2RE1A

Crystal structure of aspartokinase alpha and beta subunits
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
152
structure length
148
Chain Sequence
AVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQNGTTDFSFTVPRGDYKQTLEILSERQDSIGAASIDGDDTVCKVSAVGLGMRSHVGVAAKIFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHKAFNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of aspartokinase alpha and beta subunits.
rcsb
source organism Neisseria meningitidis mc58
molecule tags Transferase
molecule keywords Aspartokinase, alpha and beta subunits
total genus 34
structure length 148
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
A PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2re1A02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2re1A01
3MAHA 3DHXA 5IT4A 1M0SA 1KS2A 3W7BA 5IS2A 3ENWA 3L7OA 2P9GA 3OBIA 3MTJA 4GO5X 1YBAA 2LQJA 3P96A 3IXQA 3U7JA 2J0WA 1LK5A 2F1FA 5JJBA 4X84A 2J0XA 2P9EA 2RQMA 3OFHA 3AB4B 5T41A 1UJ4A 2ZHOA 4GMKA 1U8SA 3DDNA 2QMWA 3DHWC 2PC6A 3ENVA 1LKZA 2QRRA 3UW1A 1UJ5A 3TUIC 2JHEA 3LUYA 4GO7X 2PA3A 2RE1A 3K5PA 2QMXA 3OFFA 3AAWB 3AB2B 2LVWA 1XTZA 4NMLA 1O8BA 1ZPVA 1LK7A 3HHEA 3OFGA 1PSDA 1YGYA 3MWBA 2H9ZA 3OFEA 3CEDA 1SC6A 4M8LA 4PWUA 4IO1A 3O1LA 3NRBA 3TUZC 3IBWA 3KWMA 5IT0A 2JOQA 3TUJC 2DTJA 1Y7PA 2I9SA 3N0VA 2F8MA 4LUBA 1UJ6A 3S1TA 2NYIA 2MDAA 2DT9A 2QSWA 3DC2A 3ENQA 2CDQA 2FGCA 2RQKA 2P9CA 3LOUA 2KO1A 5FIIA 1RWUA
chains in the Genus database with same CATH superfamily
1Z4UA 1A9NB 3ZZZA 4NXMF 4OV6A 2GVZB 4CO3A 3NCPA 1N33F 4WFZA 5HN0A 5HMWA 2DEIA 5E2QA 4FYYB 2DGUA 3DN9A 3ENWA 4NLOA 3UI3A 1N36F 2HBZB 2ZBCA 4P74A 3CPWR 2XS2A 5KFOA 1BQNB 2W8KA 2A6OA 4NLYA 4QR0A 2KRBA 2JX2A 1QAXA 2V4JB 3EVOA 3FEXB 3GCWP 3I82A 4ZPWR 3DRRA 2AHOB 1NDCA 2R7RA 