA 2GZ8A 1Z8JB 3GYMA 1SQRA 3GY8A 3LJJA 4MNWA 2H2ZA 1OSSA 2FOMB 2O8WA 2AGGX 1V2OT 2BDIA 2PSYA 4CRBA 3F68H 2J9NA 4WMEA 2KCPA 1YLCA 4NSVA 1XVMA 3AW0A 2GCTC 3KQDA 4ABDA 4OGXA 2Z3EA 1CHOG 1BRBE 5EGMA 4E06H 4U2WA 5FPTA 2ODQA 2WINI 4MVNA 3GCOA 1O2NA 4OM9A 3RXGA 1KDQB 1L4DA 3EYDA 1HAHH 1D3DB 2WPDD 4AORA 4ISNA 4AFZA 1DY9A 2LPRA 3EA7A 3A7WA 3KEEA 3F2HA 1P9UA 3KL6A 2QE7D 4LK4A 4CRFA 1RIWC 2BOHB 3SU1A 1BZXE 1P05A 1TRMA 3LC5A 2F91A 1C5MD 1FN8A 2ZKSA 3PROA 3TNSA 3MHWU 1K0HA 1KLJH 4BAOB 3DT0H 3PMAB 1CA0C 2ZZUH 1NRRH 3KNXA 1PPEE 2QA9E 2PTCE 4XOJA 3UR6A 1QBVH 3D65E 3MOCA 4NA8A 5F6MA 2GV7A 1GJ4H 1P3CA 6CHAB 2AIQA 3UAIC 1TNKA 1BHXF 2Y7ZA 2HOBA 4ZROA 1IOEA 1SLXB 2VGCC 4XBDA 3P8GA 3T2NA 1OKXA 4D7FA 2SGDE 1F0SA 3N7DA 1YGCH 1C1SA 5GPIB 4X2XA 1GI1A 2ZDLA 3ITIA 1BTWA 1GJ9B 3BV9B 1HAVB 2BD8A 3ZZ5A 3ATWA 4CR9A 4J1YA 1YF4A 2W6ID 1MAXA 5LPEA 5C20A 3IWMA 3O8RA 1O3PB 2SFAA 3M3TA 1GDQA 3SI4H 4MPXA 2EI6A 1YPEH 2BTCE 3OEED 3BTME 3BEFB 1SLWB 3Q3XA 4AN7A 1QL9A 1QQ4A 4ZCNA 2O8TA 1YBWA 4A1VA 1P9SA 1YKTA 3GY5A 2V0BA 1AB9B 2XNIA 1TNJA 2VVCA 4U32A 5EPYA 1C1WH 4IC6A 2FI5E 3GS9A 2BLQA 3RMNH 4RSPA 5A8ZA 1SBWA 4TWWA 1TNGA 1BMMH 1TB6H 1GMCG 5J4SA 4TSFD 2PGQB 3UR9A 3P17H 1O5EH 3TK5A 3E3TA 3E1XB 3ZVGA 2QF0A 1QGFA 4NIXA 2FX4A 4RI0A 1AQ7A 2FTLE 1M9UA 1O5AB 4NGAH 4FUFA 2P3TB 5AF9H 3TVJB 1O37A 1T8NA 2ZGCA 4Y7BA 2F9PA 4TWYA 7ESTE 1TPAE 3ESTA 1IQNA 2CGAA 3P8FA 2CMYA 1BITA 2ZFFH 2GT7A 1QRXA 2YMSD 4LOYH 1TLDA 4X1NU 1GMHF 1K1IA 1GPZA 3GY4A 1LQDB 1UCYH 2FODA 1QA7A 4Y10E 1C2KA 4NWKA 4A5TS 3BF6H 3TH3H 2P3UB 1C5OH 4DURA 3TNTA 4F55A 2P93A 4FXGH 3M5OA 3STIA 1C5UA 2CF8H 2J97A 1BMFD 4I8LA 2BD3A 1NFWA 2G55A 4WH6A 2XC4A 1YLNA 3PV5A 5I46H 3SNCA 3E16B 2FTMA 3SGBE 3E0NB 4I8KA 1KXAA 3PO1B 1GBIA 4NWLA 4ZH8A 1GHXH 3P92A 3FKSD 4K60A 4IN2A 4IN1A 2FOAA 4ISLA 1GGDC
