2RDLA

Hamster chymase 2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
226
structure length
226
Chain Sequence
IIGGTECRPHARPYMAYLEIVTPENHLSACSGFLIRRNFVMTAAHCAGRSITVLLGAHNKKVKEDTWQKLEVEKQFPHPKYDDRLVLNDIMLLKLKEKANLTLGVGTLPISAKSNSIPPGRVCRAVGWGRTNVNEPPSDTLQEVKMRILDPQACKHFEDFHQEPQLCVGNPKKIRNVYKGDSGGPLLCAGIAQGIASYVLRNAKPPSVFTRISHYRPWINKILREN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymase 2
publication title Structural basis for elastolytic substrate specificity in rodent alpha-chymases.
pubmed doi rcsb
source organism Mesocricetus auratus
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rdlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rdlA02
2Z9LA 3DHKH 4GAWA 1FI8A 2VWNA 4Q7YA 1XUGA 1P3CA 1AWHB 3RXOA 3F68H 4SGBE 1GBLA 2BDBA 4F4OC 3KQEA 4YESB 1Z6EA 1CHOG 1EKBB 1GHVH 4ABAA 2A5IA 3T28A 2XTTB 2CHAC 2FDAA 1JRTA 1VITG 5LGOA 3LGYA 4O03A 3U98H 3RM0H 4NWLA 1T8LA 1QNJA 2P93A 5ETXA 3RXBA 1SOZA 4JYVH 1BDAA 1CVWH 3A8DA 2HRVA 3BTHE 3BTFE 4TWWA 2CN0H 2WPMS 3MH4A 9ESTA 2WPIS 1RJXB 5HMAA 1O2YA 2BLVA 3UOUA 3WY8A 5B6OA 1S6HA 2R0KA 4PROA 4TY7A 3B8JA 3TK6A 3LGIA 1XMNB 2Z9GA 2BDIA 1TRYA 1O3KA 2ANKH 1GJDB 5JB8S 1SR5C 2QY0B 1SB1H 5F8TA 2C8YB 5E2PA 1NC6A 3L33A 2LNCA 1TNJA 1V2LT 2XXLA 2ZGJA 5AFZH 1O32A 1D4PB 3LPRA 1EASA 1QQ4A 2FI3E 4MNXA 3BSQA 3RP2A 4OS6A 1J9CH 3IITA 1GI9B 1VJ9U 2FIRH 1KXFA 4CHAC 4HZHA 1OOKB 1FN8A 4OS4A 4YOGA 1C1VH 2O8TA 3H7OA 1WQVH 1XUJA 4HGCA 3SI3H 2HNTE 4JZIA 2Z3CA 3MNSA 1GJ7B 3TNSA 1BJUA 1ZPCA 4FUIA 1GG6C 1O35A 3V12A 1AGJA 3U1IB 1P2MA 1QBVH 2C3SA 3IG6B 1MZAA 3TK5A 3GDVA 4THNH 1IQLA 2BY9X 2QIQA 1LHEH 3F9FA 5DKMA 4YT7H 2BD4A 2A7HA 2VWLA 2BY7X 4NZQA 5JBCS 3HGNA 1O36A 5EOKA 1BMNH 1VJAU 3KF2A 2DUCA 4KELA 1EZQA 7GCHF 2A31A 1DS2E 1HJ8A 2BQWB 1UTJA 1GJ6A 1A5IA 2VVCA 1HAVA 1SSXA 2ZA5A 3TGJE 1QY6A 3A80A 2QYIA 5TCAA 2GT7A 1Z71A 3V13A 2VIOA 3Q00A 4I33A 1DLEA 1C2MA 3RMMH 1EJNA 2VNTA 1PYTD 3KQBA 1GMHF 3RXEA 1SGEE 2XYAA 4X6OA 4X1RU 4JZDH 3UR6A 1C5LH 2V35A 3LKWA 2QXHA 7GCHG 2PUXB 1OWKA 1FPCH 1KLIH 2FOMB 2XNIA 1AD8H 2VGCB 1EOJA 1C5UA 1CGJE 3LDXH 3GICB 4H42U 1GBMA 1DXPA 3RXJA 1NY22 1W7XH 3RXSA 5ABWA 1AN1E 2I6SA 4ABFA 1GI0A 2TIOA 1P2IA 1GMHG 1G3DA 4GHTA 3QLPH 1CHGA 1AVXA 1C5ZB 3U8RH 4NIWA 1Z8RA 1YPKH 1HXFH 3TJUA 1P2NA 2BXUH 4OGYA 4DCDA 1ANCA 1LTOA 3QDZB 3R3GB 1Y3XA 5JBTA 1AE8H 1O5EH 1Z1IA 3LC5A 1P12E 1O3PB 2Z9IA 5DP8A 2G4TA 2W26A 4H6TA 1TAWA 1P57B 4TY6A 2XCNA 1HAYB 4ZKNU 2FS8A 1FPHH 2EI6A 3BTME 1YM0A 5C5NA 3QO6A 1C5XB 3A85A 3E0PB 1A3EH 3RLWH 2B8OH 1TYNA 2RDLA 2ZDMA 2ZNKH 1O3DA 1SLUB 2ZFSA 4IN2A 2ZDNA 1S81A 2Q6GA 1PQ8A 3ITIA 4MPXA 2VVUA 1QL9A 1Y59T 3U9AH 1GCDA 1NFWA 3M7TA 1O2LA 1LQDB 2BZAA 1LHCH 2QAAA 5PTPA 1XUKA 4ISLA 1XVMA 3RXMA 1ELFA 1F2SE 1MMJN 1B5GH 1O2HA 3UR9A 1SGFG 1BOQA 4AFQA 1BMAA 3QGNB 4ISOA 4ZHAA 2AFQB 2PKSC 2W5EA 3T29A 3TVJB 4B71A 1YC0A 1RTFB 5ESBA 1WUNH 1W0YH 2BXTH 1GI1A 2VGCC 3HATH 2TGPZ 3H5CB 4AGJA 1L4ZA 1SFQB 2C8ZB 1O2JA 2UUJB 4AFSA 4Z0KA 1H1BA 2HGTH 3F1SB 1H9HE 2FLBH 1ESTA 3BIUH 2OC1A 2VIWA 4KP0A 1K1LA 1HAZB 4AOQA 5DP7A 3ZVBA 4UDWH 1PFXC 1W8BH 2ZTXA 3DA9B 1F0SA 2VVVA 1AY6H 4INLA 1O5DH 6LPRA 2PGBB 1MD7A 2ZGCA 1TX7A 2FS9A 4K1TA 1O2NA 3ZZ4A 1EAXA 2D8WA 3ZV8A 1W2KH 3QUMP 1AZ8A 1GJ8B 1FLEE 1N8OB 5DPAA 1SVPA 4FXGH 1RIWC 1C5YB 4ABEA 5GJ4B 3I77A 2Y5HA 2VINA 1GJ4H 2HPQH 4DGJA 1QURH 1TFXA 1TGSZ 3FAOA 4FUGA 2GCHF 4J2YB 2BYAX 2HALA 4RKJB 3BG8A 4ZHMU 1D3QB 1K1NA 1EB2A 5EXMA 1BBRK 2FEQH 4LK4A 3MYWA 3ZZ3A 2NWNA 2ZQ2A 1Z8GA 3FANA 2EA3A 3NUMA 1XKAC 2B0FA 1BT7A 4E05H 1INCA 1H9IE 1BITA 2JH0D 4AYVB 1TPOA 1TWXB 1DWCH 1NESE 1GPZA 4WWYA 4WMFA 5F8XA 1QB6A 3PO1C 3E90B 2ZKSA 2CJIA 1YYY1 3MWIU 4NCYA 2H5DA 2B5TB 1GVLA 1F7ZA 1GBIA 1Z8IB 4NSVA 2YNBA 4VGCB 2ZF0H 2D2DA 4RSPA 3ZVFA 1O2SA 3Q77A 2A32A 3BTQE 3I78A 2A4GA 1SFIA 3UREA 1FJSA 6GCHF 2F9PA 4CBNA 1GCTC 3ESTA 4X6PA 3GY7A 4U30A 2FTLE 1V2UT 2NU3E 5C1XA 2H9EH 5EODA 1JXPA 2PWXA 3E0NB 2HNTC 3GDUA 5EGMA 4I8LA 1UO6A 2R0LA 4MPUA 1G2LA 3STIA 2J92A 1OWIA 1XXFA 4A7IB 2ZPSA 3GCHC 1AO5A 1PPBH 1YCPM 4I32A 3P70B 2D26C 3ATIA 3SORA 3TNTA 1A0HB 4Q7XA 5C1YA 2VJ1A 2ZDLA 2V3HH 3S9AA 2QV1A 1LDTT 1TRMA 5DK1A 1OYTH 2CGAA 4ZUHA 3ZZBA 1C4V2 2DE9A 3TGIE 3RU4E 2GZ9A 2FODA 2ZEBA 1FN6A 3SJ8A 3E3TA 4HFPB 2A2QH 1FAKH 4SGAE 2AMQA 3TITA 1PQ5A 4X1QU 2GDDA 3M37A 3BTGE 1MD8A 3MO6A 4X8TH 1FY5A 4BTIB 4UFGH 4WJG2 5DGJA 1GDQA 2ZECA 1QRXA 1TX6A 4MG3A 1O39A 1DUEA 2ZG0H 3SV9A 1TMUH 1MTVA 2NU4E 4D76A 1S82A 1SBWA 1KTSB 3SU1A 4X2YA 1TNKA 2GD4B 1OP2A 1EPTC 1O2ZA 3LGWA 4Z6AH 1MQ6A 1WQSA 1NT1A 3RXAA 1H9LB 1MTUA 1SC8U 1MU8B 2Q6DA 3D49H 2BOKA 2DE8A 3M3SA 3D23A 4NIVA 3DT0H 4E7NA 1O5BB 3F9GA 1ELBA 3PLPA 2ZHWH 4K60A 3M36A 1F5KU 1C1OA 2FOGA 4I8JA 3O8RA 2R2MB 3P8FA 1FUJA 3SJ9A 2EC9H 1C1NA 1DDJA 4XBCA 1GBHA 2RCEA 1CU1A 3PMBB 3KIDU 2FYQA 2J9NA 1UJ1A 4OS5A 1DY8A 1F5LA 4ZXYH 1MBQA 4BAQB 4MNWA 1A46H 1NRRH 1ELTA 2G5NA 2TGAA 2CMYA 3LU9B 2IOTA 3VFEA 4I8GA 1GL1A 6CHAC 1AFQC 3A87A 4CRFA 1C5WB 1PJPA 4MTBA 2D1JA 3A86A 1OWHA 1OSSA 4WH8A 1ID5H 3KN2A 1ANDA 1SPJA 1O3HA 2BOHB 2SGFE 2FXRA 5FX5A 5I25A 2CHAB 4HI3A 5F6MA 1C1TA 3O8DA 2BD3A 1UCYK 4IC6A 4X8VH 4WF8A 2Z9JA 5AF9H 3MNCA 4XE4A 