2RCQA

Crystal structure of human apo cellular retinol binding protein ii (crbp-ii)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
b'MRGSTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKKLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinol-binding protein II, cellular
publication title Crystal structure of human cellular retinol-binding protein II to 1.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Retinol-binding protein
total genus 39
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2rcqA00
3G7XA 3O2YA 2L67A 2R73A 3P6GA 3NR3A 5K06A 3P6FA 4GRJA 4DQ3A 2W2FA 4QZTA 2AT0X 3B2IA 1YUPA 2ACOA 2ACPX 3ZUIA 2HNXA 1HMRA 2FR2A 3Q6LA 3FA8A 4QAEA 2CZTA 2A2GA 2ANSA 4GE1A 3KFGA 4KIIA 5HTDA 4YKMA 3NX2A 1CBRA 3HWEA 4BVMA 4IAWA 3STNA 1FE3A 2A0AA 3IFBA 5FFHA 1I4UA 2NNDA 1QY1A 4ZR2A 1BLRA 1I06A 5LJHA 1DV9A 1SXUA 1OPAA 3D95A 1E02A 4ODDA 3DTQA 4IB7A 1T0VA 1ZNHA 5LJKA 2Q9SA 4YCHA 2BLGA 1EPAA 4ZFXA 2HLVA 2E4JA 1CRBA 1ICNA 4AZMA 1OBUA 3CQNA 4ZJ0A 1ZNDA 2FS6A 2R56A 4YFRA 1RLBE 2OZQA 4NP1A 1FELA 1SXWA 3AKMA 5IO5A 4ORSA 5KICA 5F7GA 3VG7A 2FT9A 1G85A 1QQSA 4YFPA 3S26A 3WJGA 2XSTA 1S2PA 2RCTA 5D48A 1NP4A 1MUPA 4LZUA 5BVTA 1G5WA 2OVDA 4IB6A 1E5PA 2WUTA 4HPBA 3VG2A 5EEDA 4BQUA 3FR2A 5IO7A 1XKIA 2X45A 4UU3A 1HN2A 1MDCA 3T1DA 4ZHCA 1GT3A 3QKGA 1EUOA 1ALBA 4TLJA 1D3SA 1HMSA 1X8PA 3UEWA 1T8VA 3EYCA 3FIQA 1EXSA 1ML7A 1B56A 1GKAA 4LKPA 5DG4A 1ACDA 1EIIA 4QGWA 1QFVA 2WR6A 4AZPA 4MVLA 4QGVA 4YGZA 2X46A 5H9LA 2F73A 2A2UA 4OS3A 1R0UA 1S7DA 1YWAA 2G78A 1GX8A 3OJYC 1L6MA 2MM3A 3EBWA 1AELA 3PP6A 2P8GA 5L8NA 1BSQA 1IW2A 1N0SA 2FTBA 4XMHA 3ELXA 2HZRA 5F6ZA 3UEVA 2AT5X 1QWDA 2A3FX 3VG3A 2K62A 5L8OA 4GKCA 5HA0A 2GC9A 1O1VA 3SAOA 4WFUA 3B2HA 3NQ9A 4TQ2A 5DPQA 1BSOA 3BX8A 3FEKA 3FR5A 1SY2A 3HWDA 4LZVA 4Y0PA 1RBPA 5H8TA 1B0OA 3BY0A 1QG5A 4Y0RA 4ORUA 4NLIA 4AZRA 4QYNA 4OS8A 3HK1A 4WBKA 5CE4A 1ZNLA 4I3CA 2WSJA 3JS1A 5D8JA 2W2AA 3VG5A 3TGCA 1B8EA 3B2KA 1YP6A 1TOWA 4LKTA 2PY1A 1HQPA 1BWYA 4ALBA 2LB6A 3MVFA 4ZHFA 1IKJA 1VYFA 1MX8A 2Q39A 4TNNA 3KZAA 5LJGA 1EALA 4YKOA 4GH7A 4EDEA 2G7BA 2QOSC 2L68A 3KFIA 1DF3A 5LJBA 1FEMA 2FWVA 1UREA 2MO5A 4RUNA 3BU1A 2RCQA 1A3YA 4HFOA 4YGHA 3STKA 5HZ9A 4NYQA 4ZH9A 4PSQA 2WQ9A 3FW5A 1AB0A 1IFBA 1GXAA 1X8NA 1YWBA 1LIDA 4WFVA 2OVAA 3CMPA 1SXYA 4XMCA 2HZQA 3PPTA 4TKHA 2GTFX 3RSWA 2Q4NA 1X71A 5EEEA 1HBQA 3RZYA 1JYDA 1GM6A 4MVKA 5AQ6A 2KT4B 3D96A 4NNSA 1XCAA 5EZ2A 1GX9A 1BM5A 1LIFA 2AT6X 3PECA 2EU7X 1JZUA 1IIUA 2AT3X 3F8AA 1OBQA 4A1YA 5H9AA 2HMBA 5L8IA 2AMMX 3TF6A 5BVQA 1AVGI 3HWFA 4IAXA 1MVGA 2KTDA 4A8ZA 2JU8A 4I9RA 4GNYA 3BLGA 4AW8A 2N93A 5LKFA 4Y0SA 4EXZA 1O1UA 3I0AA 2FR3A 3U9PC 4ZHDA 3FMZA 1YIVA 3CBCA 4ES7A 1PM1X 1TVQA 3WVMA 1IFCA 1P6PA 3I17A 2OFMX 4YBPA 2Q2MA 1Z24A 5F1EA 4ZHGA 4RUUA 3EM0A 4AZOA 5LJEA 4QZUA 3PEDA 5H9NA 4YBUA 4M6SA 4ORRA 2JU7A 2OFRX 1OEEA 2DM5A 2CBSA 1DZKA 4ARHA 3B2LA 4DQ4A 2CM4A 2JOZA 1LIBA 3STMX 3PH6A 1GT5A 1SY1A 3D97A 2OVEA 5BVSA 1A2DA 2LBAA 4HPAA 5EPQA 1QFTA 4R0BA 1FTPA 3MBTA 1NP1A 3P6DA 4I9SA 3GAQA 1SXXA 5HZ5A 5EDBA 2IFBA 4ZGUA 3WJEA 4YGGA 3ZQ3A 1ZNEA 5LJDA 3C76X 5HA1A 3CWKA 5F58A 1G74A 1BJ7A 1DZJA 1UZ2X 2L5PA 2R74A 3FELA 3NADA 1FENA 5EDCA 2ALLX 3APVA 2FRSA 2QM9A 3ELZA 1S44A 3BS2A 4HPCA 4IB8A 2GJ5A 1DZMA 1KZWA 4Y0QA 4EEJA 3NPOA 5HCDC 1LICA 4QGXA 1DFVA 1LNMA 1KOIA 2POAA 1CBQA 3U0DA 1LKEA 4YCEA 1IKEA 3PH5A 3KFHA 1QY2A 3FA7A 4K19A 1I05A 5KIDA 5HTEA 1E06A 1KQWA 3TGAA 3WJBA 2JU3A 3B2JA 3JSQA 1BBPA 1YWCA 5KHPA 4TKJA 4A60A 4XMEA 5HZ8A 3WBGA 1JJXA 2WQAE 1LF7A 4UU2A 2Q2PA 4TJZA 5HBSA 4XMFA 1BRPA 1U18A 3NP1A 1YWDA 2XKLA 4N7CA 3UEUA 4TKBA 1NGLA 3FLLA 4ORWA 5HCCC 4XMGA 3UEXA 3K3LA 2NNEA 1TXLA 4I3BA 3TZSA 1KZXA 1X89A 2QO5A 1ERBA 1OEJA 5IO6A 4NYRA 2CZUA 3L4RA 4IMOA 1DZPA 3BU9A 4ALOA 5C0NA 1A18A 1JV4A 3AKNA 2FLJA 4N7DA 2K23A 4ZCBA 2O62A 4GNWA 4AYHA 2JN3A 1EIOA 1I04A 1KT5A 2NP1A 4IMNA 3NX1A 4QYPA 1PBOA 2NNQA 1CJ5A 4ZH6A 3C78X 4NNTA 3ZUOA 1SY0A 2FS7A 1HMTA 3P6HA 3O19A 1EW3A 4NLJA 5JR8A 1GGLA 1MX7A 3HWGA 2QO4A 1VYGA 3APUA 2A13A 2L9CA 1KT3A 1TOUA 2CBRA 2HYSA 1SA8A 1BRQA 1VPRA 1H91A 1O8VA 5FAZA 3FA6A 1LFOA 3P6CA 4HPDA 5HZ6A 1U17A 1B4MA 5HZQA 1EQDA 1X8OA 3P6EA 1CBIA 1KXOA 2QO6A 3BDRA 3FW4A 2G79A 4OMWA 3VG6A 5FENA 4D6AA 4YDBA 1X8QA 2RA6A 2RQ0A 3BX7A 4ORYA 1LIEA 1E00A 4YMYA 4YH0A 1A57A 1BEBA 1LPJA 1TW4A 2W2BA 3WJDA 5HAEA 1JBHA 1JYJA 4O9SA 4GETA 1KT7A 5LJCA 4YDAA 3TGBA 4OS0A 1DC9A 1KT6A 3WXQA 4CK4A 4D6BA 3EBKA 4A1HA 3VG4A 1FDQA 1ZNKA 1U0XA 1ZRYA 3APWA 1SY3A 3WJCA 2CM9A 1KT4A 4I3DA 4EFGA 5HWZA 3U03A 1JJJA 1PEEA 2AKQA 3EMMA 1CBSA 5D47A 4M7MA 4BOEA 4AZQA 5D45A 3KQ0A 5B29A 2WEXA 5H9KA 2WEWA 3O22A 5B27A 1ERXA 3CQRA 1OPBA 5D4AA 4IB9A 2LKKA 3C77X 2ASNX 3NQ3A 1YP7A 1KQXA 3F9DA 3APXA 1OBPA 5F6BA 5LKEA 1D2UA 2MJIA 3DSZA 4OMXA 1ICMA 4IBAA 1HBPA 1QY0A 2AL0X 1GT1A 3BRNA 1X8UA 2AH7X 2YG2A 3FA9A 4ORXA 4YFQA 3FR4A 3KFFA 2LBVA 4ZHHA 3CR6A 3FEPA 3CBSA 1AQBA 1BSYA 2RD7C 3FENA 1PMPA 3WJFA 1OEKA 1QABE 4MVIA 4XMDA 4AZNA 1KGLA 1ADLA 1GKAB 3IA8A 1G7NA 2AT8X 2WWPA 3BSZE 1GT4A 1T68X 1ZNGA 2LFOA 5HCEC 1EPBA
chains in the Genus database with same CATH superfamily