chains in the Genus database with same CATH topology
1WYKA 4INHA 2WPJS 1TWXB 3EQ0H 2FEQH 3NXPA 1G37A 3ZVBA 2BX3A 1TABE 1SGRE 3S9BA 1C1UH 4NCYA 5EQSA 1SB1H 2UUKB 1NM6A 3UFAA 3UPEA 1UTOA 1G3BA 5E8EH 2BD9A 1O32A 2GV6A 1ELGA 3PMJA 1DSTA 2GDDA 2PHBA 1GI7B 1Y5AT 1ZSLA 4CRCA 1GVLA 1O38A 1MTUA 3E0PB 6GCHG 3PTNA 1DICA 4B74A 2GMTC 4OS5A 3LGUA 2KAIB 1PFXC 1PPFE 1S6HA 2Z94A 4WH8A 2D1JA 1THPB 2R0LA 1DWEH 4E7NA 5T3HA 1Y3VA 4X8TH 5DP8A 1LHGH 1OWDA 2P8OB 1C5PA 1FY1A 1YLDA 4CRGA 1B0FA 5EW1H 2Z9GA 2Q1JA 4FUGA 5JBCS 1C5TA 3E6PH 3EGKH 1HBTH 4K8YA 5GIBA 2OUAA 2QGRA 1ARBA 2ZECA 2OCVB 3F9HA 5HXFA 1L4ZA 3SV9A 5DP7A 2Q6DA 3PMHB 2GDEH 1OPHB 3ZZBA 3MH4A 1OS8A 4OGYA 1O2MA 3MU0A 2PKSC 2FZZA 1RS0A 2A4QA 3KGPA 4M7GA 3Q3YA 1FV9A 1G2MA 1H9IE 2A4GA 4Q7XA 3SJIA 5A09A 3S69A 1NRQH 1WQVH 1ELAA 1QB6A 2ZCKP 1MCTA 1NRNH 1G2LA 1UO6A 1FJSA 1HJ8A 1L2EA 1SPJA 1YPJH 1W0ZU 5CE1A 1UK2A 2SGPE 3NCLA 1Z71A 2OXSA 3BTTE 2NWNA 2BLVA 9LPRA 4VGCB 4R0IA 4K8BA 3AASA 4B2CA 4ZUHA 4X8UH 1NRPH 1QL7A 1BBRK 2A4OA 1BMAA 1QL8A 3RU4E 3D23A 4Y6DA 1N6YA 5A2MH 3ZVEA 1JRSA 3S9CA 2AMPA 2CJIA 3QK1A 4GHTA 3UWJH 2TGDA 3LJOA 1YPKH 1AVXA 3RXRA 1BA8B 1PPHE 2H5CA 1PJPA 3MI4A 4UD9H 2QY0B 1TMUH 3RLWH 3BTGE 4FUEA 1O3KA 4X2YA 1SGDE 3EE0B 1TFXA 5LPFA 1C2LA 4ABGA 4D76A 3ZZDA 3TJUA 1JWTA 3TK9A 1QHRB 2VVUA 2H1UA 4GHQA 1C5YB 1TYNA 2K1QA 3JZ1B 2XYAA 3M36A 1C1VH 3UOPA 3SJ8A 4YLUA 4I8JA 1TX8A 1P2IA 2BQ6B 3MNBA 4WXVA 1O5CB 1S82A 3SNBA 