3QGPA 2IA6A 2YKQA 4O3SA 3PIPQ 1KVJA 4NI2A 2F1FA 5EHHA 4U6PA 2VBZA 3R1LA 5L1LA 3ZNUA 2J9DE 3DU6A 1RT1B 1X4AA 1NPKA 1RAJA 3MR7A 4I64A 4CQ1A 4UY8T 6AT1B 4DSFA 2HVEA 3MPVA 3IR6B 3LALA 4LF7F 4RNMA 4QIEA 3QRRA 2ZHOA 4IRCA 1EETB 1MROA 1U0HB 3FBEA 4XIUA 2DK2A 2Q6BA 2D9PA 2HNZB 3JTNA 3G8TA 1RCOB 2HIQA 1WSVA 2QLJB 4P52A 2CPZA 3TW0A 4ZLLA 4KHPJ 4P2SA 4HDGA 3KLFA 1S57A 1SC1B 4I69A 1FJCA 4C8NA 1SC3B 4UF4A 5D0GA 5KFMA 3W5YA 1UJ5A 5F9NA 5D15A 2M52A 2OH2A 2LQ5A 3QSYB 1ULRA 2KB2A 2IMWP 4OL8A 5HATA 1EETA 2J9CA 4M94A 2MEWA 2BW7A 3M32B 4YS2A 3GSDA 2IJRA 2UXDF 3DLKA 1IQZA 3QT7A 5A0YB 1QSSA 1XTZA 3KLIA 2XCAA 3TI0A 2VQFF 4ED3A 2R7VA 3AODA 3CO9A 1M5PC 3LP2A 3IN5A 3POTA 4U9RA 4PR6A 4EBDA 3UNYA 3SBMA 2VA2A 1T11A 2QE5A 1S1XB 3LP1A 1SJQA 1HNIB 3HHEA 2GVZA 2WBRA 4I4BA 4NWBA 3UDLA 3LQVA 4F0MA 6FDRA 2RF2B 3H40A 1YITS 1RACB 2HHVA 2KT3A 3BQ0A 4P6QA 2BBEA 2H5JB 1UA0A 5F8GA 3KLGA 2XEXA 2YKPA 3UN5A 4I6WA 3DRPA 2OEKA 4LFCF 1RT4A 3PY8A 1QLNA 1FVSA 1S1WB 4P2MA 3CC2S 5E41A 4DV2J 1I94F 4GKKF 1JNZB 3ZTPA 5L1KA 4RUAA 2MQNA 3M1VA 4MJKA 3ZZOA 3KHLA 2R4FA 1HNVA 3TEHB 3PHEA 3CCQS 1Y5IB 4ELVA 3C16A 4CM2A 2FJVA 2GZOA 2VFUA 3JSYA 3MPYA 2UP1A 3ITHA 1RKIA 4JI0J 1GX5A 1NK8A 1L5UA 1NHKL 2R8HA 3DCAA 1N5VA 2OSQA 3VCDA 4IFYB 1WEZA 2RRBA 2YWKA 2ZBQA 3ZZYA 1WC6A 2Y0SD 3J7YI 3PW7A 2DT9A 2G0JA 3FCVA 3M8ZA 4DN0A 1LWFA 1IR1A 3EGVA 4CYUB 3A8KA 4L6V3 1U6ZA 1CJVB 4V1Ak 4X66F 2KL8A 3N6LA 4RW4B 1YJTA 2Y8YA 2IDEA 4K4XA 2OEJA 1CG2A 1QDUB 4IG3A 2DGWA 2ZBIA 4RBUA 4JUZA 3V2UC 4B9MA 3MR6A 4DHVA 4ERDA 4UOCA 4MMOA 2QFIA 1EIYB 2F40A 3A8IA 4I2PB 1UZHA 1N33J 3ITHB 3SCJE 5HP1B 2CAJA 1UKUA 2QLWA 3BF4A 1QUVA 5K8NA 2Q66A 1N54B 2EFQA 4C8ZA 3GV5B 5B0DA 3CCES 1VLOA 3CDBA 2VB6A 1RTHA 2C2ZB 1RT2A 2E5IA 1U1KA 4LF9J 4M5IA 2A3JA 3D0HE 5LSOA 4JV5J 1CJVA 4L73A 1VBKA 