3G7XA 2OF8A 3O2YA 3SLTA 3VHHA 1NDJA 2L67A 2R73A 3P6GA 3NR3A 3FYFA 2GTLM 5K06A 3P6FA 1MK5A 2OF9A 3QQ2A 2W2FA 4GRJA 4DQ3A 3ZW0B 4QZTA 2AT0X 1Y9TA 3B2IA 1VWRB 1YUPA 2ACOA 2ACPX 3ZUIA 2HNXA 1HMRA 2FR2A 1VWEB 3PK2A 3Q6LA 3FA8A 4QAEA 2CZTA 1IJ8A 1JMZA 2A2GA 2ANSA 1SWNA 4GE1A 3KFGA 4KIIA 1VWFB 4YKMA 3NX2A 5HTDA 4KT5A 1CBRA 3HWEA 4BVMA 4IAWA 3STNA 1FE3A 2X32A 2A0AA 1VWBB 3IFBA 5FFHA 4PJ2A 1I4UA 2NNDA 4DNEA 4IRWA 1QY1A 4ZR2A 2GH7A 1BLRA 4BBOA 1I06A 2Y32A 5LJHA 1DV9A 1NQMA 1KL4A 1PBYA 1SXUA 1OPAA 3D95A 1E02A 4HWMA 3DTQA 4IB7A 4ODDA 1RAVA 1T0VA 2WPUA 2RTJA 1SWBA 1ZNHA 5LJKA 2Q9SA 4YCHA 4Y5DA 2KW1A 2BLGA 1EPAA 4ZFXA 2HLVA 3RBYA 2E4JA 1CRBA 2RTBB 1SLGB 1ICNA 4CDEA 4AZMA 1OBUA 3CQNA 4ZJ0A 2RTAA 1ZNDA 2FS6A 2R56A 5IRUA 4YFRA 1RLBE 2OZQA 4NP1A 3V8UA 1FELA 2X8TA 1SXWA 3D4RA 4CPHB 1KFFA 3AKMA 5IO5A 4JGLA 4ORSA 5F7GA 3SLOA 2FT9A 3VG7A 5KICA 4GGZA 1G85A 1QQSA 4YFPA 3S26A 5CSEA 1AVDA 3WJGA 1RXJA 1SLEB 2XSTA 2BHVA 3OE3A 1S2PA 2RCTA 1SWQA 1NP4A 1Y0GA 4OEMA 1MUPA 4GJSA 4LZUA 5D48A 5F2BA 5BVTA 2OVDA 5AJCA 2QMIA 4GUZA 3CKFA 1E5PA 4IB6A 3PQSA 3T2WA 2WUTA 4HPBA 3VG2A 3HOEA 5EEDA 3FR2A 1LELA 1XKIA 2X45A 4UU3A 4BQUA 4B55A 4COTA 1HN2A 4GGRA 1MDCA 3T1DA 4ZHCA 1GT3A 3QKGA 1EUOA 3RDQA 1ALBA 4TLJA 4U8UN 1D3SA 1HMSA 1X8PA 4EQAC 2PI3O 3UEWA 2X4MA 3HTYA 4FBOA 4ES7A 5BYPA 2A5CA 5FQ7E 1T8VA 5K67A 1OSPO 3EYCA 4GD9A 3FIQA 5IRWA 1EXSA 1ML7A 1B56A 1GKAA 4LKPA 2MWHA 5DG4A 1ACDA 1EIIA 4QGWA 2A8GA 4BX7B 3P02A 4OELA 1QFVA 2WR6A 1I9HA 2RTIB 1I78A 4AZPA 2YMSA 5AEOA 4MVLA 1SWDA 4QGVA 2BC3A 2X46A 4YGZA 2IZLB 3LTWA 5H9LA 1VWJB 2F73A 3D9WA 2A2UA 4ID2A 4OS3A 3P24A 5B3MO 1R0UA 1S7DA 1YWAA 2G78A 2UZ2A 1GX8A 3OJYC 1L6MA 2MM3A 3EBWA 1AELA 3PP6A 2P8GA 5L8NA 1BSQA 4KCAA 1IW2A 1N0SA 2FTBA 4XMHA 3ELXA 2HZRA 2LA7A 2FHNX 5F6ZA 3UEVA 2IZJA 2AT5X 1QWDA 2A3FX 3VG3A 2K62A 2OYBO 5L8OA 2KTSA 4JHQA 1RXHA 4GKCA 1VWNB 1SMPI 2GC9A 1O1VA 5HA0A 3SAOA 4WFUA 3B2HA 3ZWEA 1SWOA 2RTRB 3NQ9A 4Z6JA 4TQ2A 5DPQA 4FBRA 1BSOA 3BX8A 3FEKA 1N7YA 2IZFB 3OBLA 4CV7A 3FR5A 4KH8A 1SY2A 2DJFA 2JGSA 3S5XA 3HWDA 3KVNA 4LZVA 4MISA 1RBPA 4Y0PA 5H8TA 4BX5B 1B0OA 2RTLA 3BY0A 1QG5A 4GGTA 4ORUA 4Y0RA 4NLIA 2RTOB 4AZRA 4QYNA 4MVEA 4OS8A 3EW2A 3WZOA 1VWKB 3HK1A 4WBKA 5CE4A 1G5WA 4WHIA 1ZNLA 4I3CA 2WSJA 5IRAA 2Z4IA 3JS1A 5D8JA 2FHLA 2W2AA 3VG5A 3WZPA 3ZW1A 3TGCA 1B8EA 2F09A 2IZIA 3B2KA 4INNA 1YP6A 1TOWA 4LKTA 2PY1A 4CPHA 1FJ1E 1HQPA 1VWLB 2RTEB 2LB6A 3MVFA 4ALBA 1BWYA 3VHIA 1IKJA 4ZHFA 1VYFA 1MX8A 1VWMB 2Q39A 1WUBA 4Z28A 4TNNA 1LCZA 5B5FA 3KZAA 5LJGA 4U8UO 4YKOA 1EALA 4GH7A 2RTPB 2G7BA 4EDEA 2QOSC 3MX7A 3ZZVA 2L68A 3KFIA 3MG5A 1DF3A 5K68A 2OL8O 1JJUA 3MM0A 5LJBA 1FEMA 1JMXA 2IZEB 2FWVA 2IZGB 1UREA 2MO5A 2OVSA 3BU1A 4RUNA 2RCQA 1A3YA 4HFOA 4KC8A 4U8UM 4YGHA 3STKA 5HZ9A 2X55A 1RXKA 4NYQA 4ZH9A 4PSQA 2WQ9A 3FW5A 1AVEA 1X8NA 1AB0A 1IFBA 1GXAA 1YWBA 1LIDA 4WFVA 4Z2PA 1HY2A 2OVAA 2OY1O 4L1NA 2I5VO 3CMPA 1SXYA 2G8CO 4XMCA 4BX7A 2HZQA 3PPTA 4TKHA 4BGFA 2GTFX 4OKAA 4O3ZA 1VWDB 1VWGB 4MEEA 2Q4NA 3RSWA 1X71A 5EEEA 1HBQA 3RZYA 3VGWA 2OFAA 1JYDA 1GM6A 4MVKA 2C1SA 1UYNX 5AQ6A 2KT4B 3D96A 4NNSA 1XCAA 5EZ2A 1GX9A 2ZAIA 1BM5A 1LIFA 1EI5A 2AT6X 1UYOX 2EU7X 2RTFB 3PECA 1JZUA 1IIUA 3N91A 2AT3X 3WYQA 3F8AA 4O4XA 1OBQA 3OD9A 4A1YA 5H9AA 2HMBA 5L8IA 2AMMX 3TF6A 3AUMO 5BVQA 2RTHB 1AVGI 3HWFA 4IAXA 1MVGA 2KTDA 1SRIA 4A8ZA 1SLFB 2JU8A 1HQQA 2C4IA 1MOYA 3CKGA 1LDOA 3RY1A 4I9RA 4GNYA 5B10O 3BLGA 2OL7A 4GU8A 2N93A 5LKFA 4AW8A 4O3XB 4Y0SA 2DJGA 4EXZA 1O1UA 3I0AA 2FR3A 4QNIA 3U9PC 4ZHDA 1JQPA 3FMZA 1YIVA 3CBCA 4BJ8A 1PM1X 1TVQA 3H3IA 3SOTA 1STRB 3Q34A 1IFCA 1P6PA 1W6FA 3GE2A 3I17A 3WVMA 2Y3FA 2OFMX 4YBPA 2Q2MA 2ZSCA 3AEHA 1Z24A 3ZW2A 4LQZA 5F1EA 4ZHGA 4RUUA 3EM0A 4AZOA 4NV7A 1DF8A 1VWHB 4O3WA 4QZUA 3PEDA 5LJEA 5H9NA 4YBUA 1Y53X 4O4OA 4M6SA 2Z4HA 1STSB 3T6LA 2G5LA 4ORRA 3VE1A 3E3CA 2JU7A 1SWEA 3VPJE 5B5GA 2OFRX 1OEEA 2DM5A 2CBSA 2GTLN 1DZKA 4ARHA 3B2LA 4DQ4A 2CM4A 2JOZA 1SLDB 4U3QA 1LIBA 3STMX 3PH6A 2CAMA 1GT5A 1SY1A 1SRHA 2OVEA 3D97A 5BVSA 1A2DA 1LCWA 2BT9A 2LBAA 4HPAA 4JNJA 4GZVA 5EPQA 1QFTA 4R0BA 1FTPA 1K3BA 3MBTA 5B2AO 1NP1A 2X8SA 3P6DA 4I9SA 3GAQA 2UYWA 1SWHA 4IABA 4DCBA 1SRJA 1SXXA 1N43A 5HZ5A 4QQ1A 5EDBA 2IFBA 4ZGUA 3RE6A 3WJEA 3PQUA 5B11O 4YGGA 3ZQ3A 1ZNEA 5LJDA 3C76X 2FKGA 5HA1A 5JD2A 2BS5A 4GK9A 2IZAA 3CWKA 5CYBA 4MIRA 1KL5A 1LUQA 3VHMA 4BCSA 5F58A 1G74A 1BJ7A 1DZJA 1UZ2X 2L5PA 2R74A 3FELA 3NADA 4I6SA 4CDDA 1FENA 3EC5A 3RDOA 4FQBB 2ALLX 5EDCA 3APVA 2FRSA 2QM9A 3ZW1B 4KC7A 3ELZA 1S44A 4CDFA 4O49A 1VWCB 3BS2A 4HPCA 4IB8A 2GJ5A 1DZMA 2Y3EA 3JQOA 3SZJA 2RTMA 1N4JA 4Y0QA 1WBIA 4EEJA 3NPOA 5HCDC 1KZWA 1LICA 2HKDA 4QGXA 1DFVA 1LNMA 1KOIA 2POAA 1CBQA 3U0DA 1SWLA 1K24A 1LKEA 1MEPA 4YCEA 2FGSA 3LHNA 1IKEA 3PH5A 1HXLA 3KFHA 1QY2A 3FA7A 4K19A 3X00A 1I05A 5KIDA 5HTEA 1E06A 1KQWA 3TGAA 3WJBA 2JU3A 3B2JA 3JSQA 3T2XA 1BBPA 1YWCA 3NQKA 4QRLA 2JMBA 5KHPA 4TKJA 1SWCA 4A60A 4EKVA 4O4UA 4XMEA 5HZ8A 3WBGA 4BX6B 1JJXA 4GDZA 4CPFA 2WQAE 1LF7A 1RSUB 4UU2A 3LV4A 2Q2PA 2RN4A 3RY2A 4TJZA 5HBSA 4XMFA 1BRPA 1U18A 4CSBA 3NP1A 1YWDA 1Y52X 2XKLA 4N7CA 3UEUA 4TKBA 1NGLA 2IZDB 3FLLA 4ORWA 5HCCC 1SWJA 4XMGA 2X8FA 3UEXA 1NBXA 3K3LA 2NNEA 3T6FA 1TXLA 4I3BA 3TZSA 1KZXA 1X89A 2QO5A 1ERBA 1OEJA 3FIDA 2OY7A 5IO6A 4NYRA 2CZUA 1VWQB 3L4RA 1DZPA 3BU9A 4IMOA 1MM9A 4O4SA 4Y59A 3SZIA 4ALOA 4C5PA 1A18A 5C0NA 1JV4A 3AKNA 2FLJA 4N7DA 2K23A 4FBVA 4ZCBA 2O62A 4GNWA 3RDXA 4I60A 4AYHA 2JN3A 2RTCB 1EIOA 1I04A 1KT5A 4BX5A 2NP1A 1LDQA 1SWPA 3F6ZB 1SWFA 4IMNA 2M4LA 3NX1A 4QYPA 1PBOA 2AF5A 1N9YA 2NNQA 1SREA 2C1QA 1CJ5A 2IZKA 2RTQB 4ZH6A 1Y55X 1HXZA 3C78X 1SWUA 4NNTA 5FQ8E 3ZUOA 2BS6A 1SY0A 2FS7A 5CHKA 1RSTB 1HMTA 1JIWI 3EW1A 3P6HA 3O19A 1EW3A 4NLJA 5JR8A 1GGLA 1MX7A 2OY5O 2F01A 2QO4A 3HWGA 1VYGA 2BSZA 3APUA 2A13A 3RKGA 3UAQA 2L9CA 3HPEA 2KD2A 1KT3A 1TOUA 2CBRA 2X34A 2HYSA 4CPIA 1SA8A 1Y9LA 1E2TA 5IXGA 1BRQA 4CPEA 1VPRA 1H91A 1O8VA 5FAZA 2RTKA 3FA6A 1LFOA 3P6CA 4HPDA 1NQNA 4NW4A 