2BQ7B 3C27B 2G5VA 1GG6C 1O3AA 3RXVA 2QV1A 1IQKA 1D3PB 1EP5A 1BRAA 1TA2A 5F8ZA 3BEUA 3UNRA 3QTVH 3U1IB 1MQ6A 3ATIA 1YPMH 2BD5A 1O35A 2JH5D 2A32A 2XBVA 3BTEE 1V2MT 3RP2A 1NU7B 4NSYA 5T6DA 1NU9A 5A0CA 1UTPA 4X1SU 3GDUA 3RXOA 1F5KU 1FMGA 5E0GA 2J2UA 2CF9H 2OQUA 1BBRE 1GBKA 1RD3B 1P01A 1YPLH 4TPIZ 3FP7E 3KHVA 1TBRH 3OY5U 4X2VA 2BQWB 1AGJA 1H9HE 3L33A 3ZZCA 1W11U 3RMOH 2XBWA 1FNIA 1RTKA 1ELBA 1MTNC 1ZMNA 1BDAA 1LHEH 1TMBH 1O2RA 1V2NT 4OS4A 3BTWE 1XX9A 1L1NA 1F0RA 2FESH 1SGTA 1CGJE 3P95A 2FOHA 4Z6AH 1TA6A 1QRWA 1AY6H 2GCTB 4Y8ZA 1MU6B 1GI5A 1GBBA 5E0JA 2Y80A 5DP9A 3P70B 4DIHH 1GHWH 1C1PA 4ISIH 3P8NA 2OC0A 1Z8IB 2HGTH 5GCHG 1GJDB 3M5MA 5DPAA 5H4IB 4KP0A 4Y79A 2FI4E 1K1MA 2ZG0H 1DWCH 1O2YA 1XKAC 4K1TA 4KTUA 5ETXA 1RIWB 2OC7A 2TIOA 2AYWA 3BTHE 2ZP0H 1GJ7B 4LZ4B 1P2KA 4X6PA 3LONA 1CA0B 2A2QH 5JBTA 2W26A 2ANYA 3FZZA 5JYIA 4ABHA 1EAIA 1K28D 1Y59T 1LPKB 5HGGA 2FPZA 4K69A 3WY8A 1BHXB 1UMAH 1LVYA 1DSUA 2VGCB 1JXPA 1QB1A 1T7CA 1WBGB 2V3OH 1SGQE 4X1QU 3LIWA 2ZFRH 4ZKSU 5L6NH 3PWBA 4O97A 2Z9IA 1G3EA 1LKAA 2RCEA 3ODFA 2ZI2H 2A5AA 2P95A 2V35A 4FUBA 4JK5A 5DK1A 2FOGA 1TE0A 2V3HH 1O33A 4JYTA 3LGVA 1BMNH 3CS0A 1S84A 4OS6A 4ABAA 1CT0E 1QJ1B 2BY7X 2ANMH 7LPRA 2FYQA 3VB5A 1BTZA 2KAIA 3HK6B 1FUJA 4FUDA 1W13U 3AVZA 1P2JA 4FU7A 1IQEA 2A31A 3LGWA 4IBLH 4YESB 3A83A 2HLCA 2UWPA 2VU8E 5DJ7A 3TLOA 1LO6A 1WSSH 2VIVA 2TRMA 1FIZA 1TPPA 4DT7B 3MO9A 5EQQA 4YT7H 2NU4E 3RXKA 1D3QB 3V13A 1V2TT 1Q3XA 4AOQA 2HNTC 3A8CA 1C2EA 4CR5A 1V2WT 1PYTC 1J14A 1ELDE 3T28A 1ZPCA 1FN6A 2HWLB 3ATLA 2FOCA 4O03A 4ZKOU 2A4RA 5FHTA 2WV4A 3EA9A 2IJOB 1ABIH 1WUNH 2OLGA 1TGTA 3RXLA 1MTWA 