2RCFA

Carboxysome shell protein, orfa from h. neapolitanus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
b'MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Unidentified carboxysome polypeptide
publication title Atomic-level models of the bacterial carboxysome shell.
pubmed doi rcsb
source organism Halothiobacillus neapolitanus
molecule tags Structural protein
total genus 14
structure length 82
sequence length 82
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 2rcfA00
2RCFA 4I7AA 4N8X1 2QW7A 2Z9HA 5L37A 2HD3A 4N8FA 4JW0A 4JVZA
chains in the Genus database with same CATH superfamily
3J81j 1T9HA 4NDXA 4TVAB 3UE0A 5CV8A 2N3SA 1MSHA 4OWXB 1AH9A 4X64L 2HCIA 2B39A 4NKLA 1RTOA 4QGUA 5C44B 4JI0Q 3CCSA 1TU2B 4IALA 3HOXH 3R3OA 3KLRA 2PO4A 1SRUA 4XXEA 1SMYC 4IPCA 2M00A 3J81i 2HCCA 3I91A 3TMEA 3V2TA 3QWNA 3PO3B 1SYFA 3S17H 5E4XA 1XMQQ 1Q8KA 2YU9B 1WTPA 1V1PB 1EEFD 1Q12A 1UAPA 1HR0Q 1PH5A 3J81L 1K8MA 4QUCA 2Z4HA 1ZEQX 2Z6KA 3HZXA 4OONA 2A73B 5HURA 1PH2A 4HTHA 1E3PA 5G3LD 1B50A 3DM1A 2OCEA 2SNSA 4EX5A 2EY6A 3T1YL 1YNJD 3QIAA 4H44C 3I72A 1Q86C 4Y52H 2GA4B 3Q22A 1KLGD 1QVGA 1X3EA 1WTQA 1S5DD 1YVCA 1KIXA 1LT6D 2Z0SA 5C3EB 1Q8IA 3MXNA 3TN2A 3F2DA 2WAQE 2ZTEA 4BY1H 1JORA 5FKAC 3U9OA 1TKWB 4A3IB 3AMUA 1KDAA 1EIYB 3HEJA 5J22A 1ESFA 4RG1A 2IY5B 1DONA 2QA4A 2WINB 1XPUA 2PQAB 4QY7A 3IL8A 1BKBA 2H1EA 2Y0SE 3H3VI 1PRTC 3OSOA 5C0XG 1EQRA 2B2VC 1SYEA 4DR2L 1RCVD 2E76C 1BCPD 2ALYB 3I4MH 1Y1VB 5H1SE 2A68D 3D8GA 4IUVA 2QGQA 4V0BA 3P75A 1EY7A 2UUBL 2K6AA 2G9DA 1TWGB 1UE7A 3S1RH 2F0VA 1QUQA 3R8BA 4GLAC 3ULJA 2OTJA 3K7AB 4HIMA 4ZKCB 4R4TA 5DM73 1SNDA 2AWOA 5M3MH 4QQBX 2IX0A 1LV9A 4HMIA 4OIKA 2NVXH 1LTGD 2ZJQA 3LGJA 4APVA 1EY8A 5LMNW 3NBIA 1RKNA 2K14A 2ZJRA 2NTTA 2R93H 1EYDA 2FFKB 3PUYA 2SNMA 2L1BA 3DXJC 1MIUA 2RQXA 2F0IA 3MZ5A 1CA5A 4KTAA 5IGGA 4DV1Q 2JN4A 1LLRD 3PUZA 1UNSA 1PFMA 1J5EQ 2JE6I 2JK8A 3IFTA 4P71A 4ILWA 3QG1A 1GHKA 1DOLA 1IW7D 5G3LF 4JI1L 1ASZA 2L4NA 3HG9A 3NELA 3RLFA 3EN2A 5LMNL 4JC0A 2BA1A 4G7ZC 2YYZA 2UUCL 3K5MA 1GD7A 1AE2A 2R7FA 2MGSA 2OWOA 1QUQB 3HKSA 3FHWA 1U4MA 3DWQA 1ICFB 4QL5A 4DR4Q 2CW0C 2JA6G 3BDLA 3OWEB 3OMCA 1H9KA 2F3VA 1B44D 3J80i 2EJGC 1BCPF 3CC7A 5D3DA 1SNMA 4DK1A 1NY4A 1HNXL 1O80A 1WTHA 1LABA 3EIVA 5GROA 3STBC 4P2CB 2KVMA 2HDLA 1CZGA 3J80L 3J81c 2F0HA 2Z8LA 2D9UA 1JOKA 2QILA 1PVOA 3HOXG 3DM3A 1LTAD 2SDFA 4LUZA 5CGKA 3RN5A 1U4LA 1I94L 2KEDA 2N55A 5A2QE 1VCIA 1IBKL 4A93H 2K5HA 3E9HA 2DJGC 5IT9L 1TY2A 3J7AF 4RH6A 1A3UA 4NW2A 1X3FA 1YNXA 3SR1A 4XQQA 2UU9Q 2AHOB 1B4OA 3OTOQ 2R7ZB 3GTQB 2J7ZA 2RBMA 2WACA 2KA7A 2C5CA 1CKOA 1VQGA 2MUYA 4GNXB 4GKKQ 1ET9A 2IHFA 4B3RL 3A8JE 1U4PA 4IQZA 5I2XA 3GTLH 3GV6A 4MN3A 4LF4Q 1G91A 2MNAA 4G4KA 4A3CH 1SE3A 4MHEA 1I4QA 4PMWA 2VB3X 2PPBC 5BR8Q 4FVMA 3WOEA 2D2CC 4OHJA 4BY1G 1N9WA 4ZAIA 2V4DA 2UXCL 4JYAQ 4JI7L 1EOTA 1OXSC 4QIWB 3OWFA 3UDXA 1YHBA 3TS2A 1YJ9A 1WOCA 2KJXA 2E2JB 1V1OA 4LNQA 3EJIA 4C3HB 1LTBD 1XMQL 1G2TA 4DR3Q 3I4MG 2FMCA 3S1MB 1HUNA 5KIXA 1Q90A 4LMQD 4F88A 4K0KL 1L0XB 1WCMB 3CQZH 1A8VA 2RA4A 4KY7A 4LFBQ 1TQOA 2PYKA 2HT1A 4CKBA 4GS3A 2A8VA 1LT3D 1FNUA 5M3MG 2L55A 4NXNQ 1XNRL 4G7OC 5ELDA 4R4CA 3MFGA 3CHBD 4CDDC 4JBKA 5M5XB 4WJ4A 1FNVA 1VQJA 4B3SQ 3FRPB 4JV5Q 2J4XA 1WVLA 3CCJA 2M2LA 2IL8A 2R93G 1CKMA 5IYBH 5LL6S 5AFWA 1A3TA 1T5EA 3U50C 5IGFA 4UPAA 3FPPA 1U5KA 4CDFC 1VQNA 4ABNA 2UXBL 1FNWA 4B08A 2ICIA 1D5MC 5HY6A 4AQYQ 4Y7NB 3HOWH 1JMCA 1BO0A 5EKLA 5EBDA 3VDYA 1EYCA 1PA6A 4GNXC 1X3QA 4JK1C 3S1NB 2I46A 1ONLA 3FDTA 3VYSA 2Q2UA 2B63H 3RZOB 2B3GA 3MC0B 1SNCA 1VS0A 1XXGA 2RSNA 2X6GA 4A3KH 4K14A 2JA8B 3CCRA 2BOSA 3V96A 3A7AB 2CWAA 1CFMA 3W5OA 4DV2L 1Y8PB 2CH4W 1SMYD 4RA8A 4DR6L 4RGOS 5DM63 1K83B 1EU3A 1WTWA 1OXTA 2I07B 2IX3A 3J80c 1K28A 3TBIB 1SROA 1I50H 2NUCA 3EA6A 1YBYA 1JT8A 4P72A 2AMCB 4JI4Q 2RSOA 4JI8Q 3I4NB 2ZTCA 5IT9c 3K8AA 4JG2A 1CZWA 2F03A 5D65A 1TIID 1EQVA 1I3QH 2K5WA 1IBLL 4JI6Q 1N33L 3PUXA 3QB3A 3RLNA 4BWGB 3CP0A 2FINB 4A93G 3I70A 1RHPA 2EXZA 2E74C 5EKIA 4X6AH 1JOOA 2X6LA 4MNOA 3VYTA 4CKEA 1I6VC 4HJ9A 1PRTD 2Z6BA 4DV3L 4DR4L 4CJ1B 1SE2A 2ZJPA 2F0MA 3KLWA 2WFWA 3MXUA 2XNAC 3K5NA 3I90A 4YWLA 3GTGB 1S5BD 4PMCA 1ZYRC 4A3CG 3SXHA 4DXFA 1PTOH 1EQTA 3CC4A 2KECA 4F8MA 3CCMA 1A2UA 1V9PA 5FLMH 3KF6B 3T51B 3S2HB 4TSSA 4DV4L 1DOMA 5CORA 4YCWA 1LT5D 1CHPD 4CKCA 1V8QA 4DUZQ 4MZ9A 4NP5A 3PIP3 5E4WC 1HNZQ 2AUJD 2UU9L 1XNQL 4B3ML 1TWFH 1V43A 4L8JA 2EY1A 3OYYA 4NXML 1PH4A 3GTJB 1BQQT 1ICWA 3K57A 4A3EH 4KHPQ 1D8LA 1CKNA 2A5HA 1CT1D 4DNTB 1EIHA 2EXDA 3T1HL 3TZUA 3M3YB 3H3VC 3MHBA 4LF9Q 5IYDH 5K5PA 5BR8L 4YY3Q 1D1IA 5EKKA 4IUTA 4JVZA 1YIJA 4L5SA 3HOVH 1WTXA 4OO1I 2O5JC 4BA2I 3Q23A 3RN2A 5IYBG 1I6HB 2LXKA 1F2YA 4C1NK 5M5WH 2A19A 1BXTA 1EY5A 4Z9CB 3M4OH 1Z7TA 3T13A 2K5VA 2K32A 2CW0D 4FF3A 2OEOA 4BBRH 4DR3L 3HOWG 4FO2A 4OX9Q 1PRTF 1FJGQ 1ZXTA 2Z9HA 2XWBB 3O13A 4LFCL 2CHBD 4XYQA 1TR5A 2B63G 4FP5D 4JBJA 3VR4A 2ATWA 2UUAQ 3STBD 3DHQA 4IUPA 4A3KG 4DV6L 1WTRA 1F2ZA 2V1CC 1XWEA 2B2WC 5CV7A 1TWCB 2L9HA 4BY7H 1MJCA 1GUNA 4IPGA 4WJ3M 5HGTA 3TP5A 1CKNB 5CBAE 1IZ6A 4A3JH 1G6PA 2LSSA 4AH6A 1SR3A 5FLXL 3K5LA 4ME3A 1N8RC 