5HZ6A 1U17A 3ZI8A 5HZQA 1B4MA 1EQDA 1KL3A 4GDAA 1X8OA 3P6EA 1CBIA 4O3YA 1KXOA 4U46A 2QO6A 3BDRA 3FW4A 2G79A 2QCBA 4OMWA 3VG6A 5FENA 4D6AA 4YDBA 3VE2A 1X8QA 2RA6A 2RQ0A 3BX7A 4ON1A 1LIEA 1E00A 1VWPB 4ORYA 4YH0A 3S60A 4YMYA 1BEBA 2OL6O 1LPJA 3RE5A 1SWRA 1TW4A 2IZBA 2W2BA 3WJDA 5HAEA 2X56A 1JBHA 1SWAA 1SWSA 1JYJA 4O9SA 4GETA 4BX6A 1KT7A 3WYPA 1W5RA 4YVBA 5LJCA 2RTNB 4YDAA 2AVIA 4OS0A 1DC9A 3TGBA 1KT6A 2VFCA 3WXQA 4CK4A 4D6BA 1VWOB 2IZHB 1PTSA 4Z2OA 3EBKA 4A1HA 2QOMA 3RWXA 3VG4A 5L3YA 1FDQA 1ZNKA 1U0XA 1ZRYA 3RDSA 1SRFA 3APWA 1SY3A 2RTDB 4NV8A 3WJCA 2CM9A 1KT4A 4I3DA 4L3RA 2MHDA 4EFGA 5HWZA 2FKJA 3WZQA 3U03A 1JJJA 2VFBA 1PEEA 2AKQA 3EMMA 1CBSA 4FGIB 4M7MA 5D47A 3RDUA 1LCVA 4BOEA 4AZQA 3S5VA 3ZW0A 2I5ZO 4ZGFA 5D45A 3KQ0A 5B29A 2WEXA 2VDFA 5H9KA 4U9CA 2WEWA 3O22A 5B27A 1ERXA 1A57A 3CQRA 2RTGB 1OPBA 5D4AA 4IB9A 2LKKA 3C77X 2ASNX 3NQ3A 1YP7A 3WZNA 3SZHA 1KQXA 3F9DA 1VWAB 3APXA 1OBPA 1GX3A 1SRGA 1D2UA 5F6BA 5LKEA 2MJIA 2A5BA 3DSZA 3NBXX 1SWKA 3PDFA 1ICMA 4IBAA 4OMXA 1HBPA 1QY0A 2AL0X 1GT1A 1W4TA 5AJBA 4Z27A 3BRNA 1X8UA 4GJVA 1NC9A 2YG2A 3FA9A 4ORXA 2AH7X 4CDCA 4I95A 2IZCB 4YFQA 2ZAGA 3SLJA 1VYOA 3FR4A 5FQ6E 3KFFA 5IO7A 2LBVA 4ZHHA 4Z2VA 3CR6A 3RDMA 3VU1A 1STPA 3FEPA 3CBSA 1SWGA 3HOLA 1AQBA 1BSYA 2RD7C 1VWIB 3FENA 2JW1A 1SWTA 1PMPA 2MF6A 3FDCA 3WOVA 3WJFA 4ML7B 1OEKA 1QABE 4MVIA 4XMDA 4AZNA 4JO6A 1KGLA 1ADLA 1GKAB 2OY8A 1N9MA 3IA8A 1G7NA 2AT8X 2WWPA 3BSZE 2GTLO 1GT4A 1T68X 1ZNGA 2LFOA 2OFBA 5HCEC 1EPBA
chains in the Genus database with same CATH topology
3G7XA 3O2YA 2L67A 2R73A 3P6GA 3NR3A 3FYFA 2GTLM 5K06A 3P6FA 4GRJA 4DQ3A 2W2FA 3ZW0B 4QZTA 2AT0X 1Y9TA 3B2IA 1YUPA 2ACOA 2ACPX 3ZUIA 2HNXA 1HMRA 2FR2A 3Q6LA 3FA8A 4QAEA 2CZTA 2A2GA 2ANSA 4GE1A 3KFGA 4KIIA 5HTDA 4YKMA 3NX2A 4KT5A 1CBRA 3HWEA 4BVMA 4IAWA 3STNA 1FE3A 2A0AA 3IFBA 5FFHA 4PJ2A 1I4UA 2NNDA 1QY1A 4ZR2A 1BLRA 1I06A 5LJHA 1DV9A 1SXUA 1OPAA 3D95A 1E02A 4HWMA 3DTQA 4IB7A 4ODDA 1T0VA 1ZNHA 5LJKA 2Q9SA 4YCHA 2KW1A 2BLGA 1EPAA 4ZFXA 2HLVA 3RBYA 2E4JA 1CRBA 1ICNA 4AZMA 1OBUA 3CQNA 4ZJ0A 1ZNDA 2FS6A 2R56A 4YFRA 1RLBE 2OZQA 4NP1A 3V8UA 1FELA 2X8TA 1SXWA 3D4RA 3AKMA 5IO5A 4JGLA 4ORSA 5F7GA 3VG7A 2FT9A 5KICA 1G85A 1QQSA 4YFPA 3S26A 3WJGA 2XSTA 2BHVA 3OE3A 1S2PA 2RCTA 5D48A 1NP4A 1MUPA 4LZUA 5BVTA 1G5WA 2OVDA 5AJCA 2QMIA 4IB6A 1E5PA 3PQSA 2WUTA 4HPBA 3VG2A 3HOEA 5EEDA 3FR2A 4BQUA 1XKIA 2X45A 4UU3A 4COTA 5IO7A 1HN2A 1MDCA 3T1DA 4ZHCA 1GT3A 3QKGA 1EUOA 1ALBA 4TLJA 4U8UN 1D3SA 1HMSA 1X8PA 4EQAC 3UEWA 4FBOA 3HTYA 5BYPA 5FQ7E 1T8VA 3EYCA 3FIQA 1EXSA 1ML7A 1B56A 1GKAA 4LKPA 2MWHA 5DG4A 1ACDA 1EIIA 4QGWA 3P02A 1QFVA 2WR6A 4AZPA 2YMSA 5AEOA 4MVLA 4QGVA 4YGZA 2X46A 5H9LA 2F73A 2A2UA 4ID2A 4OS3A 3P24A 1R0UA 1S7DA 1YWAA 2G78A 1GX8A 3OJYC 1L6MA 2MM3A 3EBWA 1AELA 3PP6A 2P8GA 5L8NA 1BSQA 4KCAA 1IW2A 1N0SA 2FTBA 4XMHA 3ELXA 2HZRA 2LA7A 5F6ZA 3UEVA 2AT5X 1QWDA 2A3FX 3VG3A 2K62A 5L8OA 2KTSA 4GKCA 5HA0A 1SMPI 2GC9A 1O1VA 3SAOA 3ZWEA 4WFUA 3B2HA 3NQ9A 4TQ2A 5DPQA 4FBRA 1BSOA 3BX8A 3FEKA 3OBLA 4CV7A 3FR5A 4KH8A 1SY2A 3S5XA 3HWDA 4MISA 4LZVA 4Y0PA 1RBPA 5H8TA 1B0OA 3BY0A 1QG5A 4Y0RA 4ORUA 4NLIA 4AZRA 4QYNA 4MVEA 4OS8A 3HK1A 4WBKA 5CE4A 4WHIA 1ZNLA 4I3CA 2WSJA 2Z4IA 3JS1A 5D8JA 2W2AA 3VG5A 3TGCA 1B8EA 2F09A 3B2KA 4INNA 1YP6A 1TOWA 4LKTA 2PY1A 1HQPA 1BWYA 4ALBA 2LB6A 3MVFA 4ZHFA 1IKJA 1VYFA 1MX8A 2Q39A 4TNNA 3KZAA 5LJGA 4U8UO 4YKOA 1EALA 4GH7A 4EDEA 2G7BA 2QOSC 3MX7A 3ZZVA 2L68A 3KFIA 1DF3A 5LJBA 1FEMA 2FWVA 1UREA 2MO5A 2OVSA 3BU1A 4RUNA 2RCQA 1A3YA 4HFOA 4KC8A 4U8UM 4YGHA 3STKA 5HZ9A 4NYQA 4ZH9A 4PSQA 2WQ9A 3FW5A 1AB0A 1IFBA 1GXAA 1X8NA 1YWBA 1LIDA 4WFVA 2OVAA 4L1NA 3CMPA 1SXYA 4XMCA 2HZQA 3PPTA 4TKHA 2GTFX 4O3ZA 3RSWA 2Q4NA 1X71A 5EEEA 1HBQA 3RZYA 1JYDA 1GM6A 4MVKA 5AQ6A 2KT4B 3D96A 4NNSA 1XCAA 5EZ2A 1GX9A 2ZAIA 1BM5A 1LIFA 1EI5A 2AT6X 3PECA 2EU7X 1JZUA 1IIUA 3N91A 2AT3X 3F8AA 4O4XA 1OBQA 3OD9A 4A1YA 5H9AA 2HMBA 5L8IA 2AMMX 3TF6A 5BVQA 1AVGI 3HWFA 4IAXA 1MVGA 2KTDA 4A8ZA 2JU8A 4I9RA 4GNYA 3BLGA 4GU8A 4AW8A 2N93A 5LKFA 4O3XB 4Y0SA 4EXZA 1O1UA 3I0AA 2FR3A 4QNIA 3U9PC 4ZHDA 3FMZA 1YIVA 3CBCA 4ES7A 1PM1X 1TVQA 3H3IA 3SOTA 3ZW1A 3WVMA 1IFCA 1P6PA 3I17A 3GE2A 2OFMX 4YBPA 2Q2MA 1Z24A 3ZW2A 4LQZA 5F1EA 4ZHGA 4RUUA 3EM0A 4AZOA 5LJEA 4O3WA 4QZUA 3PEDA 5H9NA 4YBUA 4O4OA 4M6SA 2Z4HA 4ORRA 3VE1A 3E3CA 2JU7A 3VPJE 2OFRX 1OEEA 2DM5A 2CBSA 2GTLN 1DZKA 4ARHA 3B2LA 4DQ4A 2CM4A 2JOZA 4U3QA 1LIBA 3STMX 3PH6A 1GT5A 1SY1A 3D97A 2OVEA 5BVSA 1A2DA 2BT9A 2LBAA 4HPAA 4GZVA 5EPQA 1QFTA 4R0BA 1FTPA 3MBTA 1NP1A 2X8SA 3P6DA 4I9SA 3GAQA 4IABA 1SXXA 5HZ5A 4QQ1A 5EDBA 2IFBA 4ZGUA 3WJEA 3PQUA 4YGGA 3ZQ3A 1ZNEA 5LJDA 3C76X 5HA1A 2BS5A 4GK9A 5CYBA 3CWKA 4MIRA 5F58A 1G74A 1BJ7A 1DZJA 1UZ2X 2L5PA 2R74A 3FELA 3NADA 4I6SA 1FENA 4FQBB 2ALLX 5EDCA 3APVA 2FRSA 2QM9A 3ZW1B 4KC7A 3ELZA 1S44A 4O49A 3BS2A 4HPCA 4IB8A 2GJ5A 1DZMA 3JQOA 1KZWA 4Y0QA 4EEJA 3NPOA 5HCDC 1LICA 4QGXA 1DFVA 1LNMA 1KOIA 2POAA 1CBQA 3U0DA 1LKEA 4YCEA 3LHNA 1IKEA 3PH5A 3KFHA 1QY2A 3FA7A 4K19A 1I05A 5KIDA 5HTEA 1E06A 1KQWA 3TGAA 3WJBA 2JU3A 3B2JA 3JSQA 1BBPA 1YWCA 3NQKA 4QRLA 2JMBA 5KHPA 4TKJA 4A60A 4O4UA 4XMEA 5HZ8A 3WBGA 1JJXA 4GDZA 2WQAE 1LF7A 4UU2A 3LV4A 2Q2PA 2RN4A 4TJZA 5HBSA 4XMFA 1BRPA 1U18A 4CSBA 3NP1A 1YWDA 2XKLA 4N7CA 3UEUA 4TKBA 1NGLA 3FLLA 4ORWA 5HCCC 4XMGA 3UEXA 2X8FA 1EPBA 3K3LA 2NNEA 1TXLA 4I3BA 3TZSA 1KZXA 1X89A 2QO5A 1ERBA 1OEJA 5IO6A 4NYRA 2CZUA 3L4RA 4IMOA 1DZPA 3BU9A 4O4SA 4ALOA 5C0NA 1A18A 1JV4A 3AKNA 2FLJA 4N7DA 2K23A 4FBVA 4ZCBA 2O62A 4GNWA 4AYHA 2JN3A 