1CGHA 4TPYA 8GCHF 1O2SA 2QXGA 3F6UH 1O2KA 5HM9A 1MAYA 1OWHA 4MNYA 4O3TA 1JMOH 2FYRA 3RM2H 1J17T 4MNXA 4TYDA 2WV5A 2BY8X 1EAWA 1O3BA 4ABFA 3O8CA 1CU1A 1DOJA 3M7TA 3MU4A 3UQVA 1MMJN 2R3YA 1Z6EA 1Y3WA 1OWKA 1GHAG 3R0FA 1CO7E 2VJ1A 3SQEE 2OP9A 1DUEA 1HGTH 3W95A 4NA7A 1CA8B 4JZEH 5FCKA 3L3TA 1EAUA 1NFYA 4AG2A 1QY6A 1ZJDA 2H6MA 2A5KA 4CBNA 3LC3A 4O3UA 1O5GH 3VB6A 2A7JA 4DG4A 1MTSA 1SLVB 2BX4A 2ZU3A 3NWUA 2HNTE 3I29A 1CHOF 1GGDB 4I8HA 4SGBE 2A0QB 3MO3A 1O3OA 2OC8A 3RXIA 1GBHA 5E2OA 1C5LH 3HK3B 3RC4A 3EA8A 2J95A 5E0HA 1HAYB 5EODA 1H9LB 4JCNA 2F83A 3N7OA 1EQ9A 3H7OA 4DJZB 2WPHS 1GCTC 3KIDU 1EKBB 1AFEH 1EATA 4UFFH 1E37B 1W3CA 4O9VA 1MBMA 1HDTH 1CSOE 1NO9H 4I7YH 3ZZ9A 1RJXB 2BDYA 4JMYA 3C1KA 3RLYH 4BXWA 4PROA 5HMAA 2NU3E 2XRCA 2JH6D 4AYVB 1GVZA 3FANA 5FAHA 2QN5T 1V2PT 4UFEH 1XMNB 2GMTB 3TK6A 1O3IA 2XCFA 1MTVA 1FDPA 4IGDA 2RA0A 1O3EA 5ABWA 2BY6X 4Q80A 3A82A 2Q6GA 3DUXH 1XVOA 1TX6A 4UDWH 1EZUC 1XUGA 3UTUH 1FY8E 5B6OA 1FI8A 3K6YA 4JZ1A 2ZFSA 1WQSA 2A1DB 2BXUH 1C5VA 1Y5BT 3GCTG 4I33A 2PFEA 1P03A 4NIVA 1O2LA 4BTIB 1Z8RA 3SJ9A 2ZQ1A 4HZHA 1SGCA 1DX5M 1SGIB 3A87A 1QBNA 2FP7B 5EOKA 4HI3A 2PTNA 4FU9A 1QA0A 3UY9A 4A6LA 1TNHA 1A5GH 1RFNA 1HPGA 1N6XA 1WAYB 2XWBI 1C9TA 5EQRA 2ZGXH 3RU4T 1DANH 3GY2A 1A3EH 1A0HB 7GCHF 1TPSA 1O3CA 3RXQA 1UTJA 3M7QA 1QJ7B 1P10A 1MD8A 3IG6B 2BD4A 2JH0D 1DDJA 2C93B 3FFGA 1C5QA 2ZHWH 3A7YA 1YPHC 4X1RU 4UFGH 1L1GA 1AVGH 1HCGA 4AFSA 1N1LA 4FUIA 5EXMA 1GJ8B 2C8ZB 3VB3A 2Z9LA 2W3IA 1MU8B 2Y5HA 4MG3A 3KF2A 1DPOA 4F49A 1AZZA 4B1TA 3TPIZ 2ALPA 2FLRH 5TCCA 1FONA 1AE8H 1MUEB 3M5NA 2ZFPH 5SGAE 2Y5FA 1BQYA 3GY7A 2XCNA 2FLBH 