3R5CA 3R7BB 3TANA 1GXLA 3OTBA 3T6BA 3X1LB 1R0BG 2FHJD 4HT5A 3RBDA 4C4WA 1RKJA 4Z37A 1HA1A 1R6YA 4DV3F 1U49A 2UVVA 3KDNA 4Y0FA 1C1CB 1VQYA 3AD8C 2VQEJ 4DJBA 1RT5B 4I2PA 4ED5A 4ID5A 4QWDA 2XWXA 1OS5A 1U25A 2Z2LA 4HHHA 2LXFA 3WHIA 3OJSA 4X4QA 3MM5A 1YBUA 4A8WA 2OPPB 4U7UD 1CULA 1N5YB 1RAFB 2IPOB 1YZ7A 2MZQA 3CCVS 4ZK7M 3D6TB 4Y2MA 3BB5A 3GFXA 1P9QC 4ECSA 4NA2A 3SFUA 1T9YA 4DCJB 2BJ3A 4F3OA 3T5HA 2NXEA 3SEOA 1NH7A 1RHKB 3M8PB 3PYEA 5A8KA 2FLLA 3T6JA 1Q8KA 4TU7A 4BBYA 3HHDA 1K44A 4ZN3A 4RW8A 1VRQC 4P7VA 1JMTA 1S99A 1A0OB 5KT3A 4X4UA 4DFKA 1AFJA 5KFZA 3CSKA 1NSQA 1RTJB 1LW2A 3QMQA 2Q1LA 1GT8A 4Y2IA 3GR1A 3JB9k 2UUAF 3VGVA 2MPUA 2RUSA 1APSA 3OUYB 3CMAS 1G2EA 2D3UA 3DMJA 2BMBA 1TFYA 3ZTSA 1Q1KA 1ZAWA 2VZ9A 1U1OA 3HHLB 5D77A 3GPAA 4J9VA 2OTLS 1FVQA 2BX6A 3NGSA 2XYPB 2D9OA 3PR4A 1DURA 3ADAC 2FJWA 3G6YA 2J9EA 1TL1B 3MUMP 4I0WA 1IR2A 3MFHA 4B3TF 3OFGA 4B9UA 1NK6A 2ILYA 3CJ0A 4TY8B 2I5JA 4DZ6A 4ZLNA 1S0MA 1Q0NA 5B0GA 3MEDA 3DRSB 3JSRA 3KLHB 2O67A 4CLTA 2HGLA 2NQPA 2W7AA 1KOOA 2QA1A 3K8WA 1OO0B 2E66A 2FLOA 3KWMA 4URQU 4ETZA 4B3SF 1H73A 3M7VA 3QJPA 1OY8A 4K0KJ 2E9RX 1FRMA 1HD0A 2MSSA 2CA9A 2WVCA 1KTVA 3MMBB 2HNZA 2VPYB 1W26A 2VKZG 2J8AA 4DXLA 4AL6A 4CT8A 4D3HA 1R0AB 1GQEA 1KQGB 3LH2S 4MKAA 1KRPA 4L74A 4ID5B 3GILA 1P1LA 1UJ6A 1Z2ZA 4J5OA 4LQ3A 2DY9A 3LGNA 4PCQA 1NMEB 4HI2A 5I42A 4YHHJ 3H5YA 1CULB 3Q86A 1HNXJ 2BANA 3H4BA 4CLFA 2FVQA 1JK9B 1VJQA 1BD6A 2GIRA 1MROB 1U0HA 3ENQA 4DFJA 1H38A 1Y0HA 2YNFA 3D66A 2PT0A 4CLYA 4CIOA 2W9BB 3FQLA 1Q5VA 5E33A 2GC8A 1B4SA 3W8GA 4Q0BA 3CIZA 2ZOGA 4NLPA 1OMSA 3I5BA 2JDJA 5IOLA 1K1QA 3D68A 4KPCA 4NLSA 3U1NA 3SXLA 1D1UA 4G1QB 4DV5J 1KQFB 4AT1B 3DLLQ 1GXUA 2MQMA 2YNIB 2KXFA 3B4MA 4N47A 2M8DB 1B0VA 1RT6A 1KS2A 3MHYA 5ITHA 1O6XA 2HHHF 2FDNA 4ZVFA 3MD3A 3PV8A 4WCEQ 4J9LA 