1EIOA 1I04A 1KT5A 2NP1A 3F6ZB 4IMNA 2M4LA 3NX1A 4QYPA 1PBOA 2NNQA 1CJ5A 4ZH6A 3C78X 4NNTA 5FQ8E 3ZUOA 2BS6A 1SY0A 2FS7A 1HMTA 1JIWI 3P6HA 3O19A 1EW3A 4NLJA 5JR8A 1GGLA 1MX7A 3HWGA 2QO4A 3RKGA 1VYGA 3APUA 3UAQA 2A13A 2L9CA 1KT3A 1TOUA 2CBRA 2HYSA 1SA8A 1Y9LA 1BRQA 1VPRA 1H91A 1O8VA 5FAZA 3FA6A 1LFOA 3P6CA 4HPDA 4NW4A 5HZ6A 1U17A 3ZI8A 5HZQA 1B4MA 1EQDA 1X8OA 3P6EA 1CBIA 4O3YA 1KXOA 2QO6A 3BDRA 3FW4A 2G79A 4OMWA 3VG6A 5FENA 4D6AA 4YDBA 3VE2A 1X8QA 2RA6A 2RQ0A 3BX7A 4ON1A 1LIEA 1E00A 4ORYA 4YH0A 3S60A 4YMYA 1A57A 1BEBA 1LPJA 1TW4A 2W2BA 3WJDA 5HAEA 1JBHA 1JYJA 4O9SA 4GETA 1KT7A 5LJCA 4YDAA 3TGBA 4OS0A 1DC9A 1KT6A 3WXQA 4CK4A 4D6BA 3EBKA 4A1HA 3RWXA 3VG4A 1FDQA 1ZNKA 1U0XA 1ZRYA 3APWA 1SY3A 3WJCA 2CM9A 1KT4A 4I3DA 4L3RA 2MHDA 4EFGA 5HWZA 3U03A 1JJJA 1PEEA 2AKQA 3EMMA 1CBSA 4FGIB 4M7MA 5D47A 4BOEA 4AZQA 3S5VA 3ZW0A 4ZGFA 5D45A 3KQ0A 5B29A 2WEXA 5H9KA 4U9CA 2WEWA 3O22A 5B27A 1ERXA 3CQRA 1OPBA 5D4AA 4IB9A 2LKKA 3C77X 2ASNX 3NQ3A 1YP7A 1KQXA 3F9DA 3APXA 1OBPA 5F6BA 5LKEA 1D2UA 2MJIA 3DSZA 3NBXX 4OMXA 5AJBA 1ICMA 4IBAA 1HBPA 1QY0A 2AL0X 1GT1A 3BRNA 1X8UA 2AH7X 2YG2A 3FA9A 4ORXA 4I95A 4YFQA 2ZAGA 5FQ6E 3FR4A 3KFFA 2LBVA 4ZHHA 3CR6A 3VU1A 3FEPA 3CBSA 3HOLA 1AQBA 1BSYA 2RD7C 3FENA 2JW1A 1PMPA 3WOVA 3WJFA 4ML7B 1OEKA 1QABE 4MVIA 4XMDA 4AZNA 1KGLA 1ADLA 1GKAB 3IA8A 1G7NA 2AT8X 2WWPA 3BSZE 2GTLO 1GT4A 1T68X 1ZNGA 2LFOA 5HCEC 2KD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7X A;  3O2Y A;  2L67 A;  2R73 A;  3P6G A;  3NR3 A;  5K06 A;  3P6F A;  4GRJ A;  4DQ3 A;  2W2F A;  4QZT A;  2AT0 X;  3B2I A;  1YUP A;  2ACO A;  2ACP X;  3ZUI A;  2HNX A;  1HMR A;  2FR2 A;  3Q6L A;  3FA8 A;  4QAE A;  2CZT A;  2A2G A;  2ANS A;  4GE1 A;  3KFG A;  4KII A;  5HTD A;  4YKM A;  3NX2 A;  1CBR A;  3HWE A;  4BVM A;  4IAW A;  3STN A;  1FE3 A;  2A0A A;  3IFB A;  5FFH A;  1I4U A;  2NND A;  1QY1 A;  4ZR2 A;  1BLR A;  1I06 A;  5LJH A;  1DV9 A;  1SXU A;  1OPA A;  3D95 A;  1E02 A;  4ODD A;  3DTQ A;  4IB7 A;  1T0V A;  1ZNH A;  5LJK A;  2Q9S A;  4YCH A;  2BLG A;  1EPA A;  4ZFX A;  2HLV A;  2E4J A;  1CRB A;  1ICN A;  4AZM A;  1OBU A;  3CQN A;  4ZJ0 A;  1ZND A;  2FS6 A;  2R56 A;  4YFR A;  1RLB E;  2OZQ A;  4NP1 A;  1FEL A;  1SXW A;  3AKM A;  5IO5 A;  4ORS A;  5KIC A;  5F7G A;  3VG7 A;  2FT9 A;  1G85 A;  1QQS A;  4YFP A;  3S26 A;  3WJG A;  2XST A;  1S2P A;  2RCT A;  5D48 A;  1NP4 A;  1MUP A;  4LZU A;  5BVT A;  1G5W A;  2OVD A;  4IB6 A;  1E5P A;  2WUT A;  4HPB A;  3VG2 A;  5EED A;  4BQU A;  3FR2 A;  5IO7 A;  1XKI A;  2X45 A;  4UU3 A;  1HN2 A;  1MDC A;  3T1D A;  4ZHC A;  1GT3 A;  3QKG A;  1EUO A;  1ALB A;  4TLJ A;  1D3S A;  1HMS A;  1X8P A;  3UEW A;  1T8V A;  3EYC A;  3FIQ A;  1EXS A;  1ML7 A;  1B56 A;  1GKA A;  4LKP A;  5DG4 A;  1ACD A;  1EII A;  4QGW A;  1QFV A;  2WR6 A;  4AZP A;  4MVL A;  4QGV A;  4YGZ A;  2X46 A;  5H9L A;  2F73 A;  2A2U A;  4OS3 A;  1R0U A;  1S7D A;  1YWA A;  2G78 A;  1GX8 A;  3OJY C;  1L6M A;  2MM3 A;  3EBW A;  1AEL A;  3PP6 A;  2P8G A;  5L8N A;  1BSQ A;  1IW2 A;  1N0S A;  2FTB A;  4XMH A;  3ELX A;  2HZR A;  5F6Z A;  3UEV A;  2AT5 X;  1QWD A;  2A3F X;  3VG3 A;  2K62 A;  5L8O A;  4GKC A;  5HA0 A;  2GC9 A;  1O1V A;  3SAO A;  4WFU A;  3B2H A;  3NQ9 A;  4TQ2 A;  5DPQ A;  1BSO A;  3BX8 A;  3FEK A;  3FR5 A;  1SY2 A;  3HWD A;  4LZV A;  4Y0P A;  1RBP A;  5H8T A;  1B0O A;  3BY0 A;  1QG5 A;  4Y0R A;  4ORU A;  4NLI A;  4AZR A;  4QYN A;  4OS8 A;  3HK1 A;  4WBK A;  5CE4 A;  1ZNL A;  4I3C A;  2WSJ A;  3JS1 A;  5D8J A;  2W2A A;  3VG5 A;  3TGC A;  1B8E A;  3B2K A;  1YP6 A;  1TOW A;  4LKT A;  2PY1 A;  1HQP A;  1BWY A;  4ALB A;  2LB6 A;  3MVF A;  4ZHF A;  1IKJ A;  1VYF A;  1MX8 A;  2Q39 A;  4TNN A;  3KZA A;  5LJG A;  1EAL A;  4YKO A;  4GH7 A;  4EDE A;  2G7B A;  2QOS C;  2L68 A;  3KFI A;  1DF3 A;  5LJB A;  1FEM A;  2FWV A;  1URE A;  2MO5 A;  4RUN A;  3BU1 A;  2RCQ A;  1A3Y A;  4HFO A;  4YGH A;  3STK A;  5HZ9 A;  4NYQ A;  4ZH9 A;  4PSQ A;  2WQ9 A;  3FW5 A;  1AB0 A;  1IFB A;  1GXA A;  1X8N A;  1YWB A;  1LID A;  4WFV A;  2OVA A;  3CMP A;  1SXY A;  4XMC A;  2HZQ A;  3PPT A;  4TKH A;  2GTF X;  3RSW A;  2Q4N A;  1X71 A;  5EEE A;  1HBQ A;  3RZY A;  1JYD A;  1GM6 A;  4MVK A;  5AQ6 A;  2KT4 B;  3D96 A;  4NNS A;  1XCA A;  5EZ2 A;  1GX9 A;  1BM5 A;  1LIF A;  2AT6 X;  3PEC A;  2EU7 X;  1JZU A;  1IIU A;  2AT3 X;  3F8A A;  1OBQ A;  4A1Y A;  5H9A A;  2HMB A;  5L8I A;  2AMM X;  3TF6 A;  5BVQ A;  1AVG I;  3HWF A;  4IAX A;  1MVG A;  2KTD A;  4A8Z A;  2JU8 A;  4I9R A;  4GNY A;  3BLG A;  4AW8 A;  2N93 A;  5LKF A;  4Y0S A;  4EXZ A;  1O1U A;  3I0A A;  2FR3 A;  3U9P C;  4ZHD A;  3FMZ A;  1YIV A;  3CBC A;  4ES7 A;  1PM1 X;  1TVQ A;  3WVM A;  1IFC A;  1P6P A;  3I17 A;  2OFM X;  4YBP A;  2Q2M A;  1Z24 A;  5F1E A;  4ZHG A;  4RUU A;  3EM0 A;  4AZO A;  5LJE A;  4QZU A;  3PED A;  5H9N A;  4YBU A;  4M6S A;  4ORR A;  2JU7 A;  2OFR X;  1OEE A;  2DM5 A;  2CBS A;  1DZK A;  4ARH A;  3B2L A;  4DQ4 A;  2CM4 A;  2JOZ A;  1LIB A;  3STM X;  3PH6 A;  1GT5 A;  1SY1 A;  3D97 A;  2OVE A;  5BVS A;  1A2D A;  2LBA A;  4HPA A;  5EPQ A;  1QFT A;  4R0B A;  1FTP A;  3MBT A;  1NP1 A;  3P6D A;  4I9S A;  3GAQ A;  1SXX A;  5HZ5 A;  5EDB A;  2IFB A;  4ZGU A;  3WJE A;  4YGG A;  3ZQ3 A;  1ZNE A;  5LJD A;  3C76 X;  5HA1 A;  3CWK A;  5F58 A;  1G74 A;  1BJ7 A;  1DZJ A;  1UZ2 X;  2L5P A;  2R74 A;  3FEL A;  3NAD A;  1FEN A;  5EDC A;  2ALL X;  3APV A;  2FRS A;  2QM9 A;  3ELZ A;  1S44 A;  3BS2 A;  4HPC A;  4IB8 A;  2GJ5 