4K3JA 3BTEE 1WU1A 4CH2B 3ZZDA 7ESTE 1ZTLA 2G81E 3HKJB 1TOMH 1LVOA 1ZJKA 3ATLA 4MVNA 4CR9A 1LPGB 1NTPA 1O3OA 2ZTZA 1XX9A 1SGIB 3HPTB 5JPMH 2FI4E 3SHAH 2JH5D 4DURA 2QF3A 4MLFB 1HFDA 1LPZB 1TALA 3PROA 1EOLA 1YLDA 1C1PA 1W3CA 4D7GA 1ARCA 1MCVA 3MU4A 2Z9KA 3L3TA 3M35A 1LHFH 1J14A 1L1GA 4ESTE 5DP6A 4CRDA 2PKAB 1YPMH 3M61U 4DY7B 2H9HA 1ZHPA 4AYYB 3RMOH 1TRNA 1LKAA 1ZMJA 1G3BA 1UTMA 2VIVA 1O2XA 3RM2H 2AGEX 4JCNA 5LPFA 1ZPBA 2VIQA 1TMBH 3MH7A 1M9UA 1VITF 3SQEE 1GG6B 1SGQE 2WUCA 1W7GH 4RN6A 3UY9A 5A8ZA 2ZPRA 1C2DA 4NFFA 1C5MD 3UQOA 1O3NA 2OBQA 4X6MA 4NA9H 1DPOA 3OX7U 5TCCA 1WAYB 1HAXB 1GJBB 3SBKA 1TGCA 1TQ7B 1GI6A 2A1DB 5AFYH 4OS7A 4I8KA 2BDCA 3ZVEA 1WSSH 1Y3VA 3C27B 4OS2A 1C5QA 2XRCA 4UD9H 1C5NH 4YO9A 1P2OA 1TBQH 3BTTE 5DP9A 1SMFE 1TE0A 1XUIA 2A45B 3TJVA 5AVDA 3EAJA 1SI5H 2ALVA 4LOYH 5HM2A 2ESTE 4BAMB 1EJAA 3DFLA 2BY8X 1O3LA 3RXGA 3FP6E 2IN2A 4MDSA 2ZCHP 1C1QA 1ELEE 1JIRA 2SGAA 4GHQA 1KSNA 1DUAA 4ZXXH 3BTWE 1QHRB 1LQEA 1CSOE 5L2ZH 1EZUC 3RC4A 5E0GA 5EPYA 3A8AA 2J2UA 3PM3A 1A1RA 1PYTC 4FUEA 3LH1A 1MTSA 3ZZCA 2F9NA 4WVPE 1GGDB 3UFAA 4B2CA 2AMDA 4B73A 1QRZA 4FU9A 1DY9A 1MKWK 1FY1A 1SLXB 1C2KA 1GI7B 1NPMA 3EA8A 2AH4X 1BBRE 1BRCE 1Z6JH 3ZZ8A 2XBWA 1V2NT 1T8OA 1G9IE 1QIXB 3FZDA 3UNRA 1C5PA 1TPAE 3H7TA 1ZPZA 1ZTJA 5EPNA 5T3HA 3VB3A 3TH4H 1H8IH 4X2VA 1SGDE 1HV7A 1P03A 1JRSA 1OX1A 1JMOH 5EQRA 5A0CA 2WYGA 4DJZB 2ANYA 4FVDA 3KQDA 3W95A 1HYLA 2SGQE 4AFZA 2ZPQA 1LO6A 1TPPA 4ABGA 4K8YA 5GIBA 2BZ6H 3RXQA 3KEEA 2FLRH 2PW8H 1JOUB 3RMLH 3BEIB 1O3GA 4NSYA 5GXPA 1THSH 2OP9A 2WPHS 2FX6A 5A8XA 2OQ5A 1UTKA 8KME2 2WYJA 4ABIA 3GDSA 5HM9A 4GVUA 3AVZA 1CT0E 1GI3A 1AWFH 3RXFA 3PWCA 1L1JA 1UVPA 3V0XA 1TMTH 2FOHA 1Y3WA 5DP3A 1N6XA 1HPGA 1V6DA 2WV4A 1A5HA 3U8OH 3ZZ5A 1O2GH 1OXGA 2P59A 1BRUP 4ABHA 1RRKA 2BDGA 3RXIA 3M7UA 1O5CB 3ZZ7A 1E34B 2PKSB 1JBUH 3SUEA 2ZDKA 3AASA 4I7YH 3SU5A 2BD5A 3OSYA 2BDAA 1GGDC 1QCPA 1WV7H 3MO9A 1B0FA 2ZHDA 2ZU4A 3DD2H 4FUCA 1DICA 1THPB 1PPGE 1Z8JB 3TPIZ 3TH3H 1KLTA 2R3UA 3GYLB 1GJCB 3KHVA 1FMGA 1SLWB 2BLQA 1O3BA 3LT3A 1DANH 1HRTH 3NK8A 1G3EA 1LHGH 1Y5AT 5AHGH 1KXAA 2R2WU 1ZHMA 1HAOH 1W12U 2H2ZA 5FHTA 1BTPA 3SU6A 1K28D 2SGDE 1KTTB 1QQUA 5HXFA 1BQYA 5A2MH 3KNXA 1GI2A 4AFUA 2G00A 1U6QA 1TA2A 1HAVB 3AAUA 5DO4H 3PMHB 4Y8ZA 1ZMLA 1WOFA 3R0FA 3T62A 1A61H 1RIWB 3A7VA 2FESH 1FV9A 4X8UH 3RU4D 1KXBA 1O33A 1XXDA 3P92A 2KAIA 4KTSA 1DXWA 3ZVAA 1P01A 2A5KA 5EG4A 1G2MA 1SLVB 1J15A 1BMMH 1KIGH 1GBTA 2ZFFH 1GHXH 2BQ6B 1Z7KA 4ZAEA 1ELCA 5K0HA 1V2ST 1CO7E 2VU8E 1F0TA 4IGDA 2FWWA 1LPKB 3SU3A 3E8LA 4XDEA 1AKSA 2QC2A 1TONA 1UMAH 2ZHQH 1MUEB 4ZROA 1OWDA 2ZQ1A 1NU7B 1O34A 1PQ7A 1ZGVA 1GDUA 1V2TT 3VXEH 2A4QA 4DT7B 2GCTC 1C9TA 2G51A 2OLGA 3P6ZB 4WXIA 3V7TA 1CBWC 1BA8B 4BTUB 7KMEH 3SOSA 3BTKE 4TPIZ 4WY3A 4WH6A 1P06A 1BHXB 5FAHA 2SNVA 2OXSA 3IWMA 3SU2A 3PO1B 1OP8A 4FUHA 5C1UA 3VB6A 1OWJA 2BVRH 4KKDA 3OTJE 5TJXA 1GBEA 1BIOA 1A5GH 1SGRE 1W13U 2CF9H 4E06H 4ABDA 3ZYDA 1IHTH 1QBOA 4KGAA 4O9VA 3P8GA 1FXYA 3TJNA 4X8SH 1GJ9B 4BNRA 3VEQB 5BPEA 5E2OA 1A0LA 1SHYA 3FVFB 1TOCB 1GCTB 2HWLB 5F8ZA 3ZZAA 3BF6H 4QT8C 1SQAA 2BD8A 3UWIA 1AUJA 1LKBA 2KAIB 1ELVA 1OS8A 3LOXA 1CQQA 2ANWA 1EB1H 1EXFA 1EPTA 3LJOA 1DSTA 4GCHG 4YOJA 1YCPH 1GHBG 1UCYE 1C1UH 3MH6A 2J95A 1O3FA 1VCQA 2F3CE 1QA7A 3K6ZA 2WV5A 5JDUB 3CP7A 3NZIA 3GCHB 1KXEA 1A3BH 1MCTA 2H9TH 4YLUA 1C5OH 1CE5A 1NFYA 4XBDA 3U1JB 4LZ1H 2ZGBH 2Y7XA 4Y8YA 1IQGA 2AYWA 2ZFPH 1P02A 1PPCE 1NS3A 1DSUA 4D7FA 1V2VT 4Y76A 2PHBA 1MAYA 1UK4A 1P2KA 5FPTA 1MZDA 1PPEE 3SUFA 1O2QA 1WYKA 1Z1JA 2ULLA 4B2AA 1CGHA 3MU5A 1ZMNA 5K7RA 4K2YA 1NRQH 1W11U 5DJ7A 3M5OA 4CH8B 3D62A 1O38A 1W10U 3MU1A 4TYDA 1RD3B 1TBZH 3RXKA 1DFPA 5FBEA 3HK6B 1O5FH 2GDEH 1CA0B 3RMNH 4AN7A 5LH8A 1NU9A 1T8MA 3RXDA 5E0JA 3E16B 2ZWLH 1WTHD 1BRBE 3W94A 1EPTB 1O3AA 4DIHH 2FOFA 2BLWA 3A7TA 1T31A 1XVOA 4BANB 2C8WB 1GBFA 2AERH 1SG8B 3VPKA 2V6NA 4A1VA 1P0SH 4JZFH 2UWPA 2J34A 2PV9B 2Q1JA 1GBAA 5T6DA 1S84A 1MTNC 1OYQA 2PUQH 3AW0A 1QJ6B 2SNWA 5E0HA 1ETSH 1UTOA 5DP5A 2WUBA 1EP6A 3TLOA 1QFKH 2YOLA 2ODYB 1O3EA 4BXSA 3ATWA 4CRBA 4FUJA 3S69A 1HUTH 1C5SA 7LPRA 1EAIA 2H1UA 2C4FH 4Y6DA 2XC0A 1NZQH 1UVOA 4CRCA 1HAPH 2ZZUH 1Y8TA 2FYRA 6CHAB 2BDHA 1AFQB 4ISIH 5H4IB 1ETRH 2OBOA 4DVAU 3S9BA 2A4RA 3PMAB 2NU1E 1O2KA 3LH3A 1XUHA 2GMTB 3OU0A 5CMXH 4I8HA 2Z7FE 2Q6FA 1EUFA 1C2EA 2BVXH 1MKXK 4Y11E 3PYHA 1KY9A 1Y3UA 3I29A 4B76A 1HDTH 1AI8H 2TGDA 2ZFRH 4F49A 4YZUA 4M7GA 2A5AA 3A89A 4Y7AA 4ZKSU 1ZGIA 1IQHA 1NM6A 2P95A 3QTOH 1HCGA 1CA0C 4JMYA 3SV8A 1ZZZA 1L0ZA 3ODDA 4B75A 5E8EH 1O5AB 1PPHE 4YTAA 3SNAA 5CE1A 3NXPA 4DOQA 2BM2A 1TGNA 3BTDE 4AB8A 1EX3A 3RDZA 4YT6H 5A8YA 3UWJH 2Y81A 1QTFA 2FPZA 1WCZA 4ISNA 4AB9A 1BMLA 2WPKS 2V3OH 1GVZA 3SN8A 1SL3A 4X2WA 2JKHA 1IOEA 5ESTE 3RXUA 5FPYA 1ZR0A 1HIAA 3ZZ9A 3U8TH 4Y79A 3DUXH 5C5OA 1O2WA 3F6UH 2XBYA 3A8CA 3EA9A 4NIXA 1CA8B 3OY6U 3S7KB 2P3FH 1TNLA 4O3TA 2BY5X 4MNYA 5J4QA 1PQAA 2QA9E 2R9PA 4UONA 2F9BH 1EZXC 2OTVA 2BHGA 1VR1H 5FX6A 4TWYA 3A84A 2QXIA 1EAUA 1QGFA 4IMQA 1JIMA 3EA7A 1W14U 3VGCC 3MMGA 5EW2H 1GBJA 2BX4A 4IN1A 5EW1H 2ZCLP 1T7CA 4Q2KA 1SGCA 3B23B 1Q31A 1C1SA 4UFFH 4XSKU 2GMTC 4JK6A 1EQ9A 1F0RA 3MU8A 