5LMNJ 3OUYA 2HZVA 2AEJA 3FVYA 2C3OA 4LR8A 1CS4A 2AV5A 2X3DA 4JI8F 2BACA 3WX8A 2BKOA 4DX5A 3DGPA 3GJSB 4LSNB 1BWEA 3CJTA 4WPAA 4GC6A 1B70B 5KFKA 3HXMA 4QW8A 3T5LA 1M5HA 4H4MA 3Q8UA 5C25B 3GIMA 3M2RA 4LR9A 2J0WA 2AWZA 3FRYA 3AY0A 1BMQB 4OHXA 1FF2A 2RS8A 2CJYB 4YR3A 3BYRA 1MWYA 1YJVA 3S6EA 5D3GB 5CCLA 3OTOJ 3ZZ0A 1P9YA 1TVRA 7AT1B 2AD9A 2ZVSA 5M2UA 2EVZA 1Q7YT 1J2VA 1N56A 2ZH2A 1VBXA 4HT7A 1XC9A 5K9FA 4J9MA 3TAPA 3VAGA 3R5BA 2DXDA 1VK8A 3TNVA 1FKAF 4QWBA 1W2BR 3HVRA 1LWFB 1OIAA 3SYZA 1E6VB 4PYDA 5CAAA 4QIWD 3DHWC 5CHCB 2D74B 4LR7A 2BJ9A 4RNOA 4EEYA 4ES3A 2HLUA 1DHMA 5C25A 5SZTA 1IJEB 2GJ2A 3DI6A 4LF4J 1TKTA 2QTWA 4WU3A 3V6JA 4DPYA 4ER8A 3I56S 5HLFA 2B6AB 2KHDA 2HAFA 3D1QA 3TEGA 2AJ2A 5J2NA 4CO1A 4PQAA 2IRXA 5C2CA 4DV1J 1RQ0A 1X9MA 4FYDA 4GO7X 4ZA1A 4DL4A 1HHSA 4TYBA 4F50A 3IMQJ 3K5PA 2MZJA 3CJ5A 5AXKA 4CNYA 4Q8FA 1CJKB 4XK8C 5HMYA 3UD3P 1NZAA 4WXWA 5DDRC 5GADU 1RE1B 3LTOA 4P73A 3H2LA 3AJDA 3D9BA 1YWXA 3AB2B 3K2YA 2FUG9 2O01C 4RW4A 2BR0A 2WONB 2AGOA 1HBOB 1Q5YA 2V8DA 1SC4B 3N01A 4Y00A 4CO0A 5DM6Q 4QIGA 1S79A 1UP1A 4G1QA 4F7VA 1S6QB 1BLUA 3RYLA 5HL7Q 3KJVA 2CQPA 1NB7A 1FJGJ 3BKUA 4P72A 4U96A 4DV4F 2ALYB 1TAQA 2FQQB 3AJ1A 3CJQA 3KNGA 4CLWA 1JKHB 1LOUA 2B4UA 1WDDA 2V68A 4DSLA 3R2DJ 5IT9U 5IV3A 2EFPA 2CJBA 4PWUA 1S0VA 3J7AN 3G4SS 2E1MC 4QIVA 3HF5A 1NDLA 4YFUA 1CJUB 1AZSA 3FSYA 2FJDB 5IQ6A 2EFNA 1KD1T 4DBQA 3WDOA 3FSXA 5E0OA 1HBNB 1OQ3A 2V8PA 4W98A 5HBMA 5HQLA 2AJ0A 4OZ3A 3CIMA 4TYAA 5K14A 4X66J 3ZXWA 5C7PA 3Q8QB 2BOPA 2UU9J 2VG7B 4JV1A 4RW7A 4C3KA 5GAHI 3SQGA 1S1VB 1UWBB 2CWKA 5DLGA 1HL6A 1SV5B 3T19A 1S4EA 3TZZA 2WRMA 2X51A 2CQBA 4ECWA 3R8YA 1PJ5A 1RT3A 1TL3B 3PR5B 2B9XA 1FX4A 3DLEA 1H74A 1O0PA 3C15A 2Q6CA 3VAIA 1IBKJ 1X31C 2FGCA 4EWTA 3OVBA 3LAMA 1Y00A 4DL7A 4X4VA 2W25A 2YQ3A 2YPYA 