A;  1DZM A;  1KZW A;  4Y0Q A;  4EEJ A;  3NPO A;  5HCD C;  1LIC A;  4QGX A;  1DFV A;  1LNM A;  1KOI A;  2POA A;  1CBQ A;  3U0D A;  1LKE A;  4YCE A;  1IKE A;  3PH5 A;  3KFH A;  1QY2 A;  3FA7 A;  4K19 A;  1I05 A;  5KID A;  5HTE A;  1E06 A;  1KQW A;  3TGA A;  3WJB A;  2JU3 A;  3B2J A;  3JSQ A;  1BBP A;  1YWC A;  5KHP A;  4TKJ A;  4A60 A;  4XME A;  5HZ8 A;  3WBG A;  1JJX A;  2WQA E;  1LF7 A;  4UU2 A;  2Q2P A;  4TJZ A;  5HBS A;  4XMF A;  1BRP A;  1U18 A;  3NP1 A;  1YWD A;  2XKL A;  4N7C A;  3UEU A;  4TKB A;  1NGL A;  3FLL A;  4ORW A;  5HCC C;  4XMG A;  3UEX A;  3K3L A;  2NNE A;  1TXL A;  4I3B A;  3TZS A;  1KZX A;  1X89 A;  2QO5 A;  1ERB A;  1OEJ A;  5IO6 A;  4NYR A;  2CZU A;  3L4R A;  4IMO A;  1DZP A;  3BU9 A;  4ALO A;  5C0N A;  1A18 A;  1JV4 A;  3AKN A;  2FLJ A;  4N7D A;  2K23 A;  4ZCB A;  2O62 A;  4GNW A;  4AYH A;  2JN3 A;  1EIO A;  1I04 A;  1KT5 A;  2NP1 A;  4IMN A;  3NX1 A;  4QYP A;  1PBO A;  2NNQ A;  1CJ5 A;  4ZH6 A;  3C78 X;  4NNT A;  3ZUO A;  1SY0 A;  2FS7 A;  1HMT A;  3P6H A;  3O19 A;  1EW3 A;  4NLJ A;  5JR8 A;  1GGL A;  1MX7 A;  3HWG A;  2QO4 A;  1VYG A;  3APU A;  2A13 A;  2L9C A;  1KT3 A;  1TOU A;  2CBR A;  2HYS A;  1SA8 A;  1BRQ A;  1VPR A;  1H91 A;  1O8V A;  5FAZ A;  3FA6 A;  1LFO A;  3P6C A;  4HPD A;  5HZ6 A;  1U17 A;  1B4M A;  5HZQ A;  1EQD A;  1X8O A;  3P6E A;  1CBI A;  1KXO A;  2QO6 A;  3BDR A;  3FW4 A;  2G79 A;  4OMW A;  3VG6 A;  5FEN A;  4D6A A;  4YDB A;  1X8Q A;  2RA6 A;  2RQ0 A;  3BX7 A;  4ORY A;  1LIE A;  1E00 A;  4YMY A;  4YH0 A;  1A57 A;  1BEB A;  1LPJ A;  1TW4 A;  2W2B A;  3WJD A;  5HAE A;  1JBH A;  1JYJ A;  4O9S A;  4GET A;  1KT7 A;  5LJC A;  4YDA A;  3TGB A;  4OS0 A;  1DC9 A;  1KT6 A;  3WXQ A;  4CK4 A;  4D6B A;  3EBK A;  4A1H A;  3VG4 A;  1FDQ A;  1ZNK A;  1U0X A;  1ZRY A;  3APW A;  1SY3 A;  3WJC A;  2CM9 A;  1KT4 A;  4I3D A;  4EFG A;  5HWZ A;  3U03 A;  1JJJ A;  1PEE A;  2AKQ A;  3EMM A;  1CBS A;  5D47 A;  4M7M A;  4BOE A;  4AZQ A;  5D45 A;  3KQ0 A;  5B29 A;  2WEX A;  5H9K A;  2WEW A;  3O22 A;  5B27 A;  1ERX A;  3CQR A;  1OPB A;  5D4A A;  4IB9 A;  2LKK A;  3C77 X;  2ASN X;  3NQ3 A;  1YP7 A;  1KQX A;  3F9D A;  3APX A;  1OBP A;  5F6B A;  5LKE A;  1D2U A;  2MJI A;  3DSZ A;  4OMX A;  1ICM A;  4IBA A;  1HBP A;  1QY0 A;  2AL0 X;  1GT1 A;  3BRN A;  1X8U A;  2AH7 X;  2YG2 A;  3FA9 A;  4ORX A;  4YFQ A;  3FR4 A;  3KFF A;  2LBV A;  4ZHH A;  3CR6 A;  3FEP A;  3CBS A;  1AQB A;  1BSY A;  2RD7 C;  3FEN A;  1PMP A;  3WJF A;  1OEK A;  1QAB E;  4MVI A;  4XMD A;  4AZN A;  1KGL A;  1ADL A;  1GKA B;  3IA8 A;  1G7N A;  2AT8 X;  2WWP A;  3BSZ E;  1GT4 A;  1T68 X;  1ZNG A;  2LFO A;  5HCE C;  1EPB A; 
#chains in the Genus database with same CATH topology
 3G7X A;  2OF8 A;  3O2Y A;  3SLT A;  3VHH A;  1NDJ A;  2L67 A;  2R73 A;  3P6G A;  3NR3 A;  3FYF A;  2GTL M;  5K06 A;  3P6F A;  1MK5 A;  2OF9 A;  3QQ2 A;  2W2F A;  4GRJ A;  4DQ3 A;  3ZW0 B;  4QZT A;  2AT0 X;  1Y9T A;  3B2I A;  1VWR B;  1YUP A;  2ACO A;  2ACP X;  3ZUI A;  2HNX A;  1HMR A;  2FR2 A;  1VWE B;  3PK2 A;  3Q6L A;  3FA8 A;  4QAE A;  2CZT A;  1IJ8 A;  1JMZ A;  2A2G A;  2ANS A;  1SWN A;  4GE1 A;  3KFG A;  4KII A;  1VWF B;  4YKM A;  3NX2 A;  5HTD A;  4KT5 A;  1CBR A;  3HWE A;  4BVM A;  4IAW A;  3STN A;  1FE3 A;  2X32 A;  2A0A A;  1VWB B;  3IFB A;  5FFH A;  4PJ2 A;  1I4U A;  2NND A;  4DNE A;  4IRW A;  1QY1 A;  4ZR2 A;  2GH7 A;  1BLR A;  4BBO A;  1I06 A;  2Y32 A;  5LJH A;  1DV9 A;  1NQM A;  1KL4 A;  1PBY A;  1SXU A;  1OPA A;  3D95 A;  1E02 A;  4HWM A;  3DTQ A;  4IB7 A;  4ODD A;  1RAV A;  1T0V A;  2WPU A;  2RTJ A;  1SWB A;  1ZNH A;  5LJK A;  2Q9S A;  4YCH A;  4Y5D A;  2KW1 A;  2BLG A;  1EPA A;  4ZFX A;  2HLV A;  3RBY A;  2E4J A;  1CRB A;  2RTB B;  1SLG B;  1ICN A;  4CDE A;  4AZM A;  1OBU A;  3CQN A;  4ZJ0 A;  2RTA A;  1ZND A;  2FS6 A;  2R56 A;  5IRU A;  4YFR A;  1RLB E;  2OZQ A;  4NP1 A;  3V8U A;  1FEL A;  2X8T A;  1SXW A;  3D4R A;  4CPH B;  1KFF A;  3AKM A;  5IO5 A;  4JGL A;  4ORS A;  5F7G A;  3SLO A;  2FT9 A;  3VG7 A;  5KIC A;  4GGZ A;  1G85 A;  1QQS A;  4YFP A;  3S26 A;  5CSE A;  1AVD A;  3WJG A;  1RXJ A;  1SLE B;  2XST A;  2BHV A;  3OE3 A;  1S2P A;  2RCT A;  1SWQ A;  1NP4 A;  1Y0G A;  4OEM A;  1MUP A;  4GJS A;  4LZU A;  5D48 A;  5F2B A;  5BVT A;  2OVD A;  5AJC A;  2QMI A;  4GUZ A;  3CKF A;  1E5P A;  4IB6 A;  3PQS A;  3T2W A;  2WUT A;  4HPB A;  3VG2 A;  3HOE A;  5EED A;  3FR2 A;  1LEL A;  1XKI A;  2X45 A;  4UU3 A;  4BQU A;  4B55 A;  4COT A;  1HN2 A;  4GGR A;  1MDC A;  3T1D A;  4ZHC A;  1GT3 A;  3QKG A;  1EUO A;  3RDQ A;  1ALB A;  4TLJ A;  4U8U N;  1D3S A;  1HMS A;  1X8P A;  4EQA C;  2PI3 O;  3UEW A;  2X4M A;  3HTY A;  4FBO A;  4ES7 A;  5BYP A;  2A5C A;  5FQ7 E;  1T8V A;  5K67 A;  1OSP O;  3EYC A;  4GD9 A;  3FIQ A;  5IRW A;  1EXS A;  1ML7 A;  1B56 A;  1GKA A;  4LKP A;  2MWH A;  5DG4 A;  1ACD A;  1EII A;  4QGW A;  2A8G A;  4BX7 B;  3P02 A;  4OEL A;  1QFV A;  2WR6 A;  1I9H A;  2RTI B;  1I78 A;  4AZP A;  2YMS A;  5AEO A;  4MVL A;  1SWD A;  4QGV A;  2BC3 A;  2X46 A;  4YGZ A;  2IZL B;  3LTW A;  5H9L A;  1VWJ B;  2F73 A;  3D9W A;  2A2U A;  4ID2 A;  4OS3 A;  3P24 A;  5B3M O;  1R0U A;  1S7D A;  1YWA A;  2G78 A;  2UZ2 A;  1GX8 A;  3OJY C;  1L6M A;  2MM3 A;  3EBW A;  1AEL A;  3PP6 A;  2P8G A;  5L8N A;  1BSQ A;  4KCA A;  1IW2 A;  1N0S A;  2FTB A;  4XMH A;  3ELX A;  2HZR A;  2LA7 A;  2FHN X;  5F6Z A;  3UEV A;  2IZJ A;  2AT5 X;  1QWD A;  2A3F X;  3VG3 A;  2K62 A;  2OYB O;  5L8O