3SZNA 1NY22 1O3MA 1RTLA 2GT8A 1GI3A 3BG8A 2D2DA 1C1QA 5IDKA 1O2UA 2XC5A 5DP6A 1SLUB 1VR1H 4X2WA 1TQ0B 4BOHA 4DVAU 5GJ4B 4I32A 1C9PA 3UQOA 2GCHF 4NZLA 2FIRH 4FU8A 1GJBB 3STJA 5L2ZH 5GWZA 1A61H 2AMDA 5JB8S 1HB0B 1NRSH 2W7SA 5LGOA 1GG6B 4AX9H 4CRDA 3DHKH 4ZKRU 3HPTB 2PW8H 3NUMA 3RXTA 1OP0A 1P2QA 1YPHE 2TGAA 1PQ7A 1GHYH 1IHTH 4K5ZA 5C1XA 1T4VH 1P57B 2TBSA 1D6RA 2SNWA 4JZFH 4X8VH 4CH2B 3F1SB 1TMTH 1Y3UA 1MKXK 1SQOA 2C8XB 2O8LA 5GXPA 1SC8U 5JBBS 1G3DA 4Y71A 2VWMA 4ABBA 1TGBA 1DY8A 1SGYE 1ZLRA 3W94A 3VPKA 1G9IE 1ZGIA 3RXSA 3SU6A 1GI2A 2WPIS 3E90B 1H8DH 2DUCA 1EAXA 1XUJA 1EXFA 1HJ9A 2IN2A 2R2MB 1PYTD 1A3BH 5I25A 2C3SA 4BXSA 3LGTA 5C5NA 4D9QA 1GMHG 2ZU2A 1SOZA 1FXYA 1W7XH 1OWEA 2WUBA 4R8TB 1BTYA 1YCPH 3A85A 3U8RH 5K0HA 1VITF 2G5NA 4KTSA 3ZZ6A 3RXPA 1UTLM 5JB9S 3UNQA 2EI8A 3GY6A 4K3JA 3BN9A 2AGEX 1OWIA 1T32A 4ZAEA 4K1EA 2ZO3H 2AGIX 4UEHH 1N8OC 4U01A 1P0SH 2ZHEH 4WWYA 1FAKH 1V2JT 1OOKB 2FXRA 1H1BA 3TGKE 1JIMA 2UWLA 1HAIH 1LVBA 3H7TA 4Y0ZE 1B5GH 3RMLH 2I6QA 3I78A 2R2WU 1HNEE 2WYGA 1P2NA 1BRUP 1GJ6A 4IMQA 1C2IA 3OTJE 3K9XB 1ZHMA 3M37A 1A5HA 3OYPA 1DLEA 4DGJA 2EI7A 1HJAC 2VIOA 4CREA 1PPBH 1S0RA 2VB0A 3U69H 1BTHH 1GJCB 2UUYA 4INLA 4BANB 1BOQA 2AMQA 1FZZA 1SGFG 1SOTA 1GHVH 1TOMH 1VGCC 1WCZA 4X6OA 4AZ2B 2C4FH 1H4WA 1K21H 1GBLA 3FP6E 1XM1A 5LPRA 1O34A 5HYOA 2Z9KA 5BRRE 1ELCA 2F9BH 1ZHPA 4DOQA 4JYUH 1J9CH 1TONA 5AFZH 1T4UH 3QO6A 2G8TA 2ZHQH 1HYLA 4E05H 1KTSB 3D49H 1PPGE 1GI8B 1C1RA 4GCHG 1F5LA 1LHCH 1YYY1 2YNAA 4THNH 2ZA5A 3VEQB 2JKHA 5ESTE 1ZJKA 2BOKA 2VH6A 1HXFH 3RXAA 2TPIZ 2F9OA 1EP6A 2Z3DA 1EJAA 4GPGA 1XXFA 1S85A 1AFQC 4YLQH 1GHBF 