2C3UA 4R5PB 4DR1J 4O3QA 2DRBA 3WBZA 2OD4A 3HT0A 2HS3A 3JTOA 2AYGA 3BO4A 3MPUB 1DARA 1VQSA 2OELA 3DXSX 5A76A 3D2WA 3RB3A 4A8SA 2VG5A 1S0OA 2JEIA 1S1VA 2J9DA 1TL1A 4NI2B 5FIIA 2KKHA 3MGJA 5DRKA 2UXCF 2V9KA 4J9KA 4R0JA 1KKHA 1Y9OA 2GCFA 3GWCA 3N6NA 1MNEA 1XN9A 2HHPA 2ZKUA 3H42A 1TK8A 3AHPA 3EJMA 1VFJA 3I0RA 1JX4A 2VBXA 4CLKA 4X4NA 4ANCA 4O4GB 3C14A 4FXWA 1DTTB 3D5MA 2DEJA 2ZBPA 1KLMA 1HWIA 2RDDA 4CO4A 3VZIA 2NS1B 5E5NA 3LP0A 3OVSA 5LOQA 4B3RJ 4P9SA 5KFRA 2QV6A 1KN6A 1PCAA 3ZO7A 2CQ2A 1S6PA 3IBCB 3NAHA 1F5AA 4NZ0A 3KFWX 3C6UA 3M6VA 2HRYA 4OIXA 2AW0A 4KKOB 1FA0A 4PWDA 2N3LA 3IO1A 2HZAA 3NXZA 1REVB 2A18A 4IH7A 2XMKA 4CLLA 2POKA 1AA1B 3M9OB 2NUHA 3AQOA 1WD6A 4MK8A 2PE8A 2B8QA 3JAMY 4DR4F 2DVIA 2IM0A 1RA7A 2D41A 3TAQA 2XGPA 1WELA 2XO6A 1WHYA 1U8SA 4USHA 4JI6F 3SI8A 1T05A 1TMMA 2R8GA 2BE7D 3AA9A 2WZ1A 4NZ6A 1R0CB 2IA0A 2L08A 3OTCA 5K14B 4F2SA 2UXBF 3R5AA 2EBEA 2OPSB 4WE1B 3O2IA 3CCLS 2DNOA 1YJWS 3C8YA 4KKOA 2CXEA 3OXFA 2KDOA 4I7FB 5CYJA 2J7WA 4LF8F 3AQPA 2EFOA 1FKOA 3HHLD 3L3CA 1EX8A 5D0HA 3PO5A 1FHTA 1YHQS 1LWCA 1U09A 2N7YA 3A8JA 3C6TA 2EBGA 4RX6A 5HMZA 1U1LA 2A2DA 1N52B 4FBTA 4DR2F 2KFZA 3FBBA 4LSLB 1FWKA 2AIRB 2QMXA 2W2PP 3GB0A 4NA1A 2LQBA 4OYZA 5D4PA 1FE4A 4R8UB 1GX6A 1M1GA 1RAEB 2W9CB 3ONQA 4DR6F 2HURA 2VDIA 4GVLA 1TUWA 2M2BA 4ID8A 2GX8A 1N48A 4NMLA 1FD2A 4X64F 4ITSA 4EYHB 5DG9A 4DR7J 1PILA 3G2XA 1D09B 2P8IA 3C16B 3R5GA 4F67A 4LF6J 5DLFA 2ZEJA 3MAQA 1GNKA 3ZTRA 2CJQA 5B0EA 2HFSA 4B9SA 1FKOB 1HW9A 4IUFA 2GFFA 4NLUA 5HVFA 2MHNA 4FYXB 1RYRA 2DR9A 3QT8A 2JWNA 1SC6A 1PYOB 3AOBA 3H5UA 3UFCX 4LSZB 2M0GB 2HHXA 1ZAVA 3FRZA 3M30B 1FXDA 4ZKAA 4FF4A 2V2KA 2VF3A 3T5JA 4DCOB 3ET6A 5IFMA 5IXUA 5K5MA 1DRZA 4C8KA 4N76A 3MAAA 4DR7F 1YJ7A 3TZXA 1WOPA 5ETKA 5FDLB 1T9XA 1RTIA 4B9VA 3JSMA 4DUZF 2CNNB 3G8SA 