2NZHA 3GTPH 1MKHA 4IFDJ 2VL6A 3CCQA 1E7ZA 4RHRA 1F2LA 2YTYA 4IJLA 4QIWE 4DV5L 2JA6B 1JWUD 3FEWX 2DNEA 1NMGA 2WB1G 2BE5D 1XYIA 2E2DC 3MXGA 1X9NA 3TP7A 1O78A 4A3DH 3J7ZC 4DK3C 2NN6I 4HR7B 2SOBA 2FHTA 2PI2A 1HJPA 1JC7A 2F0EA 4O42A 5IGCA 1K0SA 1A62A 3KDFA 3VA7A 3UDGA 4A3GH 3NXWA 1FGBD 1IYVA 1G8ZD 3CW2C 3S17B 1RL2A 1KAWA 1TWHH 2Q2HA 4O2DA 4RMFA 4B3TL 1Q1BA 1LTSD 1IYUA 5AJ3Q 5C4HA 3E3XA 2ASBA 2VB2X 3FVQA 4GKJL 1YJWA 4LFAL 3PMFA 1B9MA 2CCZA 1W3SA 5ELNA 5CMDA 5ISRA 2NBFA 3HKZG 2NVTB 2YV5A 4JI6L 3FKIB 5J39A 2G9HD 5CV9A 1N32Q 1B3QA 1BBUA 5FLMG 4DF7A 1PZID 3E5SA 2ZM6L 1VQEA 4BY1B 3CRLC 4LUVA 4JI5L 5M5YH 4BBSH 2D0PA 4L5RC 4DAVA 1BBWA 2F0GA 2BH8A 1UEBA 3GTKH 2EOTA 3C2PA 2FMMA 1ESRA 1S40A 1XTDA 3S9WA 3D4WA 1B8AA 4U68A 3A55A 4K5XA 2OQ0A 4LF6Q 3NPPA 1PZKD 4MTKA 2KCTA 4A3EG 4A75A 3I4MB 4XYOA 1JWMD 1GJXA 3M85A 3KDFB 1GUWA 3S1RB 3B6YA 1YHAA 2IX1A 4FF4A 1P8LA 4M8AA 3PO2H 4UHVA 4QUFA 4RFBA 4XDXA 4FDBA 5IYDG 1Z9FA 4YHHQ 4QJFA 1X3PA 4RGNA 4ID6A 1SYDA 4IFDH 3NTIA 1PH7A 1WTVA 1K3RA 3KJPA 2K50A 3HOVG 1PFSA 1EFID 2NVXB 5FK9C 5IOCA 1AP0A 2R92B 3LX0A 2R93B 1B70B 4FXDA 1A6XA 2CH4A 1DM0B 4DN4M 1ENFA 1TS5A 1NBWA 1RDPD 4ZK9B 1O7IA 1STAA 4KJNA 4BBRG 3D31A 1HNZL 2JA5H 2MFIA 3QOJA 3S2DB 4EQ5A 5ELBA 4PZ6A 1BVSA 3BS1A 1S5CD 3I73A 5FLXc 3TS0A 1PFBA 2Y0SG 4JPBW 3D3RA 3J81E 1EYGA 1LACA 2J0TD 2HDMA 3RLOA 2K4KA 4C3JH 2VQEQ 4MIUA 1N34Q 2EYPA 4BY7G 5JAVA 3NUCA 2A69C 3T56B 4UP9A 3M4YA 4LF5L 2JP1A 2F0NA 1XMOQ 2B2UA 4EQOA 5I4DA 3Q0AA 4A3JG 1E22A 1E24A 2K03A 2PNRC 5EPKA 3UI2A 4AYBB 2HHHL 1HZCA 2IJ0A 3OMGA 3S1QH 2VS1A 4GOPC 1H95A 3PGZA 4DUYL 1RIPA 4TRDA 4X65Q 1M1KC 4CGYB 4HJ7A 3TSSA 1I5FA 1EYAA 4P73A 1NMFA 1TY0A 4A3DG 3A5ZB 2NVYB 3JAMi 1IXRA 1XX8A 3SHLA 1AZPA 1LUZA 1BNZA 1EZ6A 4DR1Q 1PTOD 4CDEC 2F4VL 3D6CA 1UEAB 5M3FH 1I4PA 1OXXK 1E1TA 1XTCD 3M7GA 2KHIA 1L2FA 3QOLA 4GN5A 1Y8OB 3MEHA 1GKHA 2B2YC 2B2TA 3NTKA 3JAML 3CCUA 4JI2Q 1HCZA 4JI3Q 1VDZA 4IJHA 5ELFA 3MXNB 4R4QA 1BOSA 4O0AA 1SFOH 3PO3H 2BDNA 2OXPA 4A3GG 4A93B 4B9XA 5FJ8H 1STBA 1II3A 3D4RA 3HFZB 4IURA 1Y8NB 5IIFA 1RF2D 1SAPA 1VQ6A 1JB7A 4P75A 1D6EC 5CBEE 4DPGA 2F0JA 1C0AA 3BVZA 4DV7L 2RCFA 4IUQA 3GTLB 4GLXA 4KI0A 5GAHC 4ZYSA 4IO9A 5D14A 1TT2A 5LMUL 2UXDL 2F0OA 2A6HD 3PIPA 4A3IH 4JOIC 1PH1A 1Q1EA 4BBSG 3MFYA 3L2PA 2E5LQ 1MD2D 4LF8Q 3A8IE 3AFQA 1STNA 1D2BA 1STEA 2F0LA 3U9SA 1KRTA 1QVCA 4F87A 1Q81C 1PDQA 4X62L 1EEID 1NR4A 2F0SA 4OIJA 3H09A 3H15A 2G5DA 4YCVA 3BVGA 2DY8A 4DV0Q 1S4ZA 3DWPA 3BDCA 1PV4A 4FF1A 4KN7C 5IYCH 1PFNA 1VQIA 1S72A 1HZ9A 5JPNC 3J7AV 3I8ZA 3BJUA 5KNCA 2NVQH 3CQZB 3S15H 3UE1A 3PO2G 3K0XA 5JJLA 2XTIA 3ZYYX 4IFDG 3SDZA 3S14H 2FJ2A 2Z6KC 2OTLA 1N32L 3D6WA 1PTOF 1KABA 1MHWC 3G6EA 3ICEA 3CAMA 3J80E 2X69A 3AYHB 4K8IA 2JQOA 5C4ZA 3N6RA 1W6KA 3PSIA 3S24A 2JYOA 1HNWQ 4RKBA 5IT9E 3L0OA 2L15A 1HR0W 2JA5G 3U58A 1EY4A 3K81C 3SEBA 4R4OA 4LF6L 1HH2P 2BDOA 5CV5A 5IWAQ 3H0GH 4L5TA 5EGTA 5EBCA 5JEAJ 2AKWB 3HOWB 4JI0L 2NB0A 4C3JG 1STHA 1OXUA 3CXCA 1ASYA 2B63B 2RDHA 3CC2A 1I4HA 2CWPA 1YI2A 3HOYH 1WD0A 5IODA 3CCEA 4KKTA 1ENCA 1O7ZA 3CPFA 3AB9A 3LWEA 1HR0L 1HPCA 5EAYA 2EPBA 2E2HH 2AQ2B 4H13C 4C3IH 5DEHA 2RHSB 3JAMc 3ERSX 3G6JB 4AIMA 4RWSC 1ZKOA 4HCEA 4PV1C 1VQ7A 1Y69U 2QEXA 1E1OA 3ULPA 2XN9C 1QVFA 1R4QB 1A63A 2D5DA 1VQOA 2R7DA 1KNEA 1CA6A 3I3CA 1A3VA 1I3QB 1IKLA 1QG7A 1EY6A 5M3FG 1TWAH 1YNND 4WRDA 1KC8C 2PI2E 2VQEL 1J8IA 1E2VA 4YWMA 5C5LA 1MJEA 4K2KA 5GAGC 3BG3A 2CQAA 2ICEC 3PO3G 4I65A 1BCPB 4DA2A 1XMOL 4MTNA 5FJ8G 1L1OA 1C9OA 1PLFA 3MWYW 3I4OA 5I6YA 1A15A 5DNFA 4KY5A 1JWSD 1WI5A 3A74A 1F9SA 4RCNA 1GUOA 4KMUC 2KUMA 2GN5A 3TEHB 1H9JA 3NTHA 3A0JA 4A3BH 3CF5A 2VUMH 1I4RA 1HA5A 3CMEA 1NAPA 2JA7B 2JEAI 3Q6SA 4RCOA 3KF8A 1EWCA 4L6TB 2RHQB 4A3IG 2B8FA 3HKZB 4GLVB 4ZKBB 1KXLA 4TQUS 3IFDA 3Q8DA 4C56C 3I56A 1UWVA 4FYDA 1BDOA 2VQFQ 1G51A 1HZAA 4JI3L 4LAAA 4R4IA 4JI2L 2Q8RE 2JSOA 1C8CA 4X3KA 1SE4A 5JEAH 4DV1L 1AE3A 1F9RA 4DR5Q 1VQDA 4OWWB 5ELEA 3WDNA 2K5NA 1J5EL 3ONAB 1PXUA 3KLSX 5IYCG 1TWFB 1LYLA 4KKUA 3VA5A 1WCMH 1K9MC 4ZUIA 1YNJC 5EPLA 4A3EB 1LM0A 1GXDC 4X66Q 4LUOA 4RGTA 4DXGA 1L1OB 4AYBE 3BZDB 1UE5A 1TXYA 2ZXRA 2K33A 4QCLA 2H5XA 3BDOA 1Z47A 3I55A 4KLKA 1TVXA 5JJZA 3HOVB 1D5XC 2H4OA 2QDBA 1Y1WH 1EL0A 1SSOA 3QJYA 4OGQC 4FXGC 5M5WB 3LNNA 1BCPC 5LHY1 3KF8B 2VNUD 3SK4A 2A68C 4LF7Q 2KHJA 5FO9B 4DV0L 3IAYA 2F1MA 3H0GG 5BN4A 1DGSA 3URYA 5C3XA 1OTCA 5C4XH 4X64Q 3RZOH 2IHEA 5KEEA 1F9PA 2EYJA 2MP1A 1EZ8A 4G57A 1EIGA 1WYDA 2MJ8A 3MTSA 3P7JA 4JW0A 3S16H 3W1BA 3GTOH 5JVG3 1F77A 3HOYG 4BY7B 5HGQA 1QZHA 1K83H 3OTOL 2K04A 2A6EC 2KOLA 2ZXOA 2C9OA 2PMZB 3GV3A 4N9PA 1X55A 4L5QA 1P16A 2JEBI 3JC66 3K7UC 4C3IG 4GKKL 4EQNA 1IHZA 2FXQA 3GTPB 1KRSA 1SMXA 1C48A 2JXMB 4LF4L 4R1JA 3UDIA 2AUKA 4IOCA 5CC4A 3G4SA 3T1YQ 4ULLA 3H3VH 2WKDA 1B9NA 3R93A 5DLQE 2XRQD 3RZDH 1IW7C 4A3DB 3ND9A 1VQ8A 1JE5A 4JYAL 1EFWA 2ZT9C 4V190 3VYUA 1VQBA 1R9TH 3PIO3 2DGYA 3SE0A 4IPHA 1VQLA 4DR2Q 2Q2TA 4A3GB 3DMUA 1LT4D 1HHVA 5DAUA 2AQ3B 1JCKB 1HXYD 2UUBQ 4LFBL 1S5FD 2OT2A 1JJGA 4TKOB 4F7XA 1CHQD 4ZRZA 4A3BG 4NXNL 1NCVA 2VUMG 2E2IH 2PW7A 3KJOA 2TSSA 4ALPA 2CFMA 1VF7A 3ITPA 1M8AA 4B3SL 3I2ZA 4JV5L 3GTMH 2EIFA 