2GVFA 3S7HB 1A7SA 2XWAA 3S0NA 3BEUA 3JZ2B 3GYMA 1SGNE 5J4SA 1KDQA 1EJMA 3A83A 1OP0A 1GHAG 2Y82A 1K9OE 4Q80A 2UWOA 2F83A 1C5RA 1GHWH 4AG1A 1GMCF 1K1IA 3QTVH 1THRH 1VGCB 3QN7A 5BRRE 1BTWA 4A1XA 1YP9A 1ZOMA 5F03A 1HIAB 2OC7A 1B0EA 1UVSH 1E0FD 3BN9A 4NGAH 2OC0A 2TGTA 1NRNH 1ZLRA 2P94A 3GY3A 1GI8B 1KXDA 4GLYA 2WPJS 2ZGHA 4X1NU 1DX5M 1E36B 2QXJA 3UPEA 1KXCA 2SFAA 4GUXA 3PLBA 1GMCG 2PSXA 4LXBH 1C2LA 2EEKA 3EGKH 1TIOA 4Y0ZE 1GBKA 2STAE 1YPEH 1UHBA 5EXLA 5EQSA 2BVSH 1ARBA 2BB4A 1J17T 1TA6A 2GGVB 3G01A 2ZHEH 3QGJA 1A2CH 2ZCKP 3ZZ6A 5L30H 3ODFA 2XW9A 4HTCH 1YPHE 1TABE 4U32A 1HBTH 1DLKB 4ABBA 1O2TA 2GZ7A 5G4BA 3SNDA 4NWKA 3RXTA 2ODPA 4O3UA 1UVUH 4ZH8A 1CT4E 3STJA 2FOCA 2FTMA 2Y5FA 4YLQH 1ZTKA 3GISB 5C3NA 4LZ4B 3GY6A 1K1PA 1LCYA 1NN6A 1KDQB 3PTBA 3A82A 1TNGA 4UFEH 1O37A 1OPHB 1MAXA 3OYPA 4ABJA 1L2EA 2GV6A 3SV6A 1GI5A 1N6YA 1TNHA 3PV4A 5T6GA 3EYDA 2TPIZ 1ELDE 1Y5BT 3ZYEA 1QB1A 3Q3XA 2QF0A 5JYIA 2F9UA 1TX8A 2A2XH 1FAXA 4BXWA 2PR3A 1DOJA 3CENA 2GV7A 1EATA 1IAUA 1UTLM 1RXPA 1AU8A 2FI5E 3F9EA 3SJOA 1DWEH 3F9HA 3TK9A 2OCVB 5GDSH 1FY8E 3M3VA 4WMEA 2FO9A 3D65E 1VGCC 3L6PA 2J94A 4UFDH 1G37A 1TLDA 1O2RA 3VB4A 1UHBB 1P05A 4BAKB 4YM9A 1UTPA 1IQKA 3BG4C 3QZQA 1V2QT 5C67A 3V3MA 2HOBA 4B2BA 2ZDAH 5EXNA 3URDA 8GCHF 3P8NA 3A7ZA 1AQ7A 4IBLH 2CF8H 1AZZA 1TBRH 3RXLA 3U69H 2GTBA 3MOCA 4AG2A 2FMJA 4A1TA 5LPRA 4J1YA 4CR5A 3T5FH 1ZJDA 1O2PA 2BMGB 2XC4A 3Q3KA 1AB9C 4Q7ZA 1NRPH 1HGTH 2BQ7B 2FOBA 1HAHH 3UNQA 1MH0A 3MU0A 1Y5UT 4INHA 2G5VA 4A5TS 8GCHG 1TQ0B 4BAOB 2P3UB 3PTNA 2FP7B 3TU7H 1S5SA 2P3TB 2Z94A 5FBIA 2AGGX 4XFQA 1ABJH 2Y80A 4K1EA 1UTQA 1QRWA 3UUZA 3M7QA 1WTGH 2VWOA 3JZ1B 1ANBA 1D6WA 1AMHA 1AIXH 1CGIE 1GVKB 3SU0A 1ZYOA 2AIPA 1GBDA 1L4DA 1V2MT 2W7UA 3GY4A 1K22H 3TIUA 3MH5A 1DWBH 3RXCA 3PMJA 1BBRH 2Z3DA 1YPGH 3SGQE 1RFNA 1C2GA 1DE7H 2QCYA 4H4FA 1D3DB 1K1OA 1GI4A 2THFB 2PSYA 2UUKB 1HNEE 2A7CA 4MQAA 2GCTB 1BZXE 1GBCA 4GSOA 1MBMA 3TJOA 4R8TB 1CBWB 3RXVA 1YBWA 2J4IA 1B7XB 1WBGB 2TRMA 3UOPA 1ESAA 4JZ1A 2AS9A 1S0QA 3K2UA 1E38B 2FOEA 1FQ3A 2ODQA 2ZHFH 1SHHB 1C4Y2 1DT2A 4X1SU 1C5VA 2Y5GA 1IQFA 3RC5A 1BTXA 3BEFB 4Y10E 3NKKA 2PTNA 2GP9B 1SGFA 2WPLS 4NFEA 2GT8A 1KLJH 3MFJA 2HVXA 1W0ZU 1E37B 2ZTYA 1FNIA 3TGKE 4K69A 3ATMA 1C1RA 1SGTA 2XWBI 1RTLA 1MU6B 1MTWA 4AZ2B 1C2HA 1QA0A 1BCUH 3B9FH 5JBAS 4U2WA 2R3YA 3QWCH 4E7RG 1SQOA 3LGUA 4ASHA 1NROH 2ILNA 1GHYH 1ELGA 3M3TA 2PFEA 2Z3EA 3SO3A 1Y3YA 3ZVGA 4GPGA 2PTCE 4DG4A 1BJVA 2VIDA 1UTNA 4CRGA 1O0DH 1ACBE 1BTUA 1OWEA 1C2FA 5GWZA 3AAVA 3QZRA 1ESBA 2LPRA 3GY8A 4RKOB 1GMDF 3SGAE 4FUBA 2GX4A 3C1KA 1C4U2 1BHXF 2XBVA 1P04A 1MKXH 3M5NA 2VB0A 1ZSKA 2F9OA 3VB7A 1TGBA 1AE5A 2ALPA 1CT2E 1UK3A 3LGVA 3NWUA 2VH6A 1O3IA 3GY2A 1QJ7B 2B7DH 3A81A 1AHTH 1GJAB 1LMWB 5HYOA 3SI4H 3ZVCA 3ATKA 3T25A 1YLCA 5L6NH 3BIVH 4MPVA 1GL0E 1T4UH 3SJKA 3UTUH 1EZSC 3SHCH 1ZRKA 1O2VA 1AVWA 1GMDG 2BX3A 4K5ZA 5IYTA 1H4WA 2XCFA 2ZFTA 4GCHF 1RS0A 1GHBF 4NG9H 2YNAA 2NU2E 1ANEA 2UWLA 2BD9A 1OKXA 2A4OA 4KTCA 2BLOA 1QR3E 1J16A 1V2OT 5HGGA 2FZZA 2HNTF 2PGQB 1SOTA 4CRAA 4FUDA 1MTNB 1P10A 2M5TA 2OQUA 1G32B 1DITH 1YPHC 3A7XA 1D6RA 3SZNA 3KL6A 1SGYE 2G8TA 1IQEA 4TPYA 1AKSB 6ESTA 3ENSB 1O2UA 1FZZA 1UVTH 1XM1A 3A8BA 3P8OA 1O31A 1FDPA 5JBBS 1XUFA 4NA7A 4NZLA 2NU0E 3RUOA 1JWTA 3HGPA 3URCA 3E1XB 1BTYA 2QXGA 2XBXA 3GCNA 3KQCA 1NO9H 4AORA 1TNIA 2ZU1A 4O97A 2ZIQH 1A0JA 1HJAB 4IW4E 1Q3XA 3P95A 3K65B 3K6YA 4H6SB 2ZDVH 3LGTA 1GDNA 4WMDA 1NRSH 5SGAE 2Y6TA 4A92A 3SNEA 2FM2A 4DIIH 1DM4B 4R0IA 3PB1E 4NA8A 3SNCA 1HLTH 2B9LA 3LONA 2P16A 1HAIH 2O9QA 3Q76A 2OC8A 3MO3A 3LC3A 1UCYH 2ZC9H 3A88A 2PLXA 1FIWA 3P17H 1O5GH 1QL7A 1S83A 4ZKOU 2ASUB 4OGXA 1VCWA 2SGEE 2Y7ZA 1V2RT 1K2I1 2TBSA 4FU7A 2GZ8A 3GOVB 2QGRA 4NIYA 1TGTA 2VH0A 3SUGA 5A0AE 2O8LA 2H5CA 1V2KT 2W7SA 2GCHG 1ORFA 1S6FA 5DG6A 8ESTE 5LPEA 3ZVDA 4MPWA 1D3TB 1P3EA 5IDKA 1O3JA 1S85A 4Y0YE 1O2MA 4OS1A 3A7YA 4AX9H 2IJOB 3NPSA 2SGPE 4KTUA 4YOIA 5A0BA 2CXVA 3OY5U 2VIPA 4JYUH 1QBNA 2BTCE 3E91A 5FXLA 3SW2B 4I31A 4WXVA 1VCPA 2AMPA 3SJIA 3K9XB 1Q2WA 3GCTF 2JETB 3PLKA 2ZGXH 1F0UA 4FUFA 2ZFQH 1G3CA 2UUFB 3BV9B 2ZU2A 3SNBA 2K1QA 1AUTC 1GHZA 1J8AA 1SGPE 1YPLH 1N8OC 1O2IA 4UEHH 2F91A 1C1WH 3M5MA 1HJAC 2O8WA 3VGCB 3MTYA 2I6QA 3SQHE 3HKIB 4X0WU 2FX4A 2UUYA 4BAHB 1N1LA 4JYTA 3GCTG 3HK3B 6GCHG 5T6FA 5CHAB 2WINI 1IHSH 3EQ0H 5EU8A 1G36A 1S0RA 2CV3A 3SU4A 1ZHRA 1GJ5H 2G52A 5C20A 1QB9A 4B1TA 4CBOA 2A7JA 1TB6H 1P2JA 2OINA 3RLYH 1ZSJA 1E35B 1HXEH 1V2JT 3N7OA 4MNVA 2RA3A 1UK2A 1K1MA 4A6LA 3O8BA 1BUIA 5FPSA 2OUAA 4ZMAH 1P9UA 1BTHH 3AW1A 4UE7H 1RGQA 1BRAA 1F92A 1A4WH 3RXRA 1P2QA 3KCGH 2GKVE 3EE0B 4JZEH 3UNSA 2AGIX 1EP5A 3PWBA 2Z6BD 1D3PB 1ZRBA 1MKWH 2QN5T 3RC6A 2P8OB 4D8NA 2C90B 1PPZA 5A09A 1FIZA 3SV7A 1FONA 1O3MA 1VITH 4ISHH 3ZV9A 4VGCC 3FFGA 1K1JA 1HB0B 1QL8A 1IQMA 3CS7A 1QJ1B 2F9VA 4AGKA 1D9IA 2JETC 3FP7E 3RU4T 5GPIB 4X2XA 2AIQA 1C2JA 5DP4A 2AEIH 3DFJA 1GHAF 3VXFH 2J38A 5FCRA 3KGPA 1YCPK 4INKA 3MNXA 4D9RA 1GBBA 2XC5A 1P8VC 2STBE 1NFXA 2ZU5A 3UQVA 4DW2U 1P09A 1ETTH 3T27A 3QX5H 4D9QA 2ZO3H 1O2OA 3Q3YA 2BDYA 3NCLA 5GCHF 1EAWA 4K8BA 1G30B 1IQIA 5CHAC 3S9CA 1MQ5A 1H8DH 4Y8XA 1ABIH 2C93B 4Y71A 2C8XB 2PKAA 