1VR6A 1JJ2R 4K4ZA 5HROA 1XIQA 4LREA 2WVBA 3S1TA 4TKTA 2WOMB 1NK7A 2RUGA 2DHAA 4LMZA 1UW9A 1FXRA 4X2BA 4ECVA 3KHGA 3SV4A 4IG0A 3KK1B 1P6TA 2HWIA 1KTQA 4NCBA 2MQPA 3CVKA 2HHQA 4LF9F 1D8ZA 3DC2A 3J7Z5 4C98A 2RDIA 4DL0C 1N88A 2CKWA 2VPXB 3I9ZA 3I55S 1S48A 2WK4A 2DNRA 3IA0A 2AEMA 4XAKA 2FLPA 2ZH9A 1CJTA 4PZVA 3QT5A 4WWSA 4F3MA 4Z7CA 1J5OB 4H4MB 2LLZA 3PXGa 1NSKL 3QYYA 2LEPA 2OO4A 4OI3A 3SFGA 4AQYJ 2ACMA 4M95A 1XMQF 2LECA 4DQQA 4C2MA 1W2IA 4DSKA 3OXGA 2OHDA 2J8SA 1WI8A 3GLJA 1IKWB 1WEXA 2YKNB 2BV3A 4K7QA 3RZAA 1FO1A 1JNRB 4PG4A 3US5A 5KT7A 2DXEA 3TQ1A 1EB0A 1RWMB 4A8FA 4NCAA 3OTOF 2ASJA 1SJRA 2BABA 2HBRB 2W24A 4OJ1A 5A0YA 3THTA 3GIKA 1T7PA 1D0EA 4NE9C 3IBFB 3KLEB 1DZ5A 2G9OA 1EKSA 2IYGA 1JWWA 5KOWA 1WTFA 2I2YA 4N8NA 1S9GA 1YG0A 2RKIA 3PCOB 1CQMA 4ED4A 4FF1A 3U7JA 5CD4H 2JJ4D 2OI2A 4OJ3A 1GTEA 2KG0A 3BH7B 2J0XA 5T7LB 3EPIA 3TA2A 4DL5A 1LWEA 3PNIA 1TL3A 4BWMA 1PBAA 4LFAF 2ILZA 2GQQA 1KONA 1D9AA 4BWJA 1U1RA 1UJ4A 5J1NA 2V94A 2Y1LB 2DCUB 1N5QA 1XEZA 2KVQE 3BR9A 4J9PA 4B9LA 1F3VA 3WIVA 1WORA 2G4BA 1FDDA 3GE9A 4KYZA 4WF9Q 4G3IA 2EC2A 2F65A 3GFHA 4CTAA 2VUGA 3W66A 3ENVA 3DLJA 3KK3A 3UN2A 1UWBA 1VHFA 2AZ1A 3OQ2A 2XY6A 1NAQA 2BQRA 3R7SB 5D0EA 4IG0B 3KK1A 1K0VA 2CVIA 1VS3A 2DNZA 2BA9A 4WIIA 1U48A 1IKVA 3LUYA 4KGKA 2HFOA 3HJFA 2VFSA 1U2CA 3CCZA 1NJIT 1PBUA 1TKZB 4ZPVR 4EO8A 4ZP9A 3MR2A 1HYSA 3MZIA 2F4VJ 4DPWA 3OLAA 2MKYA 1UVMA 1JLFA 3TYTA 3W2VA 3OSPA 4XO0A 2ZWOA 3CO0P 4B02A 1SJ3P 3M8PA 4USVA 1TUVA 5A8KB 1UVJA 2AJ1A 3S01A 3MEGB 4GVBB 2A6MA 5RUBA 3G87A 1JLCB 3E2EA 3N4WA 4L76A 3SQGB 2ZH4A 4JI4J 2IAJA 1YX2A 3DOKA 3UO0A 5KFYA 4XPEA 1L3UA 2W2OP 5LL6d 3FCHA 1FKPB 1ZZNA 1XJWB 1QTNB 3QJLA 2UXDJ 4NRUA 5LXYA 2PO4A 3MMAA 2ZH8A 1IQTA 3NRBA 2W2QP 2NZ4A 3Q22A 5IT0A 5AXMA 4B17A 4A8MP 4U7UK 4FBUA 1QAJA 4OZ0A 