3PCOB 1EIFA 2LFNA 1GOZA 1SE8A 5T1GA 1V1QA 3KYHC 1FVIA 5M5YB 1XPRA 3H91A 1X56A 4BBSB 5JEAG 2F0FA 1FL0A 3LWUA 3GTKB 1DCZA 3A7LA 5JOBA 2M9VA 4AQYL 3D4DA 4Q5VA 5F2DA 1EY0A 4R8NA 3HOUH 3WOFA 4HIDA 1UE1A 1WCMG 1QNKA 2VY3A 5FLXE 1H9SA 1NUCA 1ILPA 5I2YA 3IRBA 5BN3A 1QE6A 2B2VA 4EQPA 3BYTB 2DNCA 1YJNA 2F3IA 4JI1Q 3M7NA 2K75A 5I9PA 3HOXB 2PZUA 3VR3A 1KAAA 5CV6A 5LMNQ 1O7YA 4JBMA 1I4GA 4OEMB 4CHTB 1DYQA 3KBXA 2HQEA 1GM5A 2UUCQ 3RNUA 2KCNA 1PYWD 2N8NA 2IW3A 4UP7A 4DAYA 5GQOA 3F1ZA 4I7ZC 1Y1WG 4C2MH 3VR6A 1ILQA 1JQYD 3NWSA 1VQHA 1K3BC 3T53B 1CUKA 4JI4L 4JI8L 5JVH3 2N78A 2K52A 4X3TA 1HQMC 4J6HA 4IPDA 3TQYA 3E9IA 1SNPA 1KHIA 3C46A 3KLSA 2JA5B 1W2BA 1X32A 2F3WA 4OELB 4PNYA 3HOZH 1HNXQ 4QB4A 1LTRD 5C4XG 3SGIA 2ES2A 2N88A 1T5XD 3FP9A 1L0WA 1V1PA 2N49A 3M9BA 4I7AA 2QCPX 4C3JB 4K5VA 3GDEA 3AQQA 3K6OA 1I94Q 1QILA 1IBKQ 4UP8A 3E0EA 1X65A 3AU7A 2MO0A 1PHJA 1K8GA 1H9SB 4C1NI 1PRTB 5C4JH 2BA0A 4DK0A 2ZTDA 3GP7A 2JJQA 3BU2A 2JA9A 3HKZE 3NENA 2WV6D 2MPMA 1SLJA 3ERQA 4ZQ3A 4B3RQ 3TRZA 2OF1A 2RF4A 2HUGA 2KQ3A 4DAYB 2PQAA 2F52A 4PQXA 5M3MB 1JB3A 5JPMC 4A3FH 2TMPA 3GQBA 1C7YA 1RD9D 1VQ4A 1SJED 2GVAA 2ID0A 2EYOA 3R2IA 1SJHD 1QWYA 1PZJD 2UXCQ 5M3FB 4JI7Q 2L11A 3U4ZA 1VQFA 1U9RA 4DUZL 4KK7A 3OIQA 5ELCA 3ZJYC 1B7YB 1H9RA 2WAQG 3U4VA 5KGUA 4DAMA 2EJMA 2IPKD 1SFOB 1VQKA 5EJWA 5IGDA 3TP8A 4K6LA 2QW7A 4HJAA 2Z1CA 4KHPL 2B8GA 1HFGA 3M4QA 3EFXD 3DEPA 1AZQA 1QOHA 4K0KQ 1SN8A 1QNUA 2OQKA 3F2CA 3C3LA 2EZVA 4DU9A 4LF9L 4A3MH 3OPOA 4YY3L 1YHQA 2NVTH 2KCCA 1XNRQ 3FKIH 5T1IA 4N8FA 5KNBA 4A4IA 3NSWA 3R2TA 5I6WA 1EWHA 1TS2A 3MAQA 1G2SA 2IWHA 1VMCA 1VQ9A 3OHXC 1CSPA 4POGA 1Q82C 1RJTA 3NQTA 4OX9L 1HUMA 2LMCB 4IUNA 1FJGL 3HOUG 2UXBQ 1EU4A 1ZYRD 1IL8A 1AEXA 5C44H 3EBEA 1J6QA 1FR3A 5CV4A 4PG3A 2UUAL 3CD6A 1B2TA 2PMZE 2DN8A 1H9MA 2NVQB 3K5OA 3S15B 1DD2A 2RCNA 3DWAA 5IY0A 2RDFA 1HQRD 2F0QA 3CCLA 3DLLA 3W2DA 2XSCA 4B9WA 1FGUA 2YU9H 3S14B 2WIIB 4ZCKA 4DV2Q 3RUZA 1SXTA 4DR6Q 1BBXC 4RKLA 1LTID 3MA2B 4IN3A 2R92H 4HCSA 1QB5D 3ULLA 3PUVA 2EQSA 2A6ED 3JAME 2R61A 3MXPA 1U0LA 3S2DH 4DR7Q 5C3EH 4J1MA 5C0XI 3HOZG 1VF5C 3BZKA 4NB3A 4R8IA 1W6JA 2NWGA 4N9TA 1NTGA 3K58A 2O2LD 1IBLQ 1X3GA 3H0GB 1N33Q 2EY5A 1MBYA 4KKSA 2EYFA 1G6ZA 2O4XA 4PZ7A 1PYSB 4OXPA 4KV6A 3P20A 5NUCA 4GNXA 4NMZA 4ODGA 4FXKC 1E2ZA 3CCVA 2K28A 4IOAA 3HOYB 1Y1VH 3ND8A 3NHHA 3NEMA 5K36H 3SK8A 1TWGH 3GD7A 1SYGA 1MI2A 5AJ3L 4DV3Q 1LO5D 3J7A5 1PMRA 4A3LH 1HTLD 3K7AH 4KD3A 2E2HB 1D5ZC 4C3IB 5A2QL 4J15A 2NVYH 1HTPA 5IP9H 2KEEA 2K5QA 3TZDA 4A3FG 3H94A 3PIOA 1Y14B 3PQIA 4DFAA 4WJWA 1GHJA 4RGMA 4YCUA 1SNOA 1K73C 1TWAB 4DV4Q 3SK5A 3BZCA 4BXXH 3Q24A 1EUJA 1SDFA 1MSGA 4E6IA 1X6OA 1PH6A 1XNQQ 1HZBA 4G7HC 2HD3A 4B3MQ 2AQ1B 2PNHA 1Q46A 4OL7A 2EYMA 4NXMQ 4OO1H 3TREA 5E7NA 3BYYB 2WKCA 1X54A 4QF4A 4KHVA 3T4AC 2B2UC 3MEFA 3NE5B 4KHZA 5EPJA 1B53A 2BE5C 2VXWA 3T1HQ 4A3MG 4YHHL 1BR9A 4A3KB 2LXJA 1RTNA 4NPSA 1DOKA 3FKIG 1MGSA 4A3BB 1B3AA 2VUMB 4YWKA 5JJKA 2F0UA 4HSPA 4BS9A 2F0KA 5GAEC 1SNQA 2D62A 4L63B 3EROA 1IL2A 1L0YB 4WORA 4YIJA 1I50B 1GUSA 2RKSA 3DUZA 5J1ZA 2I5MX 1R4PB 1RODA 3M4PA 3OOCA 2MQHA 4H7BA 4HJ5A 2QEJC 1SBBB 3NK9A 1OXVA 1B1ZA 4IFDI 2BCOA 1STGA 2KHSA 5COYA 3D0FA 2KENA 3WWVA 1CK1A 2B2TC 2WB1B 1KL9A 5GADC 5C44G 2L0CA 1PH3A 2Q8IB 2L12A 4HIKA 3TP6A 3VR5A 4LFCQ 2L5TA 3A54A 4K8JA 1JICA 1SYBA 3CPWA 1F2MA 3DEOA 1N34L 1AFPA 4DV6Q 1J9OA 3H6MA 5C3WA 4POFA 2K01A 2K7VA 3AEVA 5FOBB 4CJ0B 2F0PA 4GN3B 1VQCA 2R7ZH 3GTQH 2LKVA 2IT1A 3P1HA 1S3OA 4N8X1 2NN6H 2R92G 3GO5A 4OWTB 1JE4A 1Y1WB 3C1EA 4X65L 1EQQA 2D0OA 3EQLC 2KBNA 1EWIA 4DV5Q 1PH8A 5C3EG 3KBGA 2CQOA 2PW5A 4H02A 2F0WA 2RVLA 4Q0FA 4HIOA 4XT1B 1PTOB 4LJZC 4CDCC 4DR1L 1M4VA 1UE6A 5IP7H 3K59A 2MO1A 5C4XB 3PF4A 1I4XA 4R9WA 4CBVA 1CQFA 4DKAC 4K5WA 4A76A 4GZYC 2E2JH 4C3HH 3S16B 4DAPA 4P74A 2LS01 5KYIA 3GTOB 5M9OA 1YZ6A 2HIXA 3X3MA 3TDQA 1IKMA 4JCVE 2Q2IA 1N36Q 4JBWA 1Y1VG 3V05A 1HFNA 3QR8A 5K36G 3S1MH 2B2WA 2CKZB 4AYBG 1VQMA 1KTKA 3HP3A 4A3LG 1SEBD 4B3TQ 1STYA 2XRSD 1QCBD 2VW9A 2DJFC 1WTOA 3KF6A 2QDLA 1F9QA 3BVMA 4GKJQ 5IP9G 4LFAQ 4DR7L 1E0BA 3NBHA 3SVMA 5M5XH 3N52A 4DGZA 4XQNA 2RDGA 2O5IC 2A69D 3RD4A 1JJ2A 1OO9B 3RZDB 2E5LL 4LF8L 3PV0A 2XIWA 1DJRD 4XIGS 1IBMQ 2ZM6Q 3W1GA 3L9AX 1HRJA 4JI5Q 4LK1C 4BXXG 2GVBA 3PUWA 4XT3B 2K05A 2PZTA 1R9TB 3M4OB 1KD1C 4Y7NH 3KUPA 2WAQB 4ME5A 3L3OC 4BBRB 2NZ1D 5CR3A 1CM9A 1K8AC 2EJFC 4OO1G 4EVOA 3S1NH 3OW7A 2E8GA 4HMJA 2A74C 1NJIC 1VQPA 2PCFB 1Q3LA 1NNXA 3UDFA 1ET6A 4O1NA 3E6ZX 2F0TA 5C0XJ 2JA8H 2I5HA 2Y0SB 3AFPA 1DZ1A 4UDUC 2QKIC 2JA7H 5IGEA 2B29A 1PTOC 5I9OA 4M1UB 2E2IB 4J8QA 1NE3A 2NYZD 1FD7D 4A3JB 2KCMA 4HJ8A 1E2WA 3GTMB 5FO7B 1PH9A 3I4NH 4LWCA 3NBHB 1HNWL 4FNFA 5E1FA 3IKJA 2I0QA 2LY7A 2NTSA 4WFN3 1CSQA 5A35A 3E0JA 1AW7A 2XWJB 3C1FA 5IWAL 3X3NA 3HOUB 4XQJA 4X3UA 2PQEA 2HIVA 3KOJA 1UUPA 1GUGA 1L1OC 1JJCB 4HEDA 4X3SA 2Z4IA 3OIPA 1QZGA 1M90C 4HAEA 4FF2A 2QF7A 1XJVA 1C4QA 1XPOA 2A6HC 2R3ZA 3FPUB 1EY9A 3CRKC 4LF5Q 1D7QA 2R7ZG 5IE8A 1KLUD 2CVRA 3CKIB 3CU7A 1KNAA 4KN4C 5EQ0A 4KY6A 4BA1I 4UAIA 1GO3E 1PYBA 2NN6G 4DK6C 3VYRA 3NQIA 2F4IA 1TWHB 5ELOA 4C2MB 4ZLTF 1KDBA 2HQLA 3GTGH 2HHHQ 3I7FA 1KQSA 1CTMA 