3PYHA 1EJNA 5TJXA 1P09A 1C2JA 2FI3E 3SUFA 1HAXB 1U6QA 1O0DH 4AG1A 4NFEA 4YM9A 1Y3XA 5TCAA 1PQ5A 4B75A 1T8MA 5FPYA 4UONA 2XBXA 1ZPBA 4ISHH 1CT4E 3URCA 2QXHA 3P6ZB 1UTMA 1SQTA 2Z6BD 3M35A 1TRYA 1GJAB 5JPMH 3HKJB 3A7VA 1BTXA 4MLFB 3UREA 1K1LA 3VGCC 1GVKB 3FP8E 3PV4A 9ESTA 1TX7A 3LT3A 4JK6A 1NT1A 1RGQA 1MBQA 1QTFA 1THSH 3LH3A 3QX5H 1QB9A 1C2MA 4YO9A 4XE4A 4WJG2 1C4Y2 4ZXYH 2G4UA 1EOLA 2BLOA 2BD2A 4X6MA 1GL0E 1GBAA 1UK4A 3F9GA 1ABJH 2Z9JA 1O2IA 3GCHC 3KCGH 1RRKA 4ZMAH 1V2LT 3GDVA 2ZTZA 1T31A 3SN8A 1LCYA 5A0BA 1J15A 1O2XA 1BT7A 1O3LA 4D8NA 4XBBA 1Z7KA 4WXIA 1TBQH 1FQ3A 1ZYOA 3RC6A 3GYLB 2SGEE 3O8DA 3OX7U 4X1PU 3RXJA 1GCTB 2SGAA 4KTCA 4Y8XA 3TH4H 4BNRA 3LDXH 1TPOA 1BUIA 3EDXB 4AB9A 3V0XA 4K1SA 2G4TA 4NA9H 3SHAH 5F8XA 3BEIB 1X7AC 3ODDA 2AERH 1ZTJA 1GL1A 2BDHA 1OYQA 1ZMJA 2P16A 1TGNA 3V7TA 3QDZB 1ETSH 3LGIA 4F4OC 2AH4X 3LGYA 1KLIH 4I31A 1OX1A 3A7XA 3S9AA 5FXLA 1OWJA 3VB7A 5C2ZA 2PKAA 2IOTA 4KELA 4U30A 1KIGH 1SGPE 1GJ5H 3ZVAA 1DITH 2GZ9A 2J34A 3OY6U 3GCNA 1IQJA 5C1UA 2YNBA 1WV7H 4NIWA 1GBDA 1IQFA 2ZU5A 1P11E 4ZHLU 1ELVA 2PWXA 3SGAE 2GKVE 3V12A 4LXBH 1IQMA 1GI0A 1UCYK 3TIUA 4AGKA 4MDSA 2FOBA 1ELFA 2ZDNA 1AHTH 4WY3A 2WPMS 1G32B 2BZ6H 2ZWLH 1C1TA 1AUJA 1OXGA 3LU9B 1KXCA 4ZHAA 4DW2U 2A5IA 2OD3B 1F0TA 1SI5H 1GMDF 1DWBH 1Q2WA 3VFEA 2ZPRA 1HAGE 3UWIA 1IQLA 4BAHB 1FIWA 3QZQA 2CHAC 1EX3A 2BYAX 4GLYA 2VWOA 3LH1A 4BTTB 2ZU1A 1O2TA 3S0NA 2FOEA 2GGVB 3TJOA 4BAMB 2F3CE 2P3FH 3A88A 1ANCA 3S7KB 4X8SH 1VZQH 4FUJA 3VXFH 4AFUA 4K2YA 4MPVA 1FY4A 2BXTH 4ASHA 5L2YH 1MKXH 3ATKA 1WTHD 1QNJA 1GWAA 4FVBA 1FPHH 1KXEA 4IW4E 2HNTF 3LPRA 4YOGA 1V6DA 3HGNA 2QXIA