1AFEH 3ELAH 1P9SA 2A0QB 2RA0A 2G4UA 4Y7BA 1V3XA 1L1NA 4FVBA 1PPFE 1IQJA 1C5TA 1YKTA 4JK5A 2OD3B 2BD7A 1ZSLA 2JH6D 1BB0B 1K21H 1YGCH 1X7AC 5FCKA 5GCHG 2ZU3A 2BY6X 2HPPH 5I46H 1YF4A 4ZHLU 2W3KA 1V2WT 4IS5A 1AVGH 1LVBA 3GCOA 3SUDA 2O8UA 3UIRA 5EQQA 2FOAA 4K1SA 1YPJH 3BG4B 2IPHA 1LVYA 2RG3A 2VWMA 2W3IA 3GY5A 4FU8A 5L2YH 1V2PT 1TPSA 2H6MA 1XKBC 3FP8E 3T26A 1GWAA 1VZQH 3CS0A 3E6PH 4IC5A 2P8OC 1DWDH 4XBBA 3O8CA 1RTKA 3RXHA 2EI7A 3A7WA 2EI8A 1SQTA 1LVMA 2G55A 3QK1A 4CREA 1T32A 3SV2H 4XOJA 1T4VH 4ZKRU 1AB9B 4U01A 1DVAH 1LHDH 5JB9S 3MI4A 1P11E 2O8MA 5C2ZA 2BD2A 2HLCA 4X1PU 4IMZA 1IQNA 9LPRA 4BOHA 1F5RA 1NFUA 1O30A 4X6NA 3LIWA 3VB5A 1HJ9A 3RXPA 1FY4A 3MHWU 2V0BA 1C2IA 3SGBE 4CHAB 2ZP0H 1CHOF 3T2NA 4BTTB 2ZI2H 1BTZA 1FY3A 3MNBA 8LPRA 4B74A 1T8NA 2ANMH 3M5LA 3FZZA 3LJJA 1KYNA 1ELAA 3TH2H 3EDXB 1C1MA 1HAGE 1O3CA 1C9PA
chains in the Genus database with same CATH superfamily
2Z9LA 3DHKH 4GAWA 1FI8A 1YLNA 2VWNA 4Q7YA 1XUGA 1P3CA 1AWHB 3RXOA 3F68H 4SGBE 3U28C 1GBLA 2BDBA 4F4OC 2JJ1D 3KQEA 4YESB 1Z6EA 1CHOG 5KEDA 1EKBB 1GHVH 4ABAA 2A5IA 3T28A 2XTTB 2CHAC 2FDAA 2WHXA 1JRTA 1VITG 5LGOA 3LGYA 4O03A 3U98H 2J98B 3RM0H 4NWLA 1T8LA 1QNJA 2P93A 5ETXA 3RXBA 1SOZA 4JYVH 1BDAA 1CVWH 3A8DA 2HRVA 3BTHE 3BTFE 4TWWA 2CN0H 2WPMS 3MH4A 9ESTA 2WPIS 1RJXB 5HMAA 1O2YA 2BLVA 3UOUA 3WY8A 5B6OA 1S6HA 2R0KA 4PROA 2LP6A 4TY7A 3B8JA 3TK6A 3LGIA 1XMNB 2Z9GA 2BDIA 1TRYA 3DSPA 1O3KA 2ANKH 3ZIAD 1GJDB 5JB8S 1SR5C 2QY0B 1SB1H 5F8TA 2C8YB 5E2PA 1NC6A 3L33A 2LNCA 1TNJA 1V2LT 2XXLA 2ZGJA 5AFZH 1O32A 1D4PB 3LPRA 1EASA 1QQ4A 2FI3E 4MNXA 3BSQA 3RP2A 4OS6A 1J9CH 3IITA 1GI9B 1VJ9U 2FIRH 1KXFA 4CHAC 4HZHA 1OOKB 1FN8A 4OS4A 4YOGA 1C1VH 2O8TA 3H7OA 1WQVH 1XUJA 4HGCA 3SI3H 2HNTE 4JZIA 2Z3CA 3MNSA 1GJ7B 3TNSA 1BJUA 1ZPCA 4FUIA 1GG6C 1O35A 3V12A 1AGJA 3U1IB 1P2MA 1QBVH 2C3SA 3IG6B 1MZAA 3TK5A 3GDVA 4THNH 1IQLA 2BY9X 2QIQA 1LHEH 3F9FA 5DKMA 4YT7H 2BD4A 2A7HA 2VWLA 2BY7X 4NZQA 5JBCS 3HGNA 1O36A 5EOKA 1BMNH 1VJAU 3KF2A 2DUCA 4KELA 4XD7D 1EZQA 7GCHF 2A31A 1DS2E 1HJ8A 2BQWB 1UTJA 1GJ6A 1A5IA 2VVCA 1HAVA 1SSXA 2ZA5A 5EJ1A 3TGJE 1QY6A 3A80A 2QYIA 5TCAA 2GT7A 1Z71A 3V13A 2VIOA 3Q00A 4I33A 1DLEA 3OFND 1C2MA 3RMMH 1EJNA 2VNTA 1PYTD 3KQBA 1GMHF 3RXEA 1SGEE 2XYAA 2JJ2D 4X6OA 4X1RU 4JZDH 3UR6A 1C5LH 2V35A 3LKWA 3DSOA 2QXHA 7GCHG 2PUXB 1OWKA 1FPCH 1KLIH 2FOMB 2XNIA 1AD8H 2VGCB 1EOJA 1C5UA 1CGJE 3LDXH 3GICB 4H42U 1GBMA 1DXPA 3RXJA 1NY22 1W7XH 3RXSA 5ABWA 1AN1E 2I6SA 4ABFA 1GI0A 2TIOA 1P2IA 1GMHG 1G3DA 4GHTA 3QLPH 1CHGA 1AVXA 1C5ZB 3U8RH 4NIWA 1Z8RA 1YPKH 1HXFH 3TJUA 1P2NA 2BXUH 4OGYA 4DCDA 1ANCA 1LTOA 3QDZB 3R3GB 1Y3XA 5JBTA 1AE8H 1O5EH 1Z1IA 3LC5A 1P12E 1O3PB 2Z9IA 5DP8A 2G4TA 2W26A 4H6TA 1TAWA 1P57B 4TY6A 2XCNA 1HAYB 4ZKNU 2FS8A 1FPHH 2EI6A 3BTME 1YM0A 5C5NA 3QO6A 1C5XB 3A85A 3E0PB 1A3EH 3RLWH 2B8OH 1TYNA 2RDLA 2ZDMA 2ZNKH 1O3DA 1SLUB 2ZFSA 4IN2A 2ZDNA 4RT0A 1S81A 2W6JD 2Q6GA 1PQ8A 3ITIA 4MPXA 1YY3A 2VVUA 1QL9A 1Y59T 3U9AH 1GCDA 1NFWA 3M7TA 1O2LA 1LQDB 2BZAA 1LHCH 2QAAA 5PTPA 1XUKA 4ISLA 1XVMA 3RXMA 5C17A 1ELFA 1F2SE 1MMJN 1B5GH 1O2HA 3UR9A 1SGFG 1BOQA 4AFQA 1BMAA 1H8ED 3QGNB 4ISOA 4ZHAA 2AFQB 2PKSC 2W5EA 3WW7A 3T29A 3TVJB 4B71A 1YC0A 1RTFB 5ESBA 1WUNH 1W0YH 2BXTH 1GI1A 2VGCC 3HATH 2TGPZ 3H5CB 4AGJA 1L4ZA 1SFQB 2C8ZB 1O2JA 2UUJB 4AFSA 4Z0KA 1H1BA 2HGTH 3F1SB 1H9HE 2FLBH 1ESTA 3BIUH 2OC1A 2VIWA 4KP0A 1K1LA 1HAZB 4Q4LA 4AOQA 5DP7A 2KCOA 2F43B 3ZVBA 4UDWH 1PFXC 1W8BH 2ZTXA 3DA9B 1F0SA 2VVVA 1AY6H 4INLA 1O5DH 6LPRA 2PGBB 1MD7A 2ZGCA 1TX7A 2FS9A 4K1TA 1O2NA 3ZZ4A 1EAXA 2D8WA 3ZV8A 1W2KH 3QUMP 5B6LA 1AZ8A 1GJ8B 1FLEE 1N8OB 5DPAA 2IJD1 1SVPA 4FXGH 1RIWC 1C5YB 4ABEA 5GJ4B 3I77A 2LELA 2Y5HA 2VINA 1GJ4H 2HPQH 2KX4A 4DGJA 1QURH 1TFXA 3F2FA 1TGSZ 3FAOA 1E1RD 4FUGA 2GCHF 4J2YB 2BYAX 2HALA 4RKJB 3BG8A 4ZHMU 1D3QB 1K1NA 1EB2A 5EXMA 1BBRK 2FEQH 4LK4A 3MYWA 3ZZ3A 2NWNA 2ZQ2A 1Z8GA 3FANA 2EA3A 3NUMA 1XKAC 2B0FA 1BT7A 4E05H 1INCA 1H9IE 1BITA 2JH0D 3F2GA 4AYVB 1TPOA 1TWXB 1DWCH 1NESE 1GPZA 4WWYA 4WMFA 5F8XA 1QB6A 3PO1C 3E90B 2ZKSA 2CJIA 3NRLA 4M9FA 4TT3D 1YYY1 3MWIU 4NCYA 2H5DA 2B5TB 1GVLA 1F7ZA 1GBIA 1Z8IB 4NSVA 2YNBA 1COWD 4VGCB 2ZF0H 2D2DA 4RSPA 4DT4A 3ZVFA 1O2SA 3Q77A 2A32A 3BTQE 3I78A 2A4GA 1SFIA 3UREA 1FJSA 3WWBA 2F9PA 4CBNA 1GCTC 1SKYE 6GCHF 3ESTA 3FKSD 4X6PA 3GY7A 4U30A 2FTLE 1V2UT 2NU3E 5C1XA 2H9EH 5EODA 1JXPA 2PWXA 3E0NB 2HNTC 3GDUA 5EGMA 4I8LA 1UO6A 2R0LA 4MPUA 1G2LA 3STIA 2J92A 1OWIA 1XXFA 4A7IB 2ZPSA 3GCHC 1YCPM 1AO5A 1PPBH 4I32A 3P70B 2D26C 3ATIA 3SORA 3TNTA 1A0HB 4Q7XA 5C1YA 1W0JD 2VJ1A 2ZDLA 2V3HH 3S9AA 2QV1A 4OM9A 1LDTT 1TRMA 5DK1A 1OYTH 2CGAA 4ZUHA 3ZZBA 1C4V2 2DE9A 3TGIE 3RU4E 2GZ9A 1K0HA 2FODA 2ZEBA 1FN6A 3SJ8A 3E3TA 4HFPB 2A2QH 1FAKH 4SGAE 2AMQA 3TITA 1PQ5A 4X1QU 2GDDA 3M37A 3BTGE 1MD8A 3MO6A 4X8TH 1FY5A 2WPDD 4BTIB 4UFGH 4WJG2 5DGJA 1GDQA 2ZECA 1QRXA 1TX6A 4MG3A 1O39A 1DUEA 2ZG0H 3SV9A 2WZQA 1TMUH 1MTVA 2NU4E 4D76A 1S82A 1SBWA 1KTSB 3SU1A 4X2YA 1TNKA 2GD4B 1OP2A 3VG8A 1EPTC 1O2ZA 3LGWA 4Z6AH 1MQ6A 1WQSA 1KMHB 2WV9A 1NT1A 3RXAA 1H9LB 1MTUA 1SC8U 1MU8B 3KYGA 2Q6DA 3D49H 2BOKA 2DE8A 3M3SA 3D23A 4NIVA 3DT0H 4E7NA 1O5BB 1UW7A 