4U673 4DUYQ 4ZUJA 3I4LA 1CQVA 5KRUA 1JR0D 4LW1A 1O7LA 5E3FA 2E75C 1NR2A 2EVBA 1K8OA 1FYCA 5IP7G 3T16A 4RAUC 3HOZB 3S2HH 4K2LA 1LTLA 1WFQA 3SK6A 2PZWA 2BH2A 2F4VQ 4HN7A 4S3SA 1VQ5A 2I5LX 2YTXA 1Z6HA 4C3HG 2DY7A 5BN5A 1K0RA 1VQAA 3VR2A 4HSVA 5C0XH 5L37A 3GTJH 1DXMA 1TS4A 2EDGA 5C4JB 3J7YW 1ML0D 2F0DA 3F2UA 4DNIA 2XVSA 3A56A 3A8KE 4DNRB 2YTVA 1CI3M 3M3YH 3F8TA 1JOQA 3L7ZC 1BUVT 1WJJA 3NWTA 3KFUA 1WD1A 3PO2B 2ENBA 4DV7Q 3KK7A 5TSSA 1LTTD 5J3BA 1EOVA 4GOPA 1NSNS 2MHVA 3CMAA 3K80C 5LMUQ 2P5ZX 2UXDQ 4H0LC 2NZOA 3G7LA 4A3FB 1I6HH 3RR5A 5KNDA 2WB1E 3G48A 1HA6A 2VQFL 1YEZA 1Q7YC 1GUTA 4QMGA 2EYLA 4DR5L 4UY8C 3HGBA 5JJIA 1U4RA 1N36L 4KJOA 4X62Q 2K1BA 2EYHA 2K5DA 2B2YA 1SYCA 1GVPA 2VZAA 1A2TA 2R6GA 3W3AA 3MVVA 2SEBD 2Q8TA 4X66L 3A5UA 2JA8G 1G291 5LL6X 4IZ8A 4XTCS 5C6AA 3OW2A 3HRZC 1A0IA 1TWCH 1KDCA 2JA7G 3QO2A 4PMBA 5D3IB 5KYLA 1YITA 2WP8J 4A3MB 3F2BA 3EVQA 5CYUA 3G71A 1YNNC 4KD4A 1IYJB 1ENAA 1TS3A 1D1KA 3NP8A 1S5ED 5FO8B 2EE1A 3PF5A 5C5MA 1IBML 4RHSA 4GN4B 3ER0A 4IUUA 1QJOA 4K6DA 3I4NG 3FMCA 4PZ8A 2JA6H 2EY2A 4CJ2C 2XGTA 2DUDA 3RMHA 2AWNA 2ZXPA 1BF4A 3S1QB 3K0YA 2C35B 4GOPB 4JOIA 3HS0C 5IGBA 2A1AA 4LF7L 1VMPA 1AN8A 4EGVA
chains in the Genus database with same CATH topology
2RCFA 4I7AA 4N8X1 2QW7A 2Z9HA 5L37A 2HD3A 4N8FA 4JW0A 4JVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCF A;  4I7A A;  4N8X 1;  2QW7 A;  2Z9H A;  5L37 A;  2HD3 A;  4N8F A;  4JW0 A;  4JVZ A; 
#chains in the Genus database with same CATH topology
 3J81 j;  1T9H A;  4NDX A;  4TVA B;  3UE0 A;  5CV8 A;  2N3S A;  1MSH A;  4OWX B;  1AH9 A;  4X64 L;  2HCI A;  2B39 A;  4NKL A;  1RTO A;  4QGU A;  5C44 B;  4JI0 Q;  3CCS A;  1TU2 B;  4IAL A;  3HOX H;  3R3O A;  3KLR A;  2PO4 A;  1SRU A;  4XXE A;  1SMY C;  4IPC A;  2M00 A;  3J81 i;  2HCC A;  3I91 A;  3TME A;  3V2T A;  3QWN A;  3PO3 B;  1SYF A;  3S17 H;  5E4X A;  1XMQ Q;  1Q8K A;  2YU9 B;  1WTP A;  1V1P B;  1EEF D;  1Q12 A;  1UAP A;  1HR0 Q;  1PH5 A;  3J81 L;  1K8M A;  4QUC A;  2Z4H A;  1ZEQ X;  2Z6K A;  3HZX A;  4OON A;  2A73 B;  5HUR A;  1PH2 A;  4HTH A;  1E3P A;  5G3L D;  1B50 A;  3DM1 A;  2OCE A;  2SNS A;  4EX5 A;  2EY6 A;  3T1Y L;  1YNJ D;  3QIA A;  4H44 C;  3I72 A;  1Q86 C;  4Y52 H;  2GA4 B;  3Q22 A;  1KLG D;  1QVG A;  1X3E A;  1WTQ A;  1S5D D;  1YVC A;  1KIX A;  1LT6 D;  2Z0S A;  5C3E B;  1Q8I A;  3MXN A;  3TN2 A;  3F2D A;  2WAQ E;  2ZTE A;  4BY1 H;  1JOR A;  5FKA C;  3U9O A;  1TKW B;  4A3I B;  3AMU A;  1KDA A;  1EIY B;  3HEJ A;  5J22 A;  1ESF A;  4RG1 A;  2IY5 B;  1DON A;  2QA4 A;  2WIN B;  1XPU A;  2PQA B;  4QY7 A;  3IL8 A;  1BKB A;  2H1E A;  2Y0S E;  3H3V I;  1PRT C;  3OSO A;  5C0X G;  1EQR A;  2B2V C;  1SYE A;  4DR2 L;  1RCV D;  2E76 C;  1BCP D;  2ALY B;  3I4M H;  1Y1V B;  5H1S E;  2A68 D;  3D8G A;  4IUV A;  2QGQ A;  4V0B A;  3P75 A;  1EY7 A;  2UUB L;  2K6A A;  2G9D A;  1TWG B;  1UE7 A;  3S1R H;  2F0V A;  1QUQ A;  3R8B A;  4GLA C;  3ULJ A;  2OTJ A;  3K7A B;  4HIM A;  4ZKC B;  4R4T A;  5DM7 3;  1SND A;  2AWO A;  5M3M H;  4QQB X;  2IX0 A;  1LV9 A;  4HMI A;  4OIK A;  2NVX H;  1LTG D;  2ZJQ A;  3LGJ A;  4APV A;  1EY8 A;  5LMN W;  3NBI A;  1RKN A;  2K14 A;  2ZJR A;  2NTT A;  2R93 H;  1EYD A;  2FFK B;  3PUY A;  2SNM A;  2L1B A;  3DXJ C;  1MIU A;  2RQX A;  2F0I A;  3MZ5 A;  1CA5 A;  4KTA A;  5IGG A;  4DV1 Q;  2JN4 A;  1LLR D;  3PUZ A;  1UNS A;  1PFM A;  1J5E Q;  2JE6 I;  2JK8 A;  3IFT A;  4P71 A;  4ILW A;  3QG1 A;  1GHK A;  1DOL A;  1IW7 D;  5G3L F;  4JI1 L;  1ASZ A;  2L4N A;  3HG9 A;  3NEL A;  3RLF A;  3EN2 A;  5LMN L;  4JC0 A;  2BA1 A;  4G7Z C;  2YYZ A;  2UUC L;  3K5M A;  1GD7 A;  1AE2 A;  2R7F A;  2MGS A;  2OWO A;  1QUQ B;  3HKS A;  3FHW A;  1U4M A;  3DWQ A;  1ICF B;  4QL5 A;  4DR4 Q;  2CW0 C;  2JA6 G;  3BDL A;  3OWE B;  3OMC A;  1H9K A;  2F3V A;  1B44 D;  3J80 i;  2EJG C;  1BCP F;  3CC7 A;  5D3D A;  1SNM A;  4DK1 A;  1NY4 A;  1HNX L;  1O80 A;  1WTH A;  1LAB A;  3EIV A;  5GRO A;  3STB C;  4P2C B;  2KVM A;  2HDL A;  1CZG A;  3J80 L;  3J81 c;  2F0H A;  2Z8L A;  2D9U A;  1JOK A;  2QIL A;  1PVO A;  3HOX G;  3DM3 A;  1LTA D;  2SDF A;  4LUZ A;  5CGK A;  3RN5 A;  1U4L A;  1I94 L;  2KED A;  2N55 A;  5A2Q E;  1VCI A;  1IBK L;  4A93 H;  2K5H A;  3E9H A;  2DJG C;  5IT9 L;  1TY2 A;  3J7A F;  4RH6 A;  1A3U A;  4NW2 A;  1X3F A;  1YNX A;  3SR1 A;  4XQQ A;  2UU9 Q;  2AHO B;  1B4O A;  3OTO Q;  2R7Z B;  3GTQ B;  2J7Z A;  2RBM A;  2WAC A;  2KA7 A;  2C5C A;  1CKO A;  1VQG A;  2MUY A;  4GNX B;  4GKK Q;  1ET9 A;  2IHF A;  4B3R L;  3A8J E;  1U4P A;  4IQZ A;  5I2X A;  3GTL H;  3GV6 A;  4MN3 A;  4LF4 Q;  1G91 A;  2MNA A;  4G4K A;  4A3C H;  1SE3 A;  4MHE A;  1I4Q A;  4PMW A;  2VB3 X;  2PPB C;  5BR8 Q;  4FVM A;  3WOE A;  2D2C C;  4OHJ A;  4BY1 G;  1N9W A;  4ZAI A;  2V4D A;  2UXC L;  4JYA Q;  4JI7 L;  1EOT A;  1OXS C;  4QIW B;  3OWF A;  3UDX A;  1YHB A;  3TS2 A;  1YJ9 A;  1WOC A;  2KJX A;  2E2J B;  1V1O A;  4LNQ A;  3EJI A;  4C3H B;  1LTB D;  1XMQ L;  1G2T A;  4DR3 Q;  3I4M G;  2FMC A;  3S1M B;  1HUN A;  5KIX A;  1Q90 A;  4LMQ D;  4F88 A;  4K0K L;  1L0X B;  