A;  2KTS A;  4JHQ A;  1RXH A;  4GKC A;  1VWN B;  1SMP I;  2GC9 A;  1O1V A;  5HA0 A;  3SAO A;  4WFU A;  3B2H A;  3ZWE A;  1SWO A;  2RTR B;  3NQ9 A;  4Z6J A;  4TQ2 A;  5DPQ A;  4FBR A;  1BSO A;  3BX8 A;  3FEK A;  1N7Y A;  2IZF B;  3OBL A;  4CV7 A;  3FR5 A;  4KH8 A;  1SY2 A;  2DJF A;  2JGS A;  3S5X A;  3HWD A;  3KVN A;  4LZV A;  4MIS A;  1RBP A;  4Y0P A;  5H8T A;  4BX5 B;  1B0O A;  2RTL A;  3BY0 A;  1QG5 A;  4GGT A;  4ORU A;  4Y0R A;  4NLI A;  2RTO B;  4AZR A;  4QYN A;  4MVE A;  4OS8 A;  3EW2 A;  3WZO A;  1VWK B;  3HK1 A;  4WBK A;  5CE4 A;  1G5W A;  4WHI A;  1ZNL A;  4I3C A;  2WSJ A;  5IRA A;  2Z4I A;  3JS1 A;  5D8J A;  2FHL A;  2W2A A;  3VG5 A;  3WZP A;  3ZW1 A;  3TGC A;  1B8E A;  2F09 A;  2IZI A;  3B2K A;  4INN A;  1YP6 A;  1TOW A;  4LKT A;  2PY1 A;  4CPH A;  1FJ1 E;  1HQP A;  1VWL B;  2RTE B;  2LB6 A;  3MVF A;  4ALB A;  1BWY A;  3VHI A;  1IKJ A;  4ZHF A;  1VYF A;  1MX8 A;  1VWM B;  2Q39 A;  1WUB A;  4Z28 A;  4TNN A;  1LCZ A;  5B5F A;  3KZA A;  5LJG A;  4U8U O;  4YKO A;  1EAL A;  4GH7 A;  2RTP B;  2G7B A;  4EDE A;  2QOS C;  3MX7 A;  3ZZV A;  2L68 A;  3KFI A;  3MG5 A;  1DF3 A;  5K68 A;  2OL8 O;  1JJU A;  3MM0 A;  5LJB A;  1FEM A;  1JMX A;  2IZE B;  2FWV A;  2IZG B;  1URE A;  2MO5 A;  2OVS A;  3BU1 A;  4RUN A;  2RCQ A;  1A3Y A;  4HFO A;  4KC8 A;  4U8U M;  4YGH A;  3STK A;  5HZ9 A;  2X55 A;  1RXK A;  4NYQ A;  4ZH9 A;  4PSQ A;  2WQ9 A;  3FW5 A;  1AVE A;  1X8N A;  1AB0 A;  1IFB A;  1GXA A;  1YWB A;  1LID A;  4WFV A;  4Z2P A;  1HY2 A;  2OVA A;  2OY1 O;  4L1N A;  2I5V O;  3CMP A;  1SXY A;  2G8C O;  4XMC A;  4BX7 A;  2HZQ A;  3PPT A;  4TKH A;  4BGF A;  2GTF X;  4OKA A;  4O3Z A;  1VWD B;  1VWG B;  4MEE A;  2Q4N A;  3RSW A;  1X71 A;  5EEE A;  1HBQ A;  3RZY A;  3VGW A;  2OFA A;  1JYD A;  1GM6 A;  4MVK A;  2C1S A;  1UYN X;  5AQ6 A;  2KT4 B;  3D96 A;  4NNS A;  1XCA A;  5EZ2 A;  1GX9 A;  2ZAI A;  1BM5 A;  1LIF A;  1EI5 A;  2AT6 X;  1UYO X;  2EU7 X;  2RTF B;  3PEC A;  1JZU A;  1IIU A;  3N91 A;  2AT3 X;  3WYQ A;  3F8A A;  4O4X A;  1OBQ A;  3OD9 A;  4A1Y A;  5H9A A;  2HMB A;  5L8I A;  2AMM X;  3TF6 A;  3AUM O;  5BVQ A;  2RTH B;  1AVG I;  3HWF A;  4IAX A;  1MVG A;  2KTD A;  1SRI A;  4A8Z A;  1SLF B;  2JU8 A;  1HQQ A;  2C4I A;  1MOY A;  3CKG A;  1LDO A;  3RY1 A;  4I9R A;  4GNY A;  5B10 O;  3BLG A;  2OL7 A;  4GU8 A;  2N93 A;  5LKF A;  4AW8 A;  4O3X B;  4Y0S A;  2DJG A;  4EXZ A;  1O1U A;  3I0A A;  2FR3 A;  4QNI A;  3U9P C;  4ZHD A;  1JQP A;  3FMZ A;  1YIV A;  3CBC A;  4BJ8 A;  1PM1 X;  1TVQ A;  3H3I A;  3SOT A;  1STR B;  3Q34 A;  1IFC A;  1P6P A;  1W6F A;  3GE2 A;  3I17 A;  3WVM A;  2Y3F A;  2OFM X;  4YBP A;  2Q2M A;  2ZSC A;  3AEH A;  1Z24 A;  3ZW2 A;  4LQZ A;  5F1E A;  4ZHG A;  4RUU A;  3EM0 A;  4AZO A;  4NV7 A;  1DF8 A;  1VWH B;  4O3W A;  4QZU A;  3PED A;  5LJE A;  5H9N A;  4YBU A;  1Y53 X;  4O4O A;  4M6S A;  2Z4H A;  1STS B;  3T6L A;  2G5L A;  4ORR A;  3VE1 A;  3E3C A;  2JU7 A;  1SWE A;  3VPJ E;  5B5G A;  2OFR X;  1OEE A;  2DM5 A;  2CBS A;  2GTL N;  1DZK A;  4ARH A;  3B2L A;  4DQ4 A;  2CM4 A;  2JOZ A;  1SLD B;  4U3Q A;  1LIB A;  3STM X;  3PH6 A;  2CAM A;  1GT5 A;  1SY1 A;  1SRH A;  2OVE A;  3D97 A;  5BVS A;  1A2D A;  1LCW A;  2BT9 A;  2LBA A;  4HPA A;  4JNJ A;  4GZV A;  5EPQ A;  1QFT A;  4R0B A;  1FTP A;  1K3B A;  3MBT A;  5B2A O;  1NP1 A;  2X8S A;  3P6D A;  4I9S A;  3GAQ A;  2UYW A;  1SWH A;  4IAB A;  4DCB A;  1SRJ A;  1SXX A;  1N43 A;  5HZ5 A;  4QQ1 A;  5EDB A;  2IFB A;  4ZGU A;  3RE6 A;  3WJE A;  3PQU A;  5B11 O;  4YGG A;  3ZQ3 A;  1ZNE A;  5LJD A;  3C76 X;  2FKG A;  5HA1 A;  5JD2 A;  2BS5 A;  4GK9 A;  2IZA A;  3CWK A;  5CYB A;  4MIR A;  1KL5 A;  1LUQ A;  3VHM A;  4BCS A;  5F58 A;  1G74 A;  1BJ7 A;  1DZJ A;  1UZ2 X;  2L5P A;  2R74 A;  3FEL A;  3NAD A;  4I6S A;  4CDD A;  1FEN A;  3EC5 A;  3RDO A;  4FQB B;  2ALL X;  5EDC A;  3APV A;  2FRS A;  2QM9 A;  3ZW1 B;  4KC7 A;  3ELZ A;  1S44 A;  4CDF A;  4O49 A;  1VWC B;  3BS2 A;  4HPC A;  4IB8 A;  2GJ5 A;  1DZM A;  2Y3E A;  3JQO A;  3SZJ A;  2RTM A;  1N4J A;  4Y0Q A;  1WBI A;  4EEJ A;  3NPO A;  5HCD C;  1KZW A;  1LIC A;  2HKD A;  4QGX A;  1DFV A;  1LNM A;  1KOI A;  2POA A;  1CBQ A;  3U0D A;  1SWL A;  1K24 A;  1LKE A;  1MEP A;  4YCE A;  2FGS A;  3LHN A;  1IKE A;  3PH5 A;  1HXL A;  3KFH A;  1QY2 A;  3FA7 A;  4K19 A;  3X00 A;  1I05 A;  5KID A;  5HTE A;  1E06 A;  1KQW A;  3TGA A;  3WJB A;  2JU3 A;  3B2J A;  3JSQ A;  3T2X A;  1BBP A;  1YWC A;  3NQK A;  4QRL A;  2JMB A;  5KHP A;  4TKJ A;  1SWC A;  4A60 A;  4EKV A;  4O4U A;  4XME A;  5HZ8 A;  3WBG A;  4BX6 B;  1JJX A;  4GDZ A;  4CPF A;  2WQA E;  1LF7 A;  1RSU B;  4UU2 A;  3LV4 A;  2Q2P A;  2RN4 A;  3RY2 A;  4TJZ A;  5HBS A;  4XMF A;  1BRP A;  1U18 A;  4CSB A;  3NP1 A;  1YWD A;  1Y52 X;  2XKL A;  4N7C A;  3UEU A;  4TKB A;  1NGL A;  2IZD B;  3FLL A;  4ORW A;  5HCC C;  1SWJ A;  4XMG A;  2X8F A;  3UEX A;  1NBX A;  3K3L A;  2NNE A;  3T6F A;  1TXL A;  4I3B A;  3TZS A;  1KZX A;  1X89 A;  2QO5 A;  1ERB A;  1OEJ A;  3FID A;  2OY7 A;  5IO6 A;  4NYR A;  2CZU A;  1VWQ B;  3L4R A;  1DZP A;  3BU9 A;  4IMO A;  1MM9 A;  4O4S A;  4Y59 A;  3SZI A;  4ALO A;  4C5P A;  1A18 A;  5C0N A;  1JV4 A;  3AKN A;  2FLJ A;  4N7D A;  2K23 A;  4FBV A;  4ZCB A;  2O62 A;  4GNW A;  3RDX A;  4I60 A;  4AYH A;  2JN3 A;  2RTC B;  1EIO A;  1I04 A;  1KT5 A;  4BX5 A;  2NP1 A;  1LDQ A;  1SWP A;  3F6Z B;  1SWF A;  4IMN A;  2M4L A;  3NX1 A;  4QYP A;  1PBO A;  2AF5 A;  1N9Y A;  2NNQ A;  1SRE