3F9GA 1ELBA 3PLPA 2ZHWH 4K60A 3M36A 1F5KU 1C1OA 2FOGA 4I8JA 3O8RA 2R2MB 3P8FA 1FUJA 3SJ9A 2EC9H 1C1NA 1DDJA 4XBCA 1GBHA 2RCEA 1CU1A 3PMBB 3KIDU 2FYQA 2J9NA 3OTPA 1UJ1A 4OS5A 1DY8A 1F5LA 4ZXYH 1MBQA 4BAQB 4MNWA 5C94A 1A46H 1NRRH 1ELTA 2G5NA 2TGAA 2CMYA 3LU9B 2IOTA 3VFEA 4I8GA 1GL1A 6CHAC 1AFQC 3A87A 4CRFA 1C5WB 1PJPA 4MTBA 2D1JA 3A86A 1OWHA 1OSSA 1MABB 4WH8A 1ID5H 3KN2A 1ANDA 1SPJA 1O3HA 2BOHB 2SGFE 2FXRA 5FX5A 3F2HA 5I25A 2CHAB 5C0TA 4HI3A 5F6MA 1C1TA 3O8DA 2BD3A 1UCYK 4IC6A 4X8VH 4WF8A 2Z9JA 5AF9H 3MNCA 4XE4A 4K3JA 3BTEE 1WU1A 4CH2B 3ZZDA 7ESTE 1ZTLA 2G81E 3HKJB 1TOMH 1LVOA 1ZJKA 3ATLA 4MVNA 4CR9A 1LPGB 1NTPA 1O3OA 3DSGA 2ZTZA 1XX9A 1SGIB 3HPTB 5JPMH 2FI4E 3SHAH 2K8IA 2JH5D 4DURA 2QF3A 4MLFB 1HFDA 1LPZB 1TALA 3PROA 1EOLA 1YLDA 1C1PA 1W3CA 4D7GA 1ARCA 1MCVA 3MU4A 2Z9KA 3L3TA 3M35A 1LHFH 1J14A 1L1GA 4ESTE 5DP6A 4CRDA 2PKAB 1YPMH 3M61U 4DY7B 2H9HA 1ZHPA 4AYYB 3RMOH 1TRNA 1LKAA 1ZMJA 1G3BA 1UTMA 2VIVA 1O2XA 3RM2H 2AGEX 4JCNA 5LPFA 1ZPBA 2VIQA 1TMBH 2F4LA 3MH7A 1M9UA 1VITF 3SQEE 3OAAD 1GG6B 1SGQE 2WUCA 1W7GH 4RN6A 3UY9A 5A8ZA 2ZPRA 1C2DA 4NFFA 1C5MD 3UQOA 1O3NA 2OBQA 4X6MA 4NA9H 1DPOA 3OX7U 5TCCA 1WAYB 1HAXB 1GJBB 3SBKA 1TGCA 1TQ7B 1GI6A 2A1DB 4XRNA 5AFYH 4OS7A 4I8KA 2BDCA 3ZVEA 1WSSH 1Y3VA 3C27B 4OS2A 1C5QA 2XRCA 4UD9H 1C5NH 4YO9A 1P2OA 1TBQH 3BTTE 5DP9A 1SMFE 1TE0A 1XUIA 2A45B 3TJVA 5AVDA 3EAJA 1SI5H 2ALVA 3PV5A 4LOYH 5HM2A 3WWFA 2ESTE 4BAMB 1EJAA 3DFLA 2BY8X 1O3LA 3RXGA 3FP6E 2IN2A 4MDSA 2ZCHP 1C1QA 1ELEE 1JIRA 2SGAA 4GHQA 1KSNA 1DUAA 4ZXXH 3BTWE 1QHRB 1LQEA 1CSOE 2IPQX 5L2ZH 1EZUC 3RC4A 5E0GA 5EPYA 3A8AA 2PP6A 2J2UA 3PM3A 1A1RA 1PYTC 4FUEA 3LH1A 1MTSA 3ZZCA 2F9NA 4WVPE 1GGDB 3UFAA 4B2CA 2AMDA 4B73A 1QRZA 4FU9A 1DY9A 1MKWK 1FY1A 1SLXB 1C2KA 1GI7B 1NPMA 3EA8A 2AH4X 1BBRE 1BRCE 1Z6JH 3ZZ8A 2XBWA 1V2NT 1T8OA 1G9IE 1QIXB 3FZDA 3UNRA 1C5PA 1TPAE 3H7TA 1ZPZA 1ZTJA 5EPNA 5T3HA 3VB3A 3TH4H 1H8IH 4X2VA 1SGDE 1HV7A 1P03A 1JRSA 1OX1A 1JMOH 5EQRA 5A0CA 2WYGA 4DJZB 2ANYA 4FVDA 3KQDA 3W95A 1HYLA 1S6LA 2SGQE 4AFZA 2ZPQA 5HIZA 1LO6A 1TPPA 4ABGA 4K8YA 5GIBA 2BZ6H 3RXQA 3KEEA 2FLRH 2PW8H 1JOUB 3RMLH 3BEIB 1O3GA 4NSYA 5GXPA 1THSH 2OP9A 2WPHS 2FX6A 5A8XA 2OQ5A 1UTKA 8KME2 2WYJA 4ABIA 3GDSA 2WSSD 5HM9A 4GVUA 3AVZA 1CT0E 1GI3A 1AWFH 3RXFA 3PWCA 4B6EA 2HVYB 1L1JA 1UVPA 3V0XA 1TMTH 2FOHA 1Y3WA 5DP3A 1N6XA 1HPGA 1V6DA 2WV4A 1A5HA 3U8OH 3ZZ5A 1O2GH 1OXGA 2P59A 1BRUP 4ABHA 1RRKA 2BDGA 3RXIA 3M7UA 1O5CB 3ZZ7A 1E34B 2PKSB 1JBUH 5KECA 3SUEA 2ZDKA 3AASA 4I7YH 3SU5A 2BD5A 3OSYA 2BDAA 1GGDC 3F3BA 1QCPA 1WV7H 3MO9A 1B0FA 2ZHDA 2ZU4A 3DD2H 4FUCA 1DICA 1THPB 1PPGE 1Z8JB 3TPIZ 3TH3H 1KLTA 2R3UA 3GYLB 1GJCB 3KHVA 1FMGA 1SLWB 2BLQA 1O3BA 3LT3A 4YXWD 1DANH 3GS9A 1HRTH 3NK8A 1G3EA 1LHGH 1Y5AT 5AHGH 1KXAA 2R2WU 1ZHMA 1HAOH 1W12U 2KFWA 2H2ZA 5FHTA 1BTPA 3SU6A 1K28D 2SGDE 1KTTB 1QQUA 5HXFA 2VBCA 2QF5A 4FOUC 1BQYA 5A2MH 3KNXA 1GI2A 4AFUA 2G00A 1U6QA 1TA2A 1HAVB 3AAUA 5DO4H 3PMHB 4Y8ZA 1ZMLA 1WOFA 3R0FA 3T62A 1A61H 1RIWB 3A7VA 2FESH 1FV9A 4X8UH 3RU4D 1KXBA 1O33A 1XXDA 3P92A 2KAIA 4KTSA 1DXWA 3ZVAA 1P01A 2A5KA 5EG4A 1G2MA 1SLVB 1J15A 1BMMH 1KIGH 1GBTA 2ZFFH 1GHXH 2BQ6B 1Z7KA 4ZAEA 1ELCA 5K0HA 1V2ST 1CO7E 2VU8E 1F0TA 4IGDA 2FWWA 1LPKB 3SU3A 3E8LA 4XDEA 1AKSA 2QC2A 1TONA 1UMAH 2ZHQH 1MUEB 4ZROA 1OWDA 2ZQ1A 1NU7B 1O34A 1PQ7A 1ZGVA 1GDUA 1V2TT 3VXEH 2A4QA 4DT7B 2GCTC 1C9TA 2G51A 2OLGA 3P6ZB 4WXIA 3V7TA 1CBWC 1BA8B 4BTUB 7KMEH 3SOSA 3BTKE 4TPIZ 4WY3A 4WH6A 1P06A 1BHXB 3UB0A 5FAHA 2SNVA 2OXSA 3IWMA 3SU2A 3KQ5A 3PO1B 1OP8A 4FUHA 5C1UA 3VB6A 1OWJA 2BVRH 4KKDA 3OTJE 5TJXA 1GBEA 1BIOA 2J5UA 1A5GH 1SGRE 1W13U 2CF9H 5T1VA 4E06H 4ABDA 4F55A 3ZYDA 1IHTH 1QBOA 4KGAA 4O9VA 3P8GA 1FXYA 3TJNA 4X8SH 1GJ9B 4BNRA 3VEQB 5BPEA 5E2OA 1A0LA 1SHYA 3FVFB 1TOCB 1GCTB 2HWLB 5F8ZA 3ZZAA 3BF6H 4QT8C 1SQAA 2BD8A 3UWIA 1AUJA 1LKBA 2KAIB 1ELVA 1OS8A 3LOXA 1CQQA 2ANWA 1EB1H 1EXFA 2YMSC 1EPTA 3LJOA 1DSTA 4GCHG 4YOJA 1YCPH 1GHBG 1UCYE 1C1UH 3MH6A 2J95A 1O3FA 1VCQA 2F3CE 5FL7D 1QA7A 3K6ZA 2WV5A 3OEHD 5JDUB 3CP7A 2KCPA 4HG6A 3DCLA 3NZIA 3GCHB 1KXEA 1A3BH 1MCTA 2H9TH 4YLUA 1C5OH 1CE5A 1NFYA 4XBDA 3U1JB 4LZ1H 2ZGBH 2EY4C 2Y7XA 4Y8YA 1IQGA 2AYWA 2ZFPH 1P02A 1PPCE 1NS3A 1DSUA 2L6OA 4D7FA 1V2VT 4Y76A 2PHBA 1MAYA 1UK4A 1P2KA 4AC9A 5FPTA 1MZDA 1PPEE 3SUFA 1O2QA 1WYKA 1Z1JA 2ULLA 4B2AA 1CGHA 3MU5A 1ZMNA 5K7RA 4K2YA 3MQKC 1NRQH 1W11U 5DJ7A 3M5OA 4CH8B 3D62A 1O38A 1W10U 3MU1A 4TYDA 1RD3B 1TBZH 3RXKA 1DFPA 5FBEA 3HK6B 1O5FH 2GDEH 1CA0B 3RMNH 4AN7A 5LH8A 1NU9A 1T8MA 3RXDA 5E0JA 3E16B 4FETA 1E79D 2ZWLH 1WTHD 1BRBE 2KZ4A 1BMFD 2QE7D 3W94A 1EPTB 1O3AA 4DIHH 2FOFA 2BLWA 3A7TA 1T31A 1XVOA 2YMSD 4BANB 2C8WB 1GBFA 2AERH 1SG8B 3VPKA 2V6NA 4A1VA 1P0SH 4JZFH 2UWPA 2J34A 2PV9B 2Q1JA 1GBAA 2QF4A 5T6DA 1S84A 1MTNC 1OYQA 2PUQH 3AW0A 1QJ6B 2SNWA 5E0HA 1ETSH 1UTOA 5DP5A 2WUBA 1EP6A 3TLOA 1QFKH 2YOLA 2ODYB 1O3EA 4BXSA 3ATWA 4CRBA 4FUJA 3S69A 1HUTH 1C5SA 7LPRA 1EAIA 2H1UA 2C4FH 4Y6DA 2XC0A 1NZQH 1UVOA 4CRCA 1HAPH 2ZZUH 5EJZA 1Y8TA 2FYRA 6CHAB 2BDHA 1AFQB 2M2AA 4ISIH 5H4IB 1ETRH 2OBOA 4DVAU 3S9BA 2A4RA 3PMAB 2NU1E 1O2KA 3LH3A 1XUHA 2GMTB 3OEED 3OU0A 5CMXH 4I8HA 