1WCM B;  3CQZ H;  1A8V A;  2RA4 A;  4KY7 A;  4LFB Q;  1TQO A;  2PYK A;  2HT1 A;  4CKB A;  4GS3 A;  2A8V A;  1LT3 D;  1FNU A;  5M3M G;  2L55 A;  4NXN Q;  1XNR L;  4G7O C;  5ELD A;  4R4C A;  3MFG A;  3CHB D;  4CDD C;  4JBK A;  5M5X B;  4WJ4 A;  1FNV A;  1VQJ A;  4B3S Q;  3FRP B;  4JV5 Q;  2J4X A;  1WVL A;  3CCJ A;  2M2L A;  2IL8 A;  2R93 G;  1CKM A;  5IYB H;  5LL6 S;  5AFW A;  1A3T A;  1T5E A;  3U50 C;  5IGF A;  4UPA A;  3FPP A;  1U5K A;  4CDF C;  1VQN A;  4ABN A;  2UXB L;  1FNW A;  4B08 A;  2ICI A;  1D5M C;  5HY6 A;  4AQY Q;  4Y7N B;  3HOW H;  1JMC A;  1BO0 A;  5EKL A;  5EBD A;  3VDY A;  1EYC A;  1PA6 A;  4GNX C;  1X3Q A;  4JK1 C;  3S1N B;  2I46 A;  1ONL A;  3FDT A;  3VYS A;  2Q2U A;  2B63 H;  3RZO B;  2B3G A;  3MC0 B;  1SNC A;  1VS0 A;  1XXG A;  2RSN A;  2X6G A;  4A3K H;  4K14 A;  2JA8 B;  3CCR A;  2BOS A;  3V96 A;  3A7A B;  2CWA A;  1CFM A;  3W5O A;  4DV2 L;  1Y8P B;  2CH4 W;  1SMY D;  4RA8 A;  4DR6 L;  4RGO S;  5DM6 3;  1K83 B;  1EU3 A;  1WTW A;  1OXT A;  2I07 B;  2IX3 A;  3J80 c;  1K28 A;  3TBI B;  1SRO A;  1I50 H;  2NUC A;  3EA6 A;  1YBY A;  1JT8 A;  4P72 A;  2AMC B;  4JI4 Q;  2RSO A;  4JI8 Q;  3I4N B;  2ZTC A;  5IT9 c;  3K8A A;  4JG2 A;  1CZW A;  2F03 A;  5D65 A;  1TII D;  1EQV A;  1I3Q H;  2K5W A;  1IBL L;  4JI6 Q;  1N33 L;  3PUX A;  3QB3 A;  3RLN A;  4BWG B;  3CP0 A;  2FIN B;  4A93 G;  3I70 A;  1RHP A;  2EXZ A;  2E74 C;  5EKI A;  4X6A H;  1JOO A;  2X6L A;  4MNO A;  3VYT A;  4CKE A;  1I6V C;  4HJ9 A;  1PRT D;  2Z6B A;  4DV3 L;  4DR4 L;  4CJ1 B;  1SE2 A;  2ZJP A;  2F0M A;  3KLW A;  2WFW A;  3MXU A;  2XNA C;  3K5N A;  3I90 A;  4YWL A;  3GTG B;  1S5B D;  4PMC A;  1ZYR C;  4A3C G;  3SXH A;  4DXF A;  1PTO H;  1EQT A;  3CC4 A;  2KEC A;  4F8M A;  3CCM A;  1A2U A;  1V9P A;  5FLM H;  3KF6 B;  3T51 B;  3S2H B;  4TSS A;  4DV4 L;  1DOM A;  5COR A;  4YCW A;  1LT5 D;  1CHP D;  4CKC A;  1V8Q A;  4DUZ Q;  4MZ9 A;  4NP5 A;  3PIP 3;  5E4W C;  1HNZ Q;  2AUJ D;  2UU9 L;  1XNQ L;  4B3M L;  1TWF H;  1V43 A;  4L8J A;  2EY1 A;  3OYY A;  4NXM L;  1PH4 A;  3GTJ B;  1BQQ T;  1ICW A;  3K57 A;  4A3E H;  4KHP Q;  1D8L A;  1CKN A;  2A5H A;  1CT1 D;  4DNT B;  1EIH A;  2EXD A;  3T1H L;  3TZU A;  3M3Y B;  3H3V C;  3MHB A;  4LF9 Q;  5IYD H;  5K5P A;  5BR8 L;  4YY3 Q;  1D1I A;  5EKK A;  4IUT A;  4JVZ A;  1YIJ A;  4L5S A;  3HOV H;  1WTX A;  4OO1 I;  2O5J C;  4BA2 I;  3Q23 A;  3RN2 A;  5IYB G;  1I6H B;  2LXK A;  1F2Y A;  4C1N K;  5M5W H;  2A19 A;  1BXT A;  1EY5 A;  4Z9C B;  3M4O H;  1Z7T A;  3T13 A;  2K5V A;  2K32 A;  2CW0 D;  4FF3 A;  2OEO A;  4BBR H;  4DR3 L;  3HOW G;  4FO2 A;  4OX9 Q;  1PRT F;  1FJG Q;  1ZXT A;  2Z9H A;  2XWB B;  3O13 A;  4LFC L;  2CHB D;  4XYQ A;  1TR5 A;  2B63 G;  4FP5 D;  4JBJ A;  3VR4 A;  2ATW A;  2UUA Q;  3STB D;  3DHQ A;  4IUP A;  4A3K G;  4DV6 L;  1WTR A;  1F2Z A;  2V1C C;  1XWE A;  2B2W C;  5CV7 A;  1TWC B;  2L9H A;  4BY7 H;  1MJC A;  1GUN A;  4IPG A;  4WJ3 M;  5HGT A;  3TP5 A;  1CKN B;  5CBA E;  1IZ6 A;  4A3J H;  1G6P A;  2LSS A;  4AH6 A;  1SR3 A;  5FLX L;  3K5L A;  4ME3 A;  1N8R C;  2NZH A;  3GTP H;  1MKH A;  4IFD J;  2VL6 A;  3CCQ A;  1E7Z A;  4RHR A;  1F2L A;  2YTY A;  4IJL A;  4QIW E;  4DV5 L;  2JA6 B;  1JWU D;  3FEW X;  2DNE A;  1NMG A;  2WB1 G;  2BE5 D;  1XYI A;  2E2D C;  3MXG A;  1X9N A;  3TP7 A;  1O78 A;  4A3D H;  3J7Z C;  4DK3 C;  2NN6 I;  4HR7 B;  2SOB A;  2FHT A;  2PI2 A;  1HJP A;  1JC7 A;  2F0E A;  4O42 A;  5IGC A;  1K0S A;  1A62 A;  3KDF A;  3VA7 A;  3UDG A;  4A3G H;  3NXW A;  1FGB D;  1IYV A;  1G8Z D;  3CW2 C;  3S17 B;  1RL2 A;  1KAW A;  1TWH H;  2Q2H A;  4O2D A;  4RMF A;  4B3T L;  1Q1B A;  1LTS D;  1IYU A;  5AJ3 Q;  5C4H A;  3E3X A;  2ASB A;  2VB2 X;  3FVQ A;  4GKJ L;  1YJW A;  4LFA L;  3PMF A;  1B9M A;  2CCZ A;  1W3S A;  5ELN A;  5CMD A;  5ISR A;  2NBF A;  3HKZ G;  2NVT B;  2YV5 A;  4JI6 L;  3FKI B;  5J39 A;  2G9H D;  5CV9 A;  1N32 Q;  1B3Q A;  1BBU A;  5FLM G;  4DF7 A;  1PZI D;  3E5S A;  2ZM6 L;  1VQE A;  4BY1 B;  3CRL C;  4LUV A;  4JI5 L;  5M5Y H;  4BBS H;  2D0P A;  4L5R C;  4DAV A;  1BBW A;  2F0G A;  2BH8 A;  1UEB A;  3GTK H;  2EOT A;  3C2P A;  2FMM A;  1ESR A;  1S40 A;  1XTD A;  3S9W A;  3D4W A;  1B8A A;  4U68 A;  3A55 A;  4K5X A;  2OQ0 A;  4LF6 Q;  3NPP A;  1PZK D;  4MTK A;  2KCT A;  4A3E G;  4A75 A;  3I4M B;  4XYO A;  1JWM D;  1GJX A;  3M85 A;  3KDF B;  1GUW A;  3S1R B;  3B6Y A;  1YHA A;  2IX1 A;  4FF4 A;  1P8L A;  4M8A A;  3PO2 H;  4UHV A;  4QUF A;  4RFB A;  4XDX A;  4FDB A;  5IYD G;  1Z9F A;  4YHH Q;  4QJF A;  1X3P A;  4RGN A;  4ID6 A;  1SYD A;  4IFD H;  3NTI A;  1PH7 A;  1WTV A;  1K3R A;  3KJP A;  2K50 A;  3HOV G;  1PFS A;  1EFI D;  2NVX B;  5FK9 C;  5IOC A;  1AP0 A;  2R92 B;  3LX0 A;  2R93 B;  1B70 B;  4FXD A;  1A6X A;  2CH4 A;  1DM0 B;  4DN4 M;  1ENF A;  1TS5 A;  1NBW A;  1RDP D;  4ZK9 B;  1O7I A;  1STA A;  4KJN A;  4BBR G;  3D31 A;  1HNZ L;  2JA5 H;  2MFI A;  3QOJ A;  3S2D B;  4EQ5 A;  5ELB A;  4PZ6 A;  1BVS A;  3BS1 A;  1S5C D;  3I73 A;  5FLX c;  3TS0 A;  1PFB A;  2Y0S G;  4JPB W;  3D3R A;  3J81 E;  1EYG A;  1LAC