2DD8S 1HFEL 3AD7C 3RBXA 3JTPA 1S6UA 2JNJA 3QIPB 3IAM9 4LUBA 1HI8A 4WE1A 4C3MA 2XZDB 2KI2A 2J6TA 5EX0A 4C8MA 4ILMA 2IAJB 3W61A 2RH3A 2MGZB 4ZVUB 1RYSA 1TP7A 1KC8T 3RU0A 4BC9A 3JSBA 1FKPA 2E7WA 2WVFA 1U7LA 3HVWA 3K57A 4GKJJ 1L3VA 3O3LA 3KUHA 1AUSL 3CMQA 3W63A 5D4NA 4D3GA 1SQFA 5AE3A 4USMA 4LF5J 3PEJA 4ES1A 3SCKE 4R0EA 2YKMA 2K2PA 2V2QA 3Q0AA 3X3UA 4F8RA 4USIA 4TU8A 4DPTA 3MOZA 3JQKA 4HVZA 4ZIVA 1XMQJ 2UXCJ 1XNRJ 4CP5A 1U2FA 2VD3A 3TJ9A 1ZETA 3EYZA 1FDBA 5M2PA 3KJNB 2D7SA 2ZDPA 5H9FJ 4Y65A 1VLYA 2EKNA 5IS2A 3DYAB 5BR8F 4F4ZA 2RB7A 3NL0A 4PG6A 1NZ8A 2NSCA 2YNFB 1KFDA 2YQ1A 4Y2CA 2I6WA 1TV6A 2HNYB 1RT4B 4X4PA 4O3NA 4DF8A 1C2PA 3QT6A 4DSIA 4PQUB 2A10A 2BOAA 3EZOA 1H7WA 4ICLA 3LF0A 5KFNA 1HWUA 3K89A 2C28A 2VKRA 1MU2A 2UZAA 1RHJB 3MPDA 3MF5A 4YY3J 1U24A 2VICA 3VR1A 2H5IB 4CM0A 4DFPA 4JV5F 2V8HA 4YY3F 2KZZA 2NUUG 3K5OA 1FJGF 1SIWB 1F9FA 3CNQP 1OY9A 2HNDB 2QYCA 2DO4A 1BC6A 1A7GE 1WF2A 1YKWA 2UUAJ 3HZGA 2DY1A 2X3GA 2F9DA 5M2RA 1NHVA 1XNQJ 3PYDA 5DG8A 3PRBA 2WOMA 3CT9A 2XQCA 2QL9B 3OXLA 1NK4A 2EPIA 4X64J 2RILA 3UW1A 2KO1A 8RUCA 2X1AA 4LF4F 2VL1A 3BN7A 4PXEA 1AW0A 3T1YF 2XMWA 2RU3A 2RD5C 1F5BA 4AUKA 4UUWA 5D78A 3KLGB 5H9EK 2XZTB 5IV4A 2R7XA 3D3BJ 3K7RA 4DEZA 2EFGA 1NXIA 2V6AA 4WP8A 3UPFA 2AJQA 3GYGA 2OGUA 2XMTA 5IWAF 3GTYX 1CJTB 1JXVA 2PEBA 2B4VA 3N5FA 4LF8J 1O8BA 4MYTA 3NGDA 4DPXA 3CJRA 8AT1B 1N6QB 2PEHA 2RKIB 3IRXB 1J5EJ 4NXNF 4LIRA 5BJRA 3CJ4A 4RJVA 2N7CA 3H2UB 1WOSA 2CJAA 1DTQA 1WHWA 5GAHU 2JFDA 1RT3B 4LFCJ 1WG1A 4DV4J 1KOHA 2R8IA 3OHBA 1TV6B 2HNYA 2ZFHA 3A12A 1EAYC 1M5OC 2IRYA 3RAQA 3RRGA 1UVKA 4PXCA 1IKYB 1S7IA 1SH3A 5LJ5Y 4CH0S 5EDWA 4DFMA 1P1TA 3W8PA 3NGTA 2R2RA 2VIHA 1VQ4S 2OTJS 4WZQA 1DLOA 2VPWB 4ECZA 4FYWB 2ACYA 3HKWA 1U45A 1MU2B 2UUWA 2VBWA 1KQKA 2C3MA 5HVHA 5MAOA 3CJ8A 1TTHB 