2Z7FE 2Q6FA 1EUFA 1C2EA 2BVXH 1MKXK 4Y11E 3PYHA 1KY9A 1Y3UA 3I29A 4B76A 1HDTH 1AI8H 2TGDA 2ZFRH 4F49A 4YZUA 1WDIA 4M7GA 2A5AA 3A89A 4Y7AA 4ZKSU 2L74A 1ZGIA 1IQHA 1NM6A 2P95A 3QTOH 1HCGA 1CA0C 4JMYA 3SV8A 4P00A 1ZZZA 1L0ZA 3PRDA 3ODDA 4B75A 5E8EH 1O5AB 1PPHE 4YTAA 3SNAA 5CE1A 3NXPA 4DOQA 2BM2A 1TGNA 3BTDE 4AB8A 1EX3A 3RDZA 3KYFA 4YT6H 5A8YA 4ASUD 3UWJH 2Y81A 1QTFA 2FPZA 1WCZA 4ISNA 4AB9A 1BMLA 2WPKS 2V3OH 1GVZA 3SN8A 1SL3A 4X2WA 2JKHA 1IOEA 5ESTE 3RXUA 5FPYA 1ZR0A 1HIAA 3ZZ9A 3U8TH 2RDEA 4Y79A 3DUXH 5C5OA 1O2WA 3F6UH 2XBYA 3A8CA 3EA9A 4NIXA 1CA8B 3OY6U 3S7KB 2P3FH 1TNLA 4O3TA 2BY5X 4MNYA 5J4QA 1PQAA 2QA9E 2R9PA 4UONA 2F9BH 1EZXC 2OTVA 2BHGA 1VR1H 5FX6A 4TWYA 3A84A 2QXIA 3PV2A 1EAUA 1QGFA 4IMQA 1JIMA 3EA7A 1W14U 3VGCC 3MMGA 5EW2H 1GBJA 2BX4A 4IN1A 5EW1H 2ZCLP 1T7CA 4Q2KA 1SGCA 2GJGA 3B23B 1Q31A 1C1SA 4UFFH 4XSKU 2GMTC 4JK6A 1EQ9A 1F0RA 3MU8A 2GVFA 3S7HB 1A7SA 2XWAA 3S0NA 3BEUA 3JZ2B 3GYMA 1SGNE 5J4SA 1KDQA 1EJMA 3A83A 1OP0A 1GHAG 2Y82A 1K9OE 4Q80A 2UWOA 2F83A 1C5RA 1GHWH 4AG1A 1GMCF 1K1IA 3QTVH 1THRH 1W0KD 1VGCB 3QN7A 5BRRE 1BTWA 4A1XA 1YP9A 1ZOMA 5F03A 1HIAB 2OC7A 1B0EA 1UVSH 1E0FD 3BN9A 4NGAH 2OC0A 3FOAA 2TGTA 1NRNH 1ZLRA 2P94A 3GY3A 1GI8B 1KXDA 4GLYA 2WPJS 2ZGHA 4X1NU 1DX5M 1E36B 2QXJA 3UPEA 1KXCA 2SFAA 4GUXA 3PLBA 3F0OA 1GMCG 2PSXA 4LXBH 1C2LA 2EEKA 3EGKH 1TIOA 4Y0ZE 1GBKA 2STAE 1YPEH 1UHBA 5EXLA 5EQSA 2BVSH 1ARBA 2BB4A 1J17T 1TA6A 2GGVB 3G01A 5F53A 2ZHEH 3QGJA 1A2CH 2ZCKP 3ZZ6A 5L30H 3ODFA 2XW9A 4HTCH 1YPHE 1TABE 4U32A 1HBTH 1DLKB 4ABBA 1O2TA 2GZ7A 5G4BA 3SNDA 4NWKA 3RXTA 2V7QD 2ODPA 4O3UA 1UVUH 4ZH8A 2HLDD 1CT4E 3STJA 2FOCA 2FTMA 2Y5FA 4YLQH 1ZTKA 3GISB 5C3NA 4LZ4B 3GY6A 1K1PA 1LCYA 1NN6A 1KDQB 3PTBA 3A82A 1TNGA 4UFEH 1O37A 3UAIC 1OPHB 1MAXA 3OYPA 4ABJA 1L2EA 2GV6A 3SV6A 2RFKC 1GI5A 1N6YA 1TNHA 3PV4A 5T6GA 1SQRA 3EYDA 2TPIZ 1ELDE 1Y5BT 3ZYEA 1QB1A 3Q3XA 2QF0A 5JYIA 2F9UA 1TX8A 2A2XH 1FAXA 4BXWA 2PR3A 1DOJA 3CENA 2GV7A 1EATA 1IAUA 1UTLM 1RXPA 1AU8A 2FI5E 3F9EA 1NBME 3SJOA 1DWEH 3F9HA 3TK9A 2OCVB 5GDSH 1QZ8A 1FY8E 3M3VA 4WMEA 2FO9A 3D65E 1VGCC 3L6PA 2J94A 4UFDH 1G37A 1TLDA 1O2RA 3VB4A 1UHBB 1P05A 4BAKB 4YM9A 1UTPA 1IQKA 3BG4C 3QZQA 1V2QT 5C67A 4ACBA 3V3MA 2HOBA 4B2BA 2ZDAH 5EXNA 3URDA 8GCHF 3P8NA 3A7ZA 1AQ7A 4IBLH 2CF8H 1AZZA 1TBRH 3RXLA 3U69H 2GTBA 3MOCA 4AG2A 2FMJA 4A1TA 5LPRA 4J1YA 2W6ID 4CR5A 3T5FH 1ZJDA 1O2PA 2BMGB 2XC4A 3Q3KA 1AB9C 4Q7ZA 1NRPH 1HGTH 2BQ7B 2FOBA 1HAHH 3UNQA 1MH0A 3MU0A 1Y5UT 4F48B 4INHA 2G5VA 4A5TS 8GCHG 1TQ0B 4BAOB 2P3UB 3PTNA 2FP7B 3TU7H 1S5SA 2P3TB 2Z94A 5FBIA 2AGGX 4XFQA 1ABJH 2Y80A 4P02A 4K1EA 3EE7A 1UTQA 1QRWA 3UUZA 3M7QA 4Z1MD 1WTGH 2VWOA 3JZ1B 1ANBA 1D6WA 1AMHA 1VKYA 1AIXH 1CGIE 1GVKB 3SU0A 1ZYOA 2AIPA 1GBDA 1L4DA 1V2MT 2W7UA 3GY4A 1K22H 3TIUA 3MH5A 2EQNA 1DWBH 3RXCA 3PMJA 1BBRH 2Z3DA 1YPGH 3SGQE 1RFNA 1C2GA 1DE7H 2QCYA 4H4FA 1D3DB 1K1OA 1GI4A 2THFB 2PSYA 2UUKB 1HNEE 2A7CA 4MQAA 2GCTB 1BZXE 1GBCA 4GSOA 1MBMA 3TJOA 4RI0A 2J97A 1CBWB 4R8TB 3RXVA 1YBWA 2J4IA 1B7XB 1WBGB 2TRMA 3UOPA 1ESAA 4JZ1A 2AS9A 1S0QA 3K2UA 1E38B 2FOEA 1FQ3A 2ODQA 2ZHFH 1SHHB 1C4Y2 1DT2A 4X1SU 1C5VA 5DN6D 2Y5GA 1IQFA 3RC5A 1BTXA 3BEFB 5HKKD 4Y10E 3NKKA 2PTNA 5IK2D 2GP9B 1SGFA 2WPLS 4NFEA 2GT8A 1KLJH 3MFJA 2HVXA 1W0ZU 1E37B 2ZTYA 1FNIA 3TGKE 4K69A 3ATMA 1C1RA 1SGTA 2XWBI 1RTLA 1MU6B 1MTWA 4AZ2B 1C2HA 1QA0A 1BCUH 3B9FH 5JBAS 4U2WA 2R3YA 2YMSB 3QWCH 4E7RG 1SQOA 3LGUA 4ASHA 1NROH 2ILNA 3FN8A 1GHYH 1ELGA 3M3TA 2PFEA 2Z3EA 3SO3A 1Y3YA 3ZVGA 4GPGA 2CK3D 2PTCE 4DG4A 1BJVA 2VIDA 1UTNA 4CRGA 1O0DH 1ACBE 1BTUA 1OWEA 4TSFD 1C2FA 5GWZA 3AAVA 3QZRA 1ESBA 2JIZD 2LPRA 3GY8A 4RKOB 1GMDF 3SGAE 4FUBA 2GX4A 3C1KA 1C4U2 1BHXF 2XBVA 1P04A 4I86A 4B6FA 1MKXH 3M5NA 2VB0A 1ZSKA 2F9OA 3VB7A 1TGBA 1AE5A 2ALPA 1CT2E 1UK3A 3LGVA 3NWUA 2VH6A 1O3IA 3GY2A 1QJ7B 2B7DH 3A81A 1AHTH 1GJAB 1LMWB 5C0UA 3SI4H 3ZVCA 5HYOA 3ATKA 3T25A 1YLCA 5L6NH 3BIVH 2V3MA 4MPVA 1GL0E 1T4UH 3SJKA 3UTUH 1EZSC 3SHCH 1ZRKA 1O2VA 1AVWA 1GMDG 2BX3A 4K5ZA 5IYTA 1H4WA 2XCFA 2ZFTA 4GCHF 1RS0A 1GHBF 4NG9H 2YNAA 2NU2E 1ANEA 2UWLA 2BD9A 1OKXA 2A4OA 4KTCA 2BLOA 1QR3E 1J16A 1V2OT 5HGGA 2FZZA 2HNTF 2PGQB 1SOTA 4CRAA 4FUDA 1MTNB 1P10A 2M5TA 2OQUA 1G32B 1DITH 1YPHC 3A7XA 1D6RA 3SZNA 3KL6A 1SGYE 2G8TA 1IQEA 4TPYA 1AKSB 6ESTA 3ENSB 5HIYA 1O2UA 1FZZA 1UVTH 1XM1A 3A8BA 3P8OA 1O31A 1FDPA 5JBBS 5EJLA 1XUFA 4NA7A 4NZLA 2NU0E 3RUOA 1JWTA 3HGPA 3URCA 3E1XB 1BTYA 2QXGA 2XBXA 3GCNA 3KQCA 1NO9H 4AORA 1TNIA 2ZU1A 4O97A 2ZIQH 3N7DA 5GNDA 1A0JA 1HJAB 4IW4E 1Q3XA 3P95A 3K65B 3K6YA 4H6SB 2ZDVH 3LGTA 1GDNA 4WMDA 1NRSH 3W1EA 5SGAE 2Y6TA 4A92A 3SNEA 2FM2A 4DIIH 1DM4B 4R0IA 3PB1E 4NA8A 3SNCA 1HLTH 2B9LA 3LONA 2P16A 1HAIH 2O9QA 2KCAA 2OC8A 3MO3A 3Q76A 3LC3A 1UCYH 2ZC9H 3A88A 2PLXA 1FIWA 3P17H 1O5GH 1QL7A 1S83A 4ZKOU 2ASUB 4OGXA 2K0QA 1VCWA 2SGEE 2Y7ZA 1V2RT 1K2I1 2TBSA 4FU7A 2GZ8A 3GOVB 2QGRA 4NIYA 1TGTA 2VH0A 3SUGA 5A0AE 2O8LA 2H5CA 1V2KT 2W7SA 2GCHG 1ORFA 4ACAA 1S6FA 5DG6A 8ESTE 5LPEA 3ZVDA 4MPWA 1D3TB 1P3EA 5IDKA 1O3JA 1S85A 4Y0YE 1O2MA 4OS1A 3A7YA 4AX9H 2IJOB 3NPSA 2SGPE 4KTUA 2AHME 4YOIA 5A0BA 2CXVA 3OY5U 2VIPA 4JYUH 4Q63A 1QBNA 3CNRA 