A;  2C1Q A;  1CJ5 A;  2IZK A;  2RTQ B;  4ZH6 A;  1Y55 X;  1HXZ A;  3C78 X;  1SWU A;  4NNT A;  5FQ8 E;  3ZUO A;  2BS6 A;  1SY0 A;  2FS7 A;  5CHK A;  1RST B;  1HMT A;  1JIW I;  3EW1 A;  3P6H A;  3O19 A;  1EW3 A;  4NLJ A;  5JR8 A;  1GGL A;  1MX7 A;  2OY5 O;  2F01 A;  2QO4 A;  3HWG A;  1VYG A;  2BSZ A;  3APU A;  2A13 A;  3RKG A;  3UAQ A;  2L9C A;  3HPE A;  2KD2 A;  1KT3 A;  1TOU A;  2CBR A;  2X34 A;  2HYS A;  4CPI A;  1SA8 A;  1Y9L A;  1E2T A;  5IXG A;  1BRQ A;  4CPE A;  1VPR A;  1H91 A;  1O8V A;  5FAZ A;  2RTK A;  3FA6 A;  1LFO A;  3P6C A;  4HPD A;  1NQN A;  4NW4 A;  5HZ6 A;  1U17 A;  3ZI8 A;  5HZQ A;  1B4M A;  1EQD A;  1KL3 A;  4GDA A;  1X8O A;  3P6E A;  1CBI A;  4O3Y A;  1KXO A;  4U46 A;  2QO6 A;  3BDR A;  3FW4 A;  2G79 A;  2QCB A;  4OMW A;  3VG6 A;  5FEN A;  4D6A A;  4YDB A;  3VE2 A;  1X8Q A;  2RA6 A;  2RQ0 A;  3BX7 A;  4ON1 A;  1LIE A;  1E00 A;  1VWP B;  4ORY A;  4YH0 A;  3S60 A;  4YMY A;  1BEB A;  2OL6 O;  1LPJ A;  3RE5 A;  1SWR A;  1TW4 A;  2IZB A;  2W2B A;  3WJD A;  5HAE A;  2X56 A;  1JBH A;  1SWA A;  1SWS A;  1JYJ A;  4O9S A;  4GET A;  4BX6 A;  1KT7 A;  3WYP A;  1W5R A;  4YVB A;  5LJC A;  2RTN B;  4YDA A;  2AVI A;  4OS0 A;  1DC9 A;  3TGB A;  1KT6 A;  2VFC A;  3WXQ A;  4CK4 A;  4D6B A;  1VWO B;  2IZH B;  1PTS A;  4Z2O A;  3EBK A;  4A1H A;  2QOM A;  3RWX A;  3VG4 A;  5L3Y A;  1FDQ A;  1ZNK A;  1U0X A;  1ZRY A;  3RDS A;  1SRF A;  3APW A;  1SY3 A;  2RTD B;  4NV8 A;  3WJC A;  2CM9 A;  1KT4 A;  4I3D A;  4L3R A;  2MHD A;  4EFG A;  5HWZ A;  2FKJ A;  3WZQ A;  3U03 A;  1JJJ A;  2VFB A;  1PEE A;  2AKQ A;  3EMM A;  1CBS A;  4FGI B;  4M7M A;  5D47 A;  3RDU A;  1LCV A;  4BOE A;  4AZQ A;  3S5V A;  3ZW0 A;  2I5Z O;  4ZGF A;  5D45 A;  3KQ0 A;  5B29 A;  2WEX A;  2VDF A;  5H9K A;  4U9C A;  2WEW A;  3O22 A;  5B27 A;  1ERX A;  1A57 A;  3CQR A;  2RTG B;  1OPB A;  5D4A A;  4IB9 A;  2LKK A;  3C77 X;  2ASN X;  3NQ3 A;  1YP7 A;  3WZN A;  3SZH A;  1KQX A;  3F9D A;  1VWA B;  3APX A;  1OBP A;  1GX3 A;  1SRG A;  1D2U A;  5F6B A;  5LKE A;  2MJI A;  2A5B A;  3DSZ A;  3NBX X;  1SWK A;  3PDF A;  1ICM A;  4IBA A;  4OMX A;  1HBP A;  1QY0 A;  2AL0 X;  1GT1 A;  1W4T A;  5AJB A;  4Z27 A;  3BRN A;  1X8U A;  4GJV A;  1NC9 A;  2YG2 A;  3FA9 A;  4ORX A;  2AH7 X;  4CDC A;  4I95 A;  2IZC B;  4YFQ A;  2ZAG A;  3SLJ A;  1VYO A;  3FR4 A;  5FQ6 E;  3KFF A;  5IO7 A;  2LBV A;  4ZHH A;  4Z2V A;  3CR6 A;  3RDM A;  3VU1 A;  1STP A;  3FEP A;  3CBS A;  1SWG A;  3HOL A;  1AQB A;  1BSY A;  2RD7 C;  1VWI B;  3FEN A;  2JW1 A;  1SWT A;  1PMP A;  2MF6 A;  3FDC A;  3WOV A;  3WJF A;  4ML7 B;  1OEK A;  1QAB E;  4MVI A;  4XMD A;  4AZN A;  4JO6 A;  1KGL A;  1ADL A;  1GKA B;  2OY8 A;  1N9M A;  3IA8 A;  1G7N A;  2AT8 X;  2WWP A;  3BSZ E;  2GTL O;  1GT4 A;  1T68 X;  1ZNG A;  2LFO A;  2OFB A;  5HCE C;  1EPB A; 
#chains in the Genus database with same CATH homology
 3G7X A;  3O2Y A;  2L67 A;  2R73 A;  3P6G A;  3NR3 A;  3FYF A;  2GTL M;  5K06 A;  3P6F A;  4GRJ A;  4DQ3 A;  2W2F A;  3ZW0 B;  4QZT A;  2AT0 X;  1Y9T A;  3B2I A;  1YUP A;  2ACO A;  2ACP X;  3ZUI A;  2HNX A;  1HMR A;  2FR2 A;  3Q6L A;  3FA8 A;  4QAE A;  2CZT A;  2A2G A;  2ANS A;  4GE1 A;  3KFG A;  4KII A;  5HTD A;  4YKM A;  3NX2 A;  4KT5 A;  1CBR A;  3HWE A;  4BVM A;  4IAW A;  3STN A;  1FE3 A;  2A0A A;  3IFB A;  5FFH A;  4PJ2 A;  1I4U A;  2NND A;  1QY1 A;  4ZR2 A;  1BLR A;  1I06 A;  5LJH A;  1DV9 A;  1SXU A;  1OPA A;  3D95 A;  1E02 A;  4HWM A;  3DTQ A;  4IB7 A;  4ODD A;  1T0V A;  1ZNH A;  5LJK A;  2Q9S A;  4YCH A;  2KW1 A;  2BLG A;  1EPA A;  4ZFX A;  2HLV A;  3RBY A;  2E4J A;  1CRB A;  1ICN A;  4AZM A;  1OBU A;  3CQN A;  4ZJ0 A;  1ZND A;  2FS6 A;  2R56 A;  4YFR A;  1RLB E;  2OZQ A;  4NP1 A;  3V8U A;  1FEL A;  2X8T A;  1SXW A;  3D4R A;  3AKM A;  5IO5 A;  4JGL A;  4ORS A;  5F7G A;  3VG7 A;  2FT9 A;  5KIC A;  1G85 A;  1QQS A;  4YFP A;  3S26 A;  3WJG A;  2XST A;  2BHV A;  3OE3 A;  1S2P A;  2RCT A;  5D48 A;  1NP4 A;  1MUP A;  4LZU A;  5BVT A;  1G5W A;  2OVD A;  5AJC A;  2QMI A;  4IB6 A;  1E5P A;  3PQS A;  2WUT A;  4HPB A;  3VG2 A;  3HOE A;  5EED A;  3FR2 A;  4BQU A;  1XKI A;  2X45 A;  4UU3 A;  4COT A;  5IO7 A;  1HN2 A;  1MDC A;  3T1D A;  4ZHC A;  1GT3 A;  3QKG A;  1EUO A;  1ALB A;  4TLJ A;  4U8U N;  1D3S A;  1HMS A;  1X8P A;  4EQA C;  3UEW A;  4FBO A;  3HTY A;  5BYP A;  5FQ7 E;  1T8V A;  3EYC A;  3FIQ A;  1EXS A;  1ML7 A;  1B56 A;  1GKA A;  4LKP A;  2MWH A;  5DG4 A;  1ACD A;  1EII A;  4QGW A;  3P02 A;  1QFV A;  2WR6 A;  4AZP A;  2YMS A;  5AEO A;  4MVL A;  4QGV A;  4YGZ A;  2X46 A;  5H9L A;  2F73 A;  2A2U A;  4ID2 A;  4OS3 A;  3P24 A;  1R0U A;  1S7D A;  1YWA A;  2G78 A;  1GX8 A;  3OJY C;  1L6M A;  2MM3 A;  3EBW A;  1AEL A;  3PP6 A;  2P8G A;  5L8N A;  1BSQ A;  4KCA A;  1IW2 A;  1N0S A;  2FTB A;  4XMH A;  3ELX A;  2HZR A;  2LA7 A;  5F6Z A;  3UEV A;  2AT5 X;  1QWD A;  2A3F X;  3VG3 A;  2K62 A;  5L8O A;  2KTS A;  4GKC A;  5HA0 A;  1SMP I;  2GC9 A;  1O1V A;  3SAO A;  3ZWE A;  4WFU A;  3B2H A;  3NQ9 A;  4TQ2 A;  5DPQ A;  4FBR A;  1BSO A;  3BX8 A;  3FEK A;  3OBL A;  4CV7 A;  3FR5 A;  4KH8 A;  1SY2 A;  3S5X A;  3HWD A;  4MIS A;  4LZV A;  4Y0P A;  1RBP A;  5H8T A;  1B0O A;  3BY0 A;  1QG5 A;  4Y0R A;  4ORU A;  4NLI A;  4AZR A;  4QYN A;  4MVE A;  4OS8 A;  3HK1 A;  4WBK A;  5CE4 A;  4WHI A;  1ZNL A;  4I3C A;  2WSJ A;  2Z4I A;  3JS1 A;  5D8J A;  2W2A A;  3VG5 A;  3TGC A;  1B8E A;  2F09 A;  3B2K A;  4INN A;  1YP6 A;  1TOW A;  4LKT A;  2PY1 