A;  2J0T D;  2HDM A;  3RLO A;  2K4K A;  4C3J H;  2VQE Q;  4MIU A;  1N34 Q;  2EYP A;  4BY7 G;  5JAV A;  3NUC A;  2A69 C;  3T56 B;  4UP9 A;  3M4Y A;  4LF5 L;  2JP1 A;  2F0N A;  1XMO Q;  2B2U A;  4EQO A;  5I4D A;  3Q0A A;  4A3J G;  1E22 A;  1E24 A;  2K03 A;  2PNR C;  5EPK A;  3UI2 A;  4AYB B;  2HHH L;  1HZC A;  2IJ0 A;  3OMG A;  3S1Q H;  2VS1 A;  4GOP C;  1H95 A;  3PGZ A;  4DUY L;  1RIP A;  4TRD A;  4X65 Q;  1M1K C;  4CGY B;  4HJ7 A;  3TSS A;  1I5F A;  1EYA A;  4P73 A;  1NMF A;  1TY0 A;  4A3D G;  3A5Z B;  2NVY B;  3JAM i;  1IXR A;  1XX8 A;  3SHL A;  1AZP A;  1LUZ A;  1BNZ A;  1EZ6 A;  4DR1 Q;  1PTO D;  4CDE C;  2F4V L;  3D6C A;  1UEA B;  5M3F H;  1I4P A;  1OXX K;  1E1T A;  1XTC D;  3M7G A;  2KHI A;  1L2F A;  3QOL A;  4GN5 A;  1Y8O B;  3MEH A;  1GKH A;  2B2Y C;  2B2T A;  3NTK A;  3JAM L;  3CCU A;  4JI2 Q;  1HCZ A;  4JI3 Q;  1VDZ A;  4IJH A;  5ELF A;  3MXN B;  4R4Q A;  1BOS A;  4O0A A;  1SFO H;  3PO3 H;  2BDN A;  2OXP A;  4A3G G;  4A93 B;  4B9X A;  5FJ8 H;  1STB A;  1II3 A;  3D4R A;  3HFZ B;  4IUR A;  1Y8N B;  5IIF A;  1RF2 D;  1SAP A;  1VQ6 A;  1JB7 A;  4P75 A;  1D6E C;  5CBE E;  4DPG A;  2F0J A;  1C0A A;  3BVZ A;  4DV7 L;  2RCF A;  4IUQ A;  3GTL B;  4GLX A;  4KI0 A;  5GAH C;  4ZYS A;  4IO9 A;  5D14 A;  1TT2 A;  5LMU L;  2UXD L;  2F0O A;  2A6H D;  3PIP A;  4A3I H;  4JOI C;  1PH1 A;  1Q1E A;  4BBS G;  3MFY A;  3L2P A;  2E5L Q;  1MD2 D;  4LF8 Q;  3A8I E;  3AFQ A;  1STN A;  1D2B A;  1STE A;  2F0L A;  3U9S A;  1KRT A;  1QVC A;  4F87 A;  1Q81 C;  1PDQ A;  4X62 L;  1EEI D;  1NR4 A;  2F0S A;  4OIJ A;  3H09 A;  3H15 A;  2G5D A;  4YCV A;  3BVG A;  2DY8 A;  4DV0 Q;  1S4Z A;  3DWP A;  3BDC A;  1PV4 A;  4FF1 A;  4KN7 C;  5IYC H;  1PFN A;  1VQI A;  1S72 A;  1HZ9 A;  5JPN C;  3J7A V;  3I8Z A;  3BJU A;  5KNC A;  2NVQ H;  3CQZ B;  3S15 H;  3UE1 A;  3PO2 G;  3K0X A;  5JJL A;  2XTI A;  3ZYY X;  4IFD G;  3SDZ A;  3S14 H;  2FJ2 A;  2Z6K C;  2OTL A;  1N32 L;  3D6W A;  1PTO F;  1KAB A;  1MHW C;  3G6E A;  3ICE A;  3CAM A;  3J80 E;  2X69 A;  3AYH B;  4K8I A;  2JQO A;  5C4Z A;  3N6R A;  1W6K A;  3PSI A;  3S24 A;  2JYO A;  1HNW Q;  4RKB A;  5IT9 E;  3L0O A;  2L15 A;  1HR0 W;  2JA5 G;  3U58 A;  1EY4 A;  3K81 C;  3SEB A;  4R4O A;  4LF6 L;  1HH2 P;  2BDO A;  5CV5 A;  5IWA Q;  3H0G H;  4L5T A;  5EGT A;  5EBC A;  5JEA J;  2AKW B;  3HOW B;  4JI0 L;  2NB0 A;  4C3J G;  1STH A;  1OXU A;  3CXC A;  1ASY A;  2B63 B;  2RDH A;  3CC2 A;  1I4H A;  2CWP A;  1YI2 A;  3HOY H;  1WD0 A;  5IOD A;  3CCE A;  4KKT A;  1ENC A;  1O7Z A;  3CPF A;  3AB9 A;  3LWE A;  1HR0 L;  1HPC A;  5EAY A;  2EPB A;  2E2H H;  2AQ2 B;  4H13 C;  4C3I H;  5DEH A;  2RHS B;  3JAM c;  3ERS X;  3G6J B;  4AIM A;  4RWS C;  1ZKO A;  4HCE A;  4PV1 C;  1VQ7 A;  1Y69 U;  2QEX A;  1E1O A;  3ULP A;  2XN9 C;  1QVF A;  1R4Q B;  1A63 A;  2D5D A;  1VQO A;  2R7D A;  1KNE A;  1CA6 A;  3I3C A;  1A3V A;  1I3Q B;  1IKL A;  1QG7 A;  1EY6 A;  5M3F G;  1TWA H;  1YNN D;  4WRD A;  1KC8 C;  2PI2 E;  2VQE L;  1J8I A;  1E2V A;  4YWM A;  5C5L A;  1MJE A;  4K2K A;  5GAG C;  3BG3 A;  2CQA A;  2ICE C;  3PO3 G;  4I65 A;  1BCP B;  4DA2 A;  1XMO L;  4MTN A;  5FJ8 G;  1L1O A;  1C9O A;  1PLF A;  3MWY W;  3I4O A;  5I6Y A;  1A15 A;  5DNF A;  4KY5 A;  1JWS D;  1WI5 A;  3A74 A;  1F9S A;  4RCN A;  1GUO A;  4KMU C;  2KUM A;  2GN5 A;  3TEH B;  1H9J A;  3NTH A;  3A0J A;  4A3B H;  3CF5 A;  2VUM H;  1I4R A;  1HA5 A;  3CME A;  1NAP A;  2JA7 B;  2JEA I;  3Q6S A;  4RCO A;  3KF8 A;  1EWC A;  4L6T B;  2RHQ B;  4A3I G;  2B8F A;  3HKZ B;  4GLV B;  4ZKB B;  1KXL A;  4TQU S;  3IFD A;  3Q8D A;  4C56 C;  3I56 A;  1UWV A;  4FYD A;  1BDO A;  2VQF Q;  1G51 A;  1HZA A;  4JI3 L;  4LAA A;  4R4I A;  4JI2 L;  2Q8R E;  2JSO A;  1C8C A;  4X3K A;  1SE4 A;  5JEA H;  4DV1 L;  1AE3 A;  1F9R A;  4DR5 Q;  1VQD A;  4OWW B;  5ELE A;  3WDN A;  2K5N A;  1J5E L;  3ONA B;  1PXU A;  3KLS X;  5IYC G;  1TWF B;  1LYL A;  4KKU A;  3VA5 A;  1WCM H;  1K9M C;  4ZUI A;  1YNJ C;  5EPL A;  4A3E B;  1LM0 A;  1GXD C;  4X66 Q;  4LUO A;  4RGT A;  4DXG A;  1L1O B;  4AYB E;  3BZD B;  1UE5 A;  1TXY A;  2ZXR A;  2K33 A;  4QCL A;  2H5X A;  3BDO A;  1Z47 A;  3I55 A;  4KLK A;  1TVX A;  5JJZ A;  3HOV B;  1D5X C;  2H4O A;  2QDB A;  1Y1W H;  1EL0 A;  1SSO A;  3QJY A;  4OGQ C;  4FXG C;  5M5W B;  3LNN A;  1BCP C;  5LHY 1;  3KF8 B;  2VNU D;  3SK4 A;  2A68 C;  4LF7 Q;  2KHJ A;  5FO9 B;  4DV0 L;  3IAY A;  2F1M A;  3H0G G;  5BN4 A;  1DGS A;  3URY A;  5C3X A;  1OTC A;  5C4X H;  4X64 Q;  3RZO H;  2IHE A;  5KEE A;  1F9P A;  2EYJ A;  2MP1 A;  1EZ8 A;  4G57 A;  1EIG A;  1WYD A;  2MJ8 A;  3MTS A;  3P7J A;  4JW0 A;  3S16 H;  3W1B A;  3GTO H;  5JVG 3;  1F77 A;  3HOY G;  4BY7 B;  5HGQ A;  1QZH A;  1K83 H;  3OTO L;  2K04 A;  2A6E C;  2KOL A;  2ZXO A;  2C9O A;  2PMZ B;  3GV3 A;  4N9P A;  1X55 A;  4L5Q A;  1P16 A;  2JEB I;  3JC6 6;  3K7U C;  4C3I G;  4GKK L;  4EQN A;  1IHZ A;  2FXQ A;  3GTP B;  1KRS A;  1SMX A;  1C48 A;  2JXM B;  4LF4 L;  4R1J A;  3UDI A;  2AUK A;  4IOC A;  5CC4 A;  3G4S A;  3T1Y Q;  4ULL A;  3H3V H;  2WKD A;  1B9N A;  