2ROPA 4DL6A 1S6QA 1I3OB 1XK8A 2QLXA 2CZ9A 1G4CA 3BSAA 3CTRA 1EQMA 3MM8A 1Q86T 2JH3A 1VIOA 2XSFA 2NYHA 2GO8A 2IYIA 2MDAA 2KXHA 2DRDA 3GONA 1Q79A 4F0KA 4I2QA 4IH6A 2XS7A 3PJ9A 2OPQB 4I67A 1SJ1A 1SH0A 2L48A 4Q44A 5KFQA 1URNA 1RT2B 3RUBL 3KG4A 1PJ6A 4DQPA 1UVIA 1WKKA 4USTA 1VIXA 2G1HA 1AT1B 1SB6A 5IT9Y 1JLFB 3VAFA 1PGZA 1H3DA 3J80U 4RR5A 5AE1A 1SQGA 2DGSA 5HLFB 1X4HA 2Z8QA 3QNWB 2ADCA 5B0BA 1NNDA 4K4SA 3HX9A 1JB0C 1A6LA 2V8GA 4MIWA 3M05A 3CJ3A 4RW6A 3DNCA 3ETMA 3QSIA 1REVA 1T9WA 3DOKB 4YB7A 1OYDA 2HVDA 2OPPA 3MMJA 3NCQA 3A8EA 4AXJA 2IBKA 1HYSB 2FZCB 1H6KX 3K17A 1K9MT 2ZVIA 4JI3J 3LA0A 2QMUB 3QJJA 3CCTA 4CO5A 4RU2A 4NYPA 2P6TA 1FJ7A 2CFXA 3R2CJ 3HCXA 1TAUA 4K2XA 4R5PA 1U47A 1IBMF 3IGNA 3HZEA 4OYPA 3O44A 5L46A 5F8HA 2OPSA 4WFNQ 3MM9A 4XPCA 5KG7A 3EDRB 3CE8A 2R3VA 5LMNF 2DYAA 4ZVSB 2QG9B 4HR2A 1VK3A 4ZHRA 4FF3A 1UETA 1GH8A 4K59A 1S6OA 2BANB 3BDEA 4Q45A 1KNZA 1IKYA 4HTIA 4O4GA 4WFXA 2PMHA 3ICLA 3I9V9 5CYMA 2E9TA 4B3RF 2QL5B 4OYXA 1S1TA 2Z0GA 2IJFA 1VCTA 4C11B 4Q8EA 3RAXA 4V19X 2XLKA 4OYWA 2AX1A 5E3AA 4J9SA 2PC6A 3O8WA 3EDQB 2VG7A 4FZVA 1R8HA 3ILLA 4NYOA 3KG1A 1TL4A 3T9ZA 4UT4A 4ZLJA 4WU2A 4ECQA 1G3OA 1LKZA 2ZNYA 3THPA 5KT2A 1FNXH 1D9FA 1MSWD 5A6PA 4QR2A 4KGXB 1X7VA 3PG9A 1HIYA 1NH8A 3HP6A 2KZMA 3DYAA 2PA3A 4N7TA 2L9WA 2XNRA 3MECA 2N82B 1FE0A 2LU2A 3I4HX 4DU7A 2G0IA 2CPEA 1RISA 2E7XA 1OYEA 4JBCA 4TNOA 3RR8A 1KVKA 1TZ0A 2BJ7A 4RBVA 3TAMB 4C48A 2EEYA 2Y1RI 2LVWA 3BGOP 5G0RB 3RBZA 5KFPA 4TU9A 2ALZA 3V5RA 2ZD1A 2MB0B 5F8NA 4ZVEA 4K0KF 4M5DB 1T02A 1C0UB 2QJ3A 4DL3A 3KLFB 2FIUA 4UTGA 4UZBA 3PX4A 2ZBRA 2B9EA 2FHKA 1BHNA 3M8WA 2H1YA 2WSFC 3H5SA 3QGGA 3UD5A 3Q83A 1S4FA 2ROEA 1UW4A 4PWWA 2LXUA 3ZNJ1 1T94A 2ADBA 4JYAJ 1PAEX 4DPOA 4YQWA 1XMOJ 2COLA 2M88A 4RNNA 1ZH5A 1FI4A 1W7WA 3O1LA 4O23A 3MCOA 3HVTA