A;  1HQP A;  1BWY A;  4ALB A;  2LB6 A;  3MVF A;  4ZHF A;  1IKJ A;  1VYF A;  1MX8 A;  2Q39 A;  4TNN A;  3KZA A;  5LJG A;  4U8U O;  4YKO A;  1EAL A;  4GH7 A;  4EDE A;  2G7B A;  2QOS C;  3MX7 A;  3ZZV A;  2L68 A;  3KFI A;  1DF3 A;  5LJB A;  1FEM A;  2FWV A;  1URE A;  2MO5 A;  2OVS A;  3BU1 A;  4RUN A;  2RCQ A;  1A3Y A;  4HFO A;  4KC8 A;  4U8U M;  4YGH A;  3STK A;  5HZ9 A;  4NYQ A;  4ZH9 A;  4PSQ A;  2WQ9 A;  3FW5 A;  1AB0 A;  1IFB A;  1GXA A;  1X8N A;  1YWB A;  1LID A;  4WFV A;  2OVA A;  4L1N A;  3CMP A;  1SXY A;  4XMC A;  2HZQ A;  3PPT A;  4TKH A;  2GTF X;  4O3Z A;  3RSW A;  2Q4N A;  1X71 A;  5EEE A;  1HBQ A;  3RZY A;  1JYD A;  1GM6 A;  4MVK A;  5AQ6 A;  2KT4 B;  3D96 A;  4NNS A;  1XCA A;  5EZ2 A;  1GX9 A;  2ZAI A;  1BM5 A;  1LIF A;  1EI5 A;  2AT6 X;  3PEC A;  2EU7 X;  1JZU A;  1IIU A;  3N91 A;  2AT3 X;  3F8A A;  4O4X A;  1OBQ A;  3OD9 A;  4A1Y A;  5H9A A;  2HMB A;  5L8I A;  2AMM X;  3TF6 A;  5BVQ A;  1AVG I;  3HWF A;  4IAX A;  1MVG A;  2KTD A;  4A8Z A;  2JU8 A;  4I9R A;  4GNY A;  3BLG A;  4GU8 A;  4AW8 A;  2N93 A;  5LKF A;  4O3X B;  4Y0S A;  4EXZ A;  1O1U A;  3I0A A;  2FR3 A;  4QNI A;  3U9P C;  4ZHD A;  3FMZ A;  1YIV A;  3CBC A;  4ES7 A;  1PM1 X;  1TVQ A;  3H3I A;  3SOT A;  3ZW1 A;  3WVM A;  1IFC A;  1P6P A;  3I17 A;  3GE2 A;  2OFM X;  4YBP A;  2Q2M A;  1Z24 A;  3ZW2 A;  4LQZ A;  5F1E A;  4ZHG A;  4RUU A;  3EM0 A;  4AZO A;  5LJE A;  4O3W A;  4QZU A;  3PED A;  5H9N A;  4YBU A;  4O4O A;  4M6S A;  2Z4H A;  4ORR A;  3VE1 A;  3E3C A;  2JU7 A;  3VPJ E;  2OFR X;  1OEE A;  2DM5 A;  2CBS A;  2GTL N;  1DZK A;  4ARH A;  3B2L A;  4DQ4 A;  2CM4 A;  2JOZ A;  4U3Q A;  1LIB A;  3STM X;  3PH6 A;  1GT5 A;  1SY1 A;  3D97 A;  2OVE A;  5BVS A;  1A2D A;  2BT9 A;  2LBA A;  4HPA A;  4GZV A;  5EPQ A;  1QFT A;  4R0B A;  1FTP A;  3MBT A;  1NP1 A;  2X8S A;  3P6D A;  4I9S A;  3GAQ A;  4IAB A;  1SXX A;  5HZ5 A;  4QQ1 A;  5EDB A;  2IFB A;  4ZGU A;  3WJE A;  3PQU A;  4YGG A;  3ZQ3 A;  1ZNE A;  5LJD A;  3C76 X;  5HA1 A;  2BS5 A;  4GK9 A;  5CYB A;  3CWK A;  4MIR A;  5F58 A;  1G74 A;  1BJ7 A;  1DZJ A;  1UZ2 X;  2L5P A;  2R74 A;  3FEL A;  3NAD A;  4I6S A;  1FEN A;  4FQB B;  2ALL X;  5EDC A;  3APV A;  2FRS A;  2QM9 A;  3ZW1 B;  4KC7 A;  3ELZ A;  1S44 A;  4O49 A;  3BS2 A;  4HPC A;  4IB8 A;  2GJ5 A;  1DZM A;  3JQO A;  1KZW A;  4Y0Q A;  4EEJ A;  3NPO A;  5HCD C;  1LIC A;  4QGX A;  1DFV A;  1LNM A;  1KOI A;  2POA A;  1CBQ A;  3U0D A;  1LKE A;  4YCE A;  3LHN A;  1IKE A;  3PH5 A;  3KFH A;  1QY2 A;  3FA7 A;  4K19 A;  1I05 A;  5KID A;  5HTE A;  1E06 A;  1KQW A;  3TGA A;  3WJB A;  2JU3 A;  3B2J A;  3JSQ A;  1BBP A;  1YWC A;  3NQK A;  4QRL A;  2JMB A;  5KHP A;  4TKJ A;  4A60 A;  4O4U A;  4XME A;  5HZ8 A;  3WBG A;  1JJX A;  4GDZ A;  2WQA E;  1LF7 A;  4UU2 A;  3LV4 A;  2Q2P A;  2RN4 A;  4TJZ A;  5HBS A;  4XMF A;  1BRP A;  1U18 A;  4CSB A;  3NP1 A;  1YWD A;  2XKL A;  4N7C A;  3UEU A;  4TKB A;  1NGL A;  3FLL A;  4ORW A;  5HCC C;  4XMG A;  3UEX A;  2X8F A;  1EPB A;  3K3L A;  2NNE A;  1TXL A;  4I3B A;  3TZS A;  1KZX A;  1X89 A;  2QO5 A;  1ERB A;  1OEJ A;  5IO6 A;  4NYR A;  2CZU A;  3L4R A;  4IMO A;  1DZP A;  3BU9 A;  4O4S A;  4ALO A;  5C0N A;  1A18 A;  1JV4 A;  3AKN A;  2FLJ A;  4N7D A;  2K23 A;  4FBV A;  4ZCB A;  2O62 A;  4GNW A;  4AYH A;  2JN3 A;  1EIO A;  1I04 A;  1KT5 A;  2NP1 A;  3F6Z B;  4IMN A;  2M4L A;  3NX1 A;  4QYP A;  1PBO A;  2NNQ A;  1CJ5 A;  4ZH6 A;  3C78 X;  4NNT A;  5FQ8 E;  3ZUO A;  2BS6 A;  1SY0 A;  2FS7 A;  1HMT A;  1JIW I;  3P6H A;  3O19 A;  1EW3 A;  4NLJ A;  5JR8 A;  1GGL A;  1MX7 A;  3HWG A;  2QO4 A;  3RKG A;  1VYG A;  3APU A;  3UAQ A;  2A13 A;  2L9C A;  1KT3 A;  1TOU A;  2CBR A;  2HYS A;  1SA8 A;  1Y9L A;  1BRQ A;  1VPR A;  1H91 A;  1O8V A;  5FAZ A;  3FA6 A;  1LFO A;  3P6C A;  4HPD A;  4NW4 A;  5HZ6 A;  1U17 A;  3ZI8 A;  5HZQ A;  1B4M A;  1EQD A;  1X8O A;  3P6E A;  1CBI A;  4O3Y A;  1KXO A;  2QO6 A;  3BDR A;  3FW4 A;  2G79 A;  4OMW A;  3VG6 A;  5FEN A;  4D6A A;  4YDB A;  3VE2 A;  1X8Q A;  2RA6 A;  2RQ0 A;  3BX7 A;  4ON1 A;  1LIE A;  1E00 A;  4ORY A;  4YH0 A;  3S60 A;  4YMY A;  1A57 A;  1BEB A;  1LPJ A;  1TW4 A;  2W2B A;  3WJD A;  5HAE A;  1JBH A;  1JYJ A;  4O9S A;  4GET A;  1KT7 A;  5LJC A;  4YDA A;  3TGB A;  4OS0 A;  1DC9 A;  1KT6 A;  3WXQ A;  4CK4 A;  4D6B A;  3EBK A;  4A1H A;  3RWX A;  3VG4 A;  1FDQ A;  1ZNK A;  1U0X A;  1ZRY A;  3APW A;  1SY3 A;  3WJC A;  2CM9 A;  1KT4 A;  4I3D A;  4L3R A;  2MHD A;  4EFG A;  5HWZ A;  3U03 A;  1JJJ A;  1PEE A;  2AKQ A;  3EMM A;  1CBS A;  4FGI B;  4M7M A;  5D47 A;  4BOE A;  4AZQ A;  3S5V A;  3ZW0 A;  4ZGF A;  5D45 A;  3KQ0 A;  5B29 A;  2WEX A;  5H9K A;  4U9C A;  2WEW A;  3O22 A;  5B27 A;  1ERX A;  3CQR A;  1OPB A;  5D4A A;  4IB9 A;  2LKK A;  3C77 X;  2ASN X;  3NQ3 A;  1YP7 A;  1KQX A;  3F9D A;  3APX A;  1OBP A;  5F6B A;  5LKE A;  1D2U A;  2MJI A;  3DSZ A;  3NBX X;  4OMX A;  5AJB A;  1ICM A;  4IBA A;  1HBP A;  1QY0 A;  2AL0 X;  1GT1 A;  3BRN A;  1X8U A;  2AH7 X;  2YG2 A;  3FA9 A;  4ORX A;  4I95 A;  4YFQ A;  2ZAG A;  5FQ6 E;  3FR4 A;  3KFF A;  2LBV A;  4ZHH A;  3CR6 A;  3VU1 A;  3FEP A;  3CBS A;  3HOL A;  1AQB A;  1BSY A;  2RD7 C;  3FEN A;  2JW1 A;  1PMP A;  3WOV A;  3WJF A;  4ML7 B;  1OEK A;  1QAB E;  4MVI A;  4XMD A;  4AZN A;  1KGL A;  1ADL A;  1GKA B;  3IA8 A;  1G7N A;  2AT8 X;  2WWP A;  3BSZ E;  2GTL O;  1GT4 A;  1T68 X;  1ZNG A;  2LFO A;  5HCE C;  2KD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...