3R93 A;  5DLQ E;  2XRQ D;  3RZD H;  1IW7 C;  4A3D B;  3ND9 A;  1VQ8 A;  1JE5 A;  4JYA L;  1EFW A;  2ZT9 C;  4V19 0;  3VYU A;  1VQB A;  1R9T H;  3PIO 3;  2DGY A;  3SE0 A;  4IPH A;  1VQL A;  4DR2 Q;  2Q2T A;  4A3G B;  3DMU A;  1LT4 D;  1HHV A;  5DAU A;  2AQ3 B;  1JCK B;  1HXY D;  2UUB Q;  4LFB L;  1S5F D;  2OT2 A;  1JJG A;  4TKO B;  4F7X A;  1CHQ D;  4ZRZ A;  4A3B G;  4NXN L;  1NCV A;  2VUM G;  2E2I H;  2PW7 A;  3KJO A;  2TSS A;  4ALP A;  2CFM A;  1VF7 A;  3ITP A;  1M8A A;  4B3S L;  3I2Z A;  4JV5 L;  3GTM H;  2EIF A;  3PCO B;  1EIF A;  2LFN A;  1GOZ A;  1SE8 A;  5T1G A;  1V1Q A;  3KYH C;  1FVI A;  5M5Y B;  1XPR A;  3H91 A;  1X56 A;  4BBS B;  5JEA G;  2F0F A;  1FL0 A;  3LWU A;  3GTK B;  1DCZ A;  3A7L A;  5JOB A;  2M9V A;  4AQY L;  3D4D A;  4Q5V A;  5F2D A;  1EY0 A;  4R8N A;  3HOU H;  3WOF A;  4HID A;  1UE1 A;  1WCM G;  1QNK A;  2VY3 A;  5FLX E;  1H9S A;  1NUC A;  1ILP A;  5I2Y A;  3IRB A;  5BN3 A;  1QE6 A;  2B2V A;  4EQP A;  3BYT B;  2DNC A;  1YJN A;  2F3I A;  4JI1 Q;  3M7N A;  2K75 A;  5I9P A;  3HOX B;  2PZU A;  3VR3 A;  1KAA A;  5CV6 A;  5LMN Q;  1O7Y A;  4JBM A;  1I4G A;  4OEM B;  4CHT B;  1DYQ A;  3KBX A;  2HQE A;  1GM5 A;  2UUC Q;  3RNU A;  2KCN A;  1PYW D;  2N8N A;  2IW3 A;  4UP7 A;  4DAY A;  5GQO A;  3F1Z A;  4I7Z C;  1Y1W G;  4C2M H;  3VR6 A;  1ILQ A;  1JQY D;  3NWS A;  1VQH A;  1K3B C;  3T53 B;  1CUK A;  4JI4 L;  4JI8 L;  5JVH 3;  2N78 A;  2K52 A;  4X3T A;  1HQM C;  4J6H A;  4IPD A;  3TQY A;  3E9I A;  1SNP A;  1KHI A;  3C46 A;  3KLS A;  2JA5 B;  1W2B A;  1X32 A;  2F3W A;  4OEL B;  4PNY A;  3HOZ H;  1HNX Q;  4QB4 A;  1LTR D;  5C4X G;  3SGI A;  2ES2 A;  2N88 A;  1T5X D;  3FP9 A;  1L0W A;  1V1P A;  2N49 A;  3M9B A;  4I7A A;  2QCP X;  4C3J B;  4K5V A;  3GDE A;  3AQQ A;  3K6O A;  1I94 Q;  1QIL A;  1IBK Q;  4UP8 A;  3E0E A;  1X65 A;  3AU7 A;  2MO0 A;  1PHJ A;  1K8G A;  1H9S B;  4C1N I;  1PRT B;  5C4J H;  2BA0 A;  4DK0 A;  2ZTD A;  3GP7 A;  2JJQ A;  3BU2 A;  2JA9 A;  3HKZ E;  3NEN A;  2WV6 D;  2MPM A;  1SLJ A;  3ERQ A;  4ZQ3 A;  4B3R Q;  3TRZ A;  2OF1 A;  2RF4 A;  2HUG A;  2KQ3 A;  4DAY B;  2PQA A;  2F52 A;  4PQX A;  5M3M B;  1JB3 A;  5JPM C;  4A3F H;  2TMP A;  3GQB A;  1C7Y A;  1RD9 D;  1VQ4 A;  1SJE D;  2GVA A;  2ID0 A;  2EYO A;  3R2I A;  1SJH D;  1QWY A;  1PZJ D;  2UXC Q;  5M3F B;  4JI7 Q;  2L11 A;  3U4Z A;  1VQF A;  1U9R A;  4DUZ L;  4KK7 A;  3OIQ A;  5ELC A;  3ZJY C;  1B7Y B;  1H9R A;  2WAQ G;  3U4V A;  5KGU A;  4DAM A;  2EJM A;  2IPK D;  1SFO B;  1VQK A;  5EJW A;  5IGD A;  3TP8 A;  4K6L A;  2QW7 A;  4HJA A;  2Z1C A;  4KHP L;  2B8G A;  1HFG A;  3M4Q A;  3EFX D;  3DEP A;  1AZQ A;  1QOH A;  4K0K Q;  1SN8 A;  1QNU A;  2OQK A;  3F2C A;  3C3L A;  2EZV A;  4DU9 A;  4LF9 L;  4A3M H;  3OPO A;  4YY3 L;  1YHQ A;  2NVT H;  2KCC A;  1XNR Q;  3FKI H;  5T1I A;  4N8F A;  5KNB A;  4A4I A;  3NSW A;  3R2T A;  5I6W A;  1EWH A;  1TS2 A;  3MAQ A;  1G2S A;  2IWH A;  1VMC A;  1VQ9 A;  3OHX C;  1CSP A;  4POG A;  1Q82 C;  1RJT A;  3NQT A;  4OX9 L;  1HUM A;  2LMC B;  4IUN A;  1FJG L;  3HOU G;  2UXB Q;  1EU4 A;  1ZYR D;  1IL8 A;  1AEX A;  5C44 H;  3EBE A;  1J6Q A;  1FR3 A;  5CV4 A;  4PG3 A;  2UUA L;  3CD6 A;  1B2T A;  2PMZ E;  2DN8 A;  1H9M A;  2NVQ B;  3K5O A;  3S15 B;  1DD2 A;  2RCN A;  3DWA A;  5IY0 A;  2RDF A;  1HQR D;  2F0Q A;  3CCL A;  3DLL A;  3W2D A;  2XSC A;  4B9W A;  1FGU A;  2YU9 H;  3S14 B;  2WII B;  4ZCK A;  4DV2 Q;  3RUZ A;  1SXT A;  4DR6 Q;  1BBX C;  4RKL A;  1LTI D;  3MA2 B;  4IN3 A;  2R92 H;  4HCS A;  1QB5 D;  3ULL A;  3PUV A;  2EQS A;  2A6E D;  3JAM E;  2R61 A;  3MXP A;  1U0L A;  3S2D H;  4DR7 Q;  5C3E H;  4J1M A;  5C0X I;  3HOZ G;  1VF5 C;  3BZK A;  4NB3 A;  4R8I A;  1W6J A;  2NWG A;  4N9T A;  1NTG A;  3K58 A;  2O2L D;  1IBL Q;  1X3G A;  3H0G B;  1N33 Q;  2EY5 A;  1MBY A;  4KKS A;  2EYF A;  1G6Z A;  2O4X A;  4PZ7 A;  1PYS B;  4OXP A;  4KV6 A;  3P20 A;  5NUC A;  4GNX A;  4NMZ A;  4ODG A;  4FXK C;  1E2Z A;  3CCV A;  2K28 A;  4IOA A;  3HOY B;  1Y1V H;  3ND8 A;  3NHH A;  3NEM A;  5K36 H;  3SK8 A;  1TWG H;  3GD7 A;  1SYG A;  1MI2 A;  5AJ3 L;  4DV3 Q;  1LO5 D;  3J7A 5;  1PMR A;  4A3L H;  1HTL D;  3K7A H;  4KD3 A;  2E2H B;  1D5Z C;  4C3I B;  5A2Q L;  4J15 A;  2NVY H;  1HTP A;  5IP9 H;  2KEE A;  2K5Q A;  3TZD A;  4A3F G;  3H94 A;  3PIO A;  1Y14 B;  3PQI A;  4DFA A;  4WJW A;  1GHJ A;  4RGM A;  4YCU A;  1SNO A;  1K73 C;  1TWA B;  4DV4 Q;  3SK5 A;  3BZC A;  4BXX H;  3Q24 A;  1EUJ A;  1SDF A;  1MSG A;  4E6I A;  1X6O A;  1PH6 A;  1XNQ Q;  1HZB A;  4G7H C;  2HD3 A;  4B3M Q;  2AQ1 B;  2PNH A;  1Q46 A;  4OL7 A;  2EYM A;  4NXM Q;  4OO1 H;  3TRE A;  5E7N A;  3BYY B;  2WKC A;  1X54 A;  4QF4 A;  4KHV A;  3T4A C;  2B2U C;  3MEF A;  3NE5 B;  4KHZ A;  5EPJ A;  1B53 A;  2BE5 C;  2VXW A;  3T1H Q;  4A3M G;  4YHH L;  1BR9 A;  4A3K B;  2LXJ A;  1RTN A;  4NPS A;  1DOK A;  3FKI G;  1MGS A;  4A3B B;  1B3A A;  2VUM B;  4YWK A;  5JJK A;  2F0U A;  4HSP A;  4BS9 A;  2F0K A;  5GAE C;  1SNQ A;  2D62 A;  4L63 B;  3ERO A;  1IL2 A;  1L0Y B;  4WOR A;  4YIJ A;  1I50 B;  1GUS A;  