2BTCE 3E91A 5FXLA 3SW2B 4I31A 4WXVA 1VCPA 2AMPA 3SJIA 3K9XB 1Q2WA 3GCTF 2JETB 3PLKA 2ZGXH 1F0UA 4FUFA 3N99A 2ZFQH 2KR7A 1H8HD 1G3CA 2UUFB 3BV9B 2ZU2A 3SNBA 2K1QA 1AUTC 1GHZA 1J8AA 1SGPE 1YPLH 1N8OC 1O2IA 4UEHH 2F91A 1C1WH 3M5MA 1HJAC 1NBMD 2O8WA 3VGCB 3MTYA 5DSFA 2I6QA 3SQHE 3HKIB 4X0WU 2FX4A 2UUYA 4BAHB 1N1LA 4JYTA 3GCTG 3FO8D 3HK3B 6GCHG 5T6FA 5CHAB 2WINI 1IHSH 3EQ0H 5EU8A 1G36A 1S0RA 2CV3A 2KCYA 3SU4A 1ZHRA 1GJ5H 2G52A 2OK5A 5C20A 1QB9A 4B1TA 4CBOA 2A7JA 1TB6H 1P2JA 2OINA 3RLYH 1ZSJA 1E35B 1HXEH 1V2JT 3N7OA 4MNVA 2RA3A 1UK2A 1K1MA 4A6LA 3O8BA 1BUIA 5FPSA 2OUAA 4ZMAH 1P9UA 1BTHH 3AW1A 4UE7H 1RGQA 1BRAA 1F92A 1A4WH 3RXRA 1P2QA 3KCGH 2GKVE 3EE0B 4JZEH 3UNSA 2AGIX 1EP5A 3PWBA 2Z6BD 1D3PB 1ZRBA 1MKWH 2QN5T 3RC6A 2P8OB 4D8NA 2C90B 1PPZA 5A09A 1FIZA 3SV7A 1FONA 1O3MA 1VITH 4ISHH 3ZV9A 3PRBA 4VGCC 3FFGA 1K1JA 1HB0B 1QL8A 1IQMA 3CS7A 2XNDD 1QJ1B 2F9VA 4AGKA 1D9IA 2JETC 3SYJA 1E1QD 3FP7E 3RU4T 5GPIB 4X2XA 2AIQA 1EFRD 5KGOA 1C2JA 5DP4A 2AEIH 3DFJA 1GHAF 3VXFH 2J38A 3OE7D 5FCRA 3KGPA 1YCPK 4INKA 3MNXA 4D9RA 1GBBA 2XC5A 1P8VC 2STBE 1NFXA 2ZU5A 3UQVA 4DW2U 1P09A 1ETTH 3T27A 3QX5H 4D9QA 2ZO3H 1O2OA 3Q3YA 2BDYA 3NCLA 5GCHF 1EAWA 4K8BA 1G30B 1IQIA 1FX0B 2KM0A 5CHAC 3S9CA 1MQ5A 1H8DH 4Y8XA 1ABIH 2C93B 4Y71A 2C8XB 2PKAA 1AFEH 3ELAH 1P9SA 2A0QB 1OHHD 2RA0A 2G4UA 4Y7BA 1V3XA 1L1NA 4FVBA 1PPFE 1IQJA 1C5TA 1YKTA 4JK5A 2OD3B 2BD7A 1ZSLA 2JH6D 1BB0B 1K21H 1YGCH 1X7AC 5FCKA 5GCHG 2ZU3A 2BY6X 2HPPH 5I46H 1YF4A 4ZHLU 2W3KA 1V2WT 4IS5A 1AVGH 1LVBA 3GCOA 3SUDA 2O8UA 3UIRA 5EQQA 2FOAA 4K1SA 1YPJH 1YWUA 3BG4B 3F0PA 2IPHA 2XOKD 1LVYA 2RG3A 2VWMA 2W3IA 3GY5A 4FU8A 5L2YH 1V2PT 1TPSA 2H6MA 1XKBC 3FP8E 3T26A 1GWAA 1VZQH 3CS0A 3E6PH 4IC5A 2P8OC 1DWDH 4XBBA 4RT1A 3SZEA 4ZCNA 3O8CA 1RTKA 3RXHA 2EI7A 2JDID 3A7WA 2EI8A 1SQTA 1LVMA 3AK5A 2J98A 2G55A 3QK1A 1WXRA 4CREA 1T32A 3SV2H 4XOJA 1T4VH 4ZKRU 1AB9B 4U01A 1DVAH 1LHDH 5JB9S 3MI4A 5EIYA 1P11E 2O8MA 5C2ZA 2BD2A 2HLCA 4X1PU 4IMZA 1IQNA 3H09A 9LPRA 4BOHA 1F5RA 1NFUA 1O30A 3N7EA 5CDFE 4X6NA 3LIWA 3VB5A 1HJ9A 5CHBA 3RXPA 1FY4A 3MHWU 2V0BA 1C2IA 3SGBE 4CHAB 2ZP0H 1CHOF 3T2NA 4BTTB 2ZI2H 1BTZA 1FY3A 3MNBA 8LPRA 4B74A 1T8NA 2ANMH 3M5LA 3FZZA 3LJJA 1KYNA 1ELAA 3TH2H 3EDXB 1C1MA 1HAGE 1O3CA 1C9PA
chains in the Genus database with same CATH topology
2Z9LA 3DHKH 4GAWA 1FI8A 2VWNA 4Q7YA 1XUGA 1P3CA 1AWHB 3RXOA 3F68H 4SGBE 1GBLA 2BDBA 4F4OC 3KQEA 4YESB 1Z6EA 1CHOG 1EKBB 1GHVH 4ABAA 2A5IA 3T28A 2XTTB 2CHAC 2FDAA 1JRTA 1VITG 5LGOA 3LGYA 4O03A 3U98H 3RM0H 4NWLA 1T8LA 1QNJA 2P93A 5ETXA 3RXBA 1SOZA 4JYVH 1BDAA 1CVWH 3A8DA 2HRVA 3BTHE 3BTFE 4TWWA 2CN0H 2WPMS 3MH4A 9ESTA 2WPIS 1RJXB 5HMAA 1O2YA 2BLVA 3UOUA 3WY8A 5B6OA 1S6HA 2R0KA 4PROA 4TY7A 3B8JA 3TK6A 3LGIA 1XMNB 2Z9GA 2BDIA 1TRYA 1O3KA 2ANKH 1GJDB 5JB8S 1SR5C 2QY0B 1SB1H 5F8TA 2C8YB 5E2PA 1NC6A 3L33A 2LNCA 1TNJA 1V2LT 2XXLA 2ZGJA 5AFZH 1O32A 1D4PB 3LPRA 1EASA 1QQ4A 2FI3E 4MNXA 3BSQA 3RP2A 4OS6A 1J9CH 3IITA 1GI9B 1VJ9U 2FIRH 1KXFA 4CHAC 4HZHA 1OOKB 1FN8A 4OS4A 4YOGA 1C1VH 2O8TA 3H7OA 1WQVH 1XUJA 4HGCA 3SI3H 2HNTE 4JZIA 2Z3CA 3MNSA 1GJ7B 3TNSA 1BJUA 1ZPCA 4FUIA 1GG6C 1O35A 3V12A 1AGJA 3U1IB 1P2MA 1QBVH 2C3SA 3IG6B 1MZAA 3TK5A 3GDVA 4THNH 1IQLA 2BY9X 2QIQA 1LHEH 3F9FA 5DKMA 4YT7H 2BD4A 2A7HA 2VWLA 2BY7X 4NZQA 5JBCS 3HGNA 1O36A 5EOKA 1BMNH 1VJAU 3KF2A 2DUCA 4KELA 1EZQA 7GCHF 2A31A 1DS2E 1HJ8A 2BQWB 1UTJA 1GJ6A 1A5IA 2VVCA 1HAVA 1SSXA 2ZA5A 3TGJE 1QY6A 3A80A 2QYIA 5TCAA 2GT7A 1Z71A 3V13A 2VIOA 3Q00A 4I33A 1DLEA 1C2MA 3RMMH 1EJNA 2VNTA 1PYTD 3KQBA 1GMHF 3RXEA 1SGEE 2XYAA 4X6OA 4X1RU 4JZDH 3UR6A 1C5LH 2V35A 3LKWA 2QXHA 7GCHG 2PUXB 1OWKA 1FPCH 1KLIH 2FOMB 2XNIA 1AD8H 2VGCB 1EOJA 1C5UA 1CGJE 3LDXH 3GICB 4H42U 1GBMA 1DXPA 3RXJA 1NY22 1W7XH 3RXSA 5ABWA 1AN1E 2I6SA 4ABFA 1GI0A 2TIOA 1P2IA 1GMHG 1G3DA 4GHTA 3QLPH 1CHGA 1AVXA 1C5ZB 3U8RH 4NIWA 1Z8RA 1YPKH 1HXFH 3TJUA 1P2NA 2BXUH 4OGYA 4DCDA 1ANCA 1LTOA 3QDZB 3R3GB 1Y3XA 5JBTA 1AE8H 1O5EH 1Z1IA 3LC5A 1P12E 1O3PB 2Z9IA 5DP8A 2G4TA 2W26A 4H6TA 1TAWA 1P57B 4TY6A 2XCNA 1HAYB 4ZKNU 2FS8A 1FPHH 2EI6A 3BTME 1YM0A 5C5NA 3QO6A 1C5XB 3A85A 3E0PB 1A3EH 3RLWH 2B8OH 1TYNA 2RDLA 2ZDMA 2ZNKH 1O3DA 1SLUB 2ZFSA 4IN2A 2ZDNA 1S81A 2Q6GA 1PQ8A 3ITIA 4MPXA 2VVUA 1QL9A 1Y59T 3U9AH 1GCDA 1NFWA 3M7TA 1O2LA 1LQDB 2BZAA 1LHCH 2QAAA 5PTPA 1XUKA 4ISLA 1XVMA 3RXMA 1ELFA 1F2SE 1MMJN 1B5GH 1O2HA 3UR9A 1SGFG 1BOQA 4AFQA 1BMAA 3QGNB 4ISOA 4ZHAA 2AFQB 2PKSC 2W5EA 3T29A 3TVJB 4B71A 1YC0A 1RTFB 5ESBA 1WUNH 1W0YH 2BXTH 1GI1A 2VGCC 3HATH 2TGPZ 3H5CB 4AGJA 1L4ZA 1SFQB 2C8ZB 1O2JA 2UUJB 4AFSA 4Z0KA 1H1BA 2HGTH 3F1SB 1H9HE 2FLBH 1ESTA 3BIUH 2OC1A 2VIWA 4KP0A 1K1LA 1HAZB 4AOQA 5DP7A 3ZVBA 4UDWH 1PFXC 1W8BH 2ZTXA 3DA9B 1F0SA 2VVVA 1AY6H 4INLA 1O5DH 6LPRA 2PGBB 1MD7A 2ZGCA 1TX7A 2FS9A 4K1TA 1O2NA 3ZZ4A 1EAXA 2D8WA 3ZV8A 1W2KH 3QUMP 1AZ8A 1GJ8B 1FLEE 1N8OB 5DPAA 1SVPA 4FXGH 1RIWC 1C5YB 4ABEA 5GJ4B 3I77A 2Y5HA 2VINA 1GJ4H 2HPQH 4DGJA 1QURH 1TFXA 1TGSZ 3FAOA 4FUGA 2GCHF 4J2YB 2BYAX 2HALA 4RKJB 3BG8A 4ZHMU 1D3QB 1K1NA 1EB2A 5EXMA 1BBRK 2FEQH 4LK4A 3MYWA 3ZZ3A 2NWNA 2ZQ2A 1Z8GA 3FANA 2EA3A 3NUMA 1XKAC 2B0FA 1BT7A 4E05H 1INCA 1H9IE 1BITA 2JH0D 4AYVB 1TPOA 1TWXB 1DWCH 1NESE 1GPZA 4WWYA 4WMFA 5F8XA 1QB6A 3PO1C 3E90B 2ZKSA 2CJIA 1YYY1 3MWIU 4NCYA 2H5DA 2B5TB 1GVLA 1F7ZA 1GBIA 1Z8IB 4NSVA 2YNBA 4VGCB 2ZF0H 2D2DA 4RSPA 3ZVFA 1O2SA 3Q77A 2A32A 3BTQE 3I78A 2A4GA 1SFIA 3UREA 1FJSA 6GCHF 2F9PA 4CBNA 1GCTC 3ESTA 4X6PA 3GY7A 4U30A 2FTLE 1V2UT 2NU3E 5C1XA 2H9EH 5EODA 1JXPA 2PWXA 3E0NB 2HNTC 3GDUA 5EGMA 4I8LA 1UO6A 2R0LA 4MPUA 1G2LA 3STIA 2J92A 1OWIA 1XXFA 4A7IB 2ZPSA 3GCHC 1AO5A 1PPBH 1YCPM 4I32A 3P70B 2D26C 3ATIA 3SORA 3TNTA 1A0HB 4Q7XA 5C1YA 2VJ1A 2ZDLA 2V3HH 3S9AA 2QV1A 1LDTT 1TRMA 5DK1A 1OYTH 2CGAA 4ZUHA 3ZZBA 1C4V2 2DE9A 3TGIE 3RU4E 2GZ9A 2FODA 2ZEBA 1FN6A 3SJ8A 3E3TA 4HFPB 2A2QH 1FAKH 4SGAE 2AMQA 3TITA 1PQ5A 4X1QU 2GDDA 3M37A 3BTGE 1MD8A 3MO6A 4X8TH 1FY5A 4BTIB 4UFGH 4WJG2 5DGJA 1GDQA 2ZECA 1QRXA 1TX6A 4MG3A 1O39A 1DUEA 2ZG0H 3SV9A 1TMUH 1MTVA 2NU4E 4D76A 1S82A 1SBWA 1KTSB 3SU1A 4X2YA 1TNKA 2GD4B 1OP2A 1EPTC 1O2ZA 3LGWA 4Z6AH 1MQ6A 1WQSA 1NT1A 3RXAA 1H9LB 1MTUA 1SC8U 1MU8B 2Q6DA 3D49H 2BOKA 2DE8A 3M3SA 3D23A 4NIVA 3DT0H 4E7NA 1O5BB 3F9GA 1ELBA 3PLPA 2ZHWH 4K60A 3M36A 1F5KU 1C1OA 2FOGA 4I8JA 3O8RA 2R2MB 3P8FA 1FUJA 3SJ9A 2EC9H 1C1NA 1DDJA 4XBCA 1GBHA 2RCEA 1CU1A 3PMBB 3KIDU 2FYQA 2J9NA 1UJ1A 4OS5A 1DY8A 1F5LA 4ZXYH 1MBQA 4BAQB 4MNWA 1A46H 1NRRH 1ELTA 2G5NA 2TGAA 2CMYA 3LU9B 2IOTA 3VFEA 4I8GA 1GL1A 6CHAC 1AFQC 3A87A 4CRFA 1C5WB 1PJPA 4MTBA 2D1JA 3A86A 1OWHA 1OSSA 4WH8A 1ID5H 3KN2A 1ANDA 1SPJA 1O3HA 2BOHB 2SGFE 2FXRA 5FX5A 5I25A 2CHAB 4HI3A 5F6MA 1C1TA 3O8DA 2BD3A 1UCYK 4IC6A 4X8VH 4WF8A 2Z9JA 5AF9H 3MNCA 4XE4A 4K3JA 3BTEE 1WU1A 4CH2B 3ZZDA 7ESTE 1ZTLA 2G81E 3HKJB 1TOMH 1LVOA 1ZJKA 3ATLA 4MVNA 4CR9A 1LPGB 1NTPA 1O3OA 2ZTZA 1XX9A 1SGIB 3HPTB 5JPMH 2FI4E 3SHAH 2JH5D 4DURA 2QF3A 4MLFB 1HFDA 1LPZB 1TALA 3PROA 1EOLA 1YLDA 1C1PA 1W3CA 4D7GA 1ARCA 1MCVA 3MU4A 2Z9KA 3L3TA 3M35A 1LHFH 1J14A 1L1GA 4ESTE 5DP6A 4CRDA 2PKAB 1YPMH 3M61U 4DY7B 2H9HA 1ZHPA 4AYYB 3RMOH 1TRNA 1LKAA 1ZMJA 1G3BA 1UTMA 2VIVA 1O2XA 3RM2H 2AGEX 4JCNA 5LPFA 1ZPBA 2VIQA 1TMBH 3MH7A 1M9UA 1VITF 3SQEE 1GG6B 1SGQE 2WUCA 1W7GH 4RN6A 3UY9A 5A8ZA 2ZPRA 1C2DA 4NFFA 1C5MD 3UQOA 1O3NA 2OBQA 4X6MA 4NA9H 1DPOA 3OX7U 5TCCA 1WAYB 1HAXB 1GJBB 3SBKA 1TGCA 1TQ7B 1GI6A 2A1DB 5AFYH 4OS7A 4I8KA 2BDCA 3ZVEA 1WSSH 1Y3VA 3C27B 4OS2A 1C5QA 2XRCA 4UD9H 1C5NH 4YO9A 1P2OA 1TBQH 3BTTE 5DP9A 1SMFE 1TE0A 1XUIA 2A45B 3TJVA 5AVDA 3EAJA 1SI5H 2ALVA 4LOYH 5HM2A 2ESTE 4BAMB 1EJAA 3DFLA 2BY8X 1O3LA 3RXGA 3FP6E 2IN2A 4MDSA 2ZCHP 1C1QA 1ELEE 1JIRA 2SGAA 4GHQA 1KSNA 1DUAA 4ZXXH 3BTWE 1QHRB 1LQEA 1CSOE 5L2ZH 1EZUC 3RC4A 5E0GA 5EPYA 3A8AA 2J2UA 3PM3A 1A1RA 1PYTC 4FUEA 3LH1A 1MTSA 3ZZCA 2F9NA 4WVPE 1GGDB 3UFAA 4B2CA 2AMDA 4B73A 1QRZA 4FU9A 1DY9A 1MKWK 1FY1A 1SLXB 1C2KA 1GI7B 1NPMA 3EA8A 2AH4X 1BBRE 1BRCE 1Z6JH 3ZZ8A 2XBWA 1V2NT 1T8OA 1G9IE 1QIXB 3FZDA 3UNRA 1C5PA 1TPAE 3H7TA 1ZPZA 1ZTJA 5EPNA 5T3HA 3VB3A 3TH4H 1H8IH 4X2VA 1SGDE 1HV7A 1P03A 1JRSA 1OX1A 1JMOH 5EQRA 5A0CA 2WYGA 4DJZB 2ANYA 4FVDA 3KQDA 3W95A 1HYLA 2SGQE 4AFZA 2ZPQA 1LO6A 1TPPA 4ABGA 4K8YA 5GIBA 2BZ6H 3RXQA 3KEEA 2FLRH 2PW8H 1JOUB 3RMLH 3BEIB 1O3GA 4NSYA 5GXPA 1THSH 2OP9A 2WPHS 2FX6A 5A8XA 2OQ5A 1UTKA 8KME2 2WYJA 4ABIA 3GDSA 5HM9A 4GVUA 3AVZA 1CT0E 1GI3A 1AWFH 3RXFA 3PWCA 1L1JA 1UVPA 3V0XA 1TMTH 2FOHA 1Y3WA 5DP3A 1N6XA 1HPGA 1V6DA 2WV4A 1A5HA 3U8OH 3ZZ5A 1O2GH 1OXGA 2P59A 1BRUP 4ABHA 1RRKA 2BDGA 3RXIA 3M7UA 1O5CB 3ZZ7A 1E34B 2PKSB 1JBUH 3SUEA 2ZDKA 3AASA 4I7YH 3SU5A 2BD5A 3OSYA 2BDAA 1GGDC 1QCPA 1WV7H 3MO9A 1B0FA 2ZHDA 2ZU4A 3DD2H 4FUCA 1DICA 1THPB 1PPGE 1Z8JB 3TPIZ 3TH3H 1KLTA 2R3UA 3GYLB 1GJCB 3KHVA 1FMGA 1SLWB 2BLQA 1O3BA 3LT3A 1DANH 1HRTH 3NK8A 1G3EA 1LHGH 1Y5AT 5AHGH 1KXAA 2R2WU 1ZHMA 1HAOH 1W12U 2H2ZA 5FHTA 1BTPA 3SU6A 1K28D 2SGDE 1KTTB 1QQUA 5HXFA 1BQYA 5A2MH 3KNXA 1GI2A 4AFUA 2G00A 1U6QA 1TA2A 1HAVB 3AAUA 5DO4H 3PMHB 4Y8ZA 1ZMLA 1WOFA 3R0FA 3T62A 1A61H 1RIWB 3A7VA 2FESH 1FV9A 4X8UH 3RU4D 1KXBA 1O33A 1XXDA 3P92A 2KAIA 4KTSA 1DXWA 3ZVAA 1P01A 2A5KA 5EG4A 1G2MA 1SLVB 1J15A 1BMMH 1KIGH 1GBTA 2ZFFH 1GHXH 2BQ6B 1Z7KA 4ZAEA 1ELCA 5K0HA 1V2ST 1CO7E 2VU8E 1F0TA 4IGDA 2FWWA 1LPKB 3SU3A 3E8LA 4XDEA 1AKSA 2QC2A 1TONA 1UMAH 2ZHQH 1MUEB 4ZROA 1OWDA 2ZQ1A 1NU7B 1O34A 1PQ7A 1ZGVA 1GDUA 1V2TT 3VXEH 2A4QA 4DT7B 2GCTC 1C9TA 2G51A 2OLGA 3P6ZB 4WXIA 3V7TA 1CBWC 1BA8B 4BTUB 7KMEH 3SOSA 3BTKE 4TPIZ 4WY3A 4WH6A 1P06A 1BHXB 5FAHA 2SNVA 2OXSA 3IWMA 3SU2A 3PO1B 1OP8A 4FUHA 5C1UA 3VB6A 1OWJA 2BVRH 4KKDA 3OTJE 5TJXA 1GBEA 1BIOA 1A5GH 1SGRE 1W13U 2CF9H 4E06H 4ABDA 3ZYDA 1IHTH 1QBOA 4KGAA 4O9VA 3P8GA 1FXYA 3TJNA 4X8SH 1GJ9B 4BNRA 3VEQB 5BPEA 5E2OA 1A0LA 1SHYA 3FVFB 1TOCB 1GCTB 2HWLB 5F8ZA 3ZZAA 3BF6H 4QT8C 1SQAA 2BD8A 3UWIA 1AUJA 1LKBA 2KAIB 1ELVA 1OS8A 3LOXA 1CQQA 2ANWA 1EB1H 1EXFA 1EPTA 3LJOA 1DSTA 4GCHG 4YOJA 1YCPH 1GHBG 1UCYE 1C1UH 3MH6A 2J95A 1O3FA 1VCQA 2F3CE 1QA7A 3K6ZA 2WV5A 5JDUB 3CP7A 3NZIA 3GCHB 1KXEA 1A3BH 1MCTA 2H9TH 4YLUA 1C5OH 1CE5A 1NFYA 4XBDA 3U1JB 4LZ1H 2ZGBH 2Y7XA 4Y8YA 1IQGA 2AYWA 2ZFPH 1P02A 1PPCE 1NS3A 1DSUA 4D7FA 1V2VT 4Y76A 2PHBA 1MAYA 1UK4A 1P2KA 5FPTA 1MZDA 1PPEE 3SUFA 1O2QA 1WYKA 1Z1JA