2RKS A;  3DUZ A;  5J1Z A;  2I5M X;  1R4P B;  1ROD A;  3M4P A;  3OOC A;  2MQH A;  4H7B A;  4HJ5 A;  2QEJ C;  1SBB B;  3NK9 A;  1OXV A;  1B1Z A;  4IFD I;  2BCO A;  1STG A;  2KHS A;  5COY A;  3D0F A;  2KEN A;  3WWV A;  1CK1 A;  2B2T C;  2WB1 B;  1KL9 A;  5GAD C;  5C44 G;  2L0C A;  1PH3 A;  2Q8I B;  2L12 A;  4HIK A;  3TP6 A;  3VR5 A;  4LFC Q;  2L5T A;  3A54 A;  4K8J A;  1JIC A;  1SYB A;  3CPW A;  1F2M A;  3DEO A;  1N34 L;  1AFP A;  4DV6 Q;  1J9O A;  3H6M A;  5C3W A;  4POF A;  2K01 A;  2K7V A;  3AEV A;  5FOB B;  4CJ0 B;  2F0P A;  4GN3 B;  1VQC A;  2R7Z H;  3GTQ H;  2LKV A;  2IT1 A;  3P1H A;  1S3O A;  4N8X 1;  2NN6 H;  2R92 G;  3GO5 A;  4OWT B;  1JE4 A;  1Y1W B;  3C1E A;  4X65 L;  1EQQ A;  2D0O A;  3EQL C;  2KBN A;  1EWI A;  4DV5 Q;  1PH8 A;  5C3E G;  3KBG A;  2CQO A;  2PW5 A;  4H02 A;  2F0W A;  2RVL A;  4Q0F A;  4HIO A;  4XT1 B;  1PTO B;  4LJZ C;  4CDC C;  4DR1 L;  1M4V A;  1UE6 A;  5IP7 H;  3K59 A;  2MO1 A;  5C4X B;  3PF4 A;  1I4X A;  4R9W A;  4CBV A;  1CQF A;  4DKA C;  4K5W A;  4A76 A;  4GZY C;  2E2J H;  4C3H H;  3S16 B;  4DAP A;  4P74 A;  2LS0 1;  5KYI A;  3GTO B;  5M9O A;  1YZ6 A;  2HIX A;  3X3M A;  3TDQ A;  1IKM A;  4JCV E;  2Q2I A;  1N36 Q;  4JBW A;  1Y1V G;  3V05 A;  1HFN A;  3QR8 A;  5K36 G;  3S1M H;  2B2W A;  2CKZ B;  4AYB G;  1VQM A;  1KTK A;  3HP3 A;  4A3L G;  1SEB D;  4B3T Q;  1STY A;  2XRS D;  1QCB D;  2VW9 A;  2DJF C;  1WTO A;  3KF6 A;  2QDL A;  1F9Q A;  3BVM A;  4GKJ Q;  5IP9 G;  4LFA Q;  4DR7 L;  1E0B A;  3NBH A;  3SVM A;  5M5X H;  3N52 A;  4DGZ A;  4XQN A;  2RDG A;  2O5I C;  2A69 D;  3RD4 A;  1JJ2 A;  1OO9 B;  3RZD B;  2E5L L;  4LF8 L;  3PV0 A;  2XIW A;  1DJR D;  4XIG S;  1IBM Q;  2ZM6 Q;  3W1G A;  3L9A X;  1HRJ A;  4JI5 Q;  4LK1 C;  4BXX G;  2GVB A;  3PUW A;  4XT3 B;  2K05 A;  2PZT A;  1R9T B;  3M4O B;  1KD1 C;  4Y7N H;  3KUP A;  2WAQ B;  4ME5 A;  3L3O C;  4BBR B;  2NZ1 D;  5CR3 A;  1CM9 A;  1K8A C;  2EJF C;  4OO1 G;  4EVO A;  3S1N H;  3OW7 A;  2E8G A;  4HMJ A;  2A74 C;  1NJI C;  1VQP A;  2PCF B;  1Q3L A;  1NNX A;  3UDF A;  1ET6 A;  4O1N A;  3E6Z X;  2F0T A;  5C0X J;  2JA8 H;  2I5H A;  2Y0S B;  3AFP A;  1DZ1 A;  4UDU C;  2QKI C;  2JA7 H;  5IGE A;  2B29 A;  1PTO C;  5I9O A;  4M1U B;  2E2I B;  4J8Q A;  1NE3 A;  2NYZ D;  1FD7 D;  4A3J B;  2KCM A;  4HJ8 A;  1E2W A;  3GTM B;  5FO7 B;  1PH9 A;  3I4N H;  4LWC A;  3NBH B;  1HNW L;  4FNF A;  5E1F A;  3IKJ A;  2I0Q A;  2LY7 A;  2NTS A;  4WFN 3;  1CSQ A;  5A35 A;  3E0J A;  1AW7 A;  2XWJ B;  3C1F A;  5IWA L;  3X3N A;  3HOU B;  4XQJ A;  4X3U A;  2PQE A;  2HIV A;  3KOJ A;  1UUP A;  1GUG A;  1L1O C;  1JJC B;  4HED A;  4X3S A;  2Z4I A;  3OIP A;  1QZG A;  1M90 C;  4HAE A;  4FF2 A;  2QF7 A;  1XJV A;  1C4Q A;  1XPO A;  2A6H C;  2R3Z A;  3FPU B;  1EY9 A;  3CRK C;  4LF5 Q;  1D7Q A;  2R7Z G;  5IE8 A;  1KLU D;  2CVR A;  3CKI B;  3CU7 A;  1KNA A;  4KN4 C;  5EQ0 A;  4KY6 A;  4BA1 I;  4UAI A;  1GO3 E;  1PYB A;  2NN6 G;  4DK6 C;  3VYR A;  3NQI A;  2F4I A;  1TWH B;  5ELO A;  4C2M B;  4ZLT F;  1KDB A;  2HQL A;  3GTG H;  2HHH Q;  3I7F A;  1KQS A;  1CTM A;  4U67 3;  4DUY Q;  4ZUJ A;  3I4L A;  1CQV A;  5KRU A;  1JR0 D;  4LW1 A;  1O7L A;  5E3F A;  2E75 C;  1NR2 A;  2EVB A;  1K8O A;  1FYC A;  5IP7 G;  3T16 A;  4RAU C;  3HOZ B;  3S2H H;  4K2L A;  1LTL A;  1WFQ A;  3SK6 A;  2PZW A;  2BH2 A;  2F4V Q;  4HN7 A;  4S3S A;  1VQ5 A;  2I5L X;  2YTX A;  1Z6H A;  4C3H G;  2DY7 A;  5BN5 A;  1K0R A;  1VQA A;  3VR2 A;  4HSV A;  5C0X H;  5L37 A;  3GTJ H;  1DXM A;  1TS4 A;  2EDG A;  5C4J B;  3J7Y W;  1ML0 D;  2F0D A;  3F2U A;  4DNI A;  2XVS A;  3A56 A;  3A8K E;  4DNR B;  2YTV A;  1CI3 M;  3M3Y H;  3F8T A;  1JOQ A;  3L7Z C;  1BUV T;  1WJJ A;  3NWT A;  3KFU A;  1WD1 A;  3PO2 B;  2ENB A;  4DV7 Q;  3KK7 A;  5TSS A;  1LTT D;  5J3B A;  1EOV A;  4GOP A;  1NSN S;  2MHV A;  3CMA A;  3K80 C;  5LMU Q;  2P5Z X;  2UXD Q;  4H0L C;  2NZO A;  3G7L A;  4A3F B;  1I6H H;  3RR5 A;  5KND A;  2WB1 E;  3G48 A;  1HA6 A;  2VQF L;  1YEZ A;  1Q7Y C;  1GUT A;  4QMG A;  2EYL A;  4DR5 L;  4UY8 C;  3HGB A;  5JJI A;  1U4R A;  1N36 L;  4KJO A;  4X62 Q;  2K1B A;  2EYH A;  2K5D A;  2B2Y A;  1SYC A;  1GVP A;  2VZA A;  1A2T A;  2R6G A;  3W3A A;  3MVV A;  2SEB D;  2Q8T A;  4X66 L;  3A5U A;  2JA8 G;  1G29 1;  5LL6 X;  4IZ8 A;  4XTC S;  5C6A A;  3OW2 A;  3HRZ C;  1A0I A;  1TWC H;  1KDC A;  2JA7 G;  3QO2 A;  4PMB A;  5D3I B;  5KYL A;  1YIT A;  2WP8 J;  4A3M B;  3F2B A;  3EVQ A;  5CYU A;  3G71 A;  1YNN C;  4KD4 A;  1IYJ B;  1ENA A;  1TS3 A;  1D1K A;  3NP8 A;  1S5E D;  5FO8 B;  2EE1 A;  3PF5 A;  5C5M A;  1IBM L;  4RHS A;  4GN4 B;  3ER0 A;  4IUU A;  1QJO A;  4K6D A;  3I4N G;  3FMC A;  4PZ8 A;  2JA6 H;  2EY2 A;  4CJ2 C;  2XGT A;  2DUD A;  3RMH A;  2AWN A;  2ZXP A;  1BF4 A;  3S1Q B;  3K0Y A;  2C35 B;  4GOP B;  4JOI A;  3HS0 C;  5IGB A;  2A1A A;  4LF7 L;  1VMP A;  1AN8 A;  4EGV A; 
#chains in the Genus database with same CATH homology
 2RCF A;  4I7A A;  4N8X 1;  2QW7 A;  2Z9H A;  5L37 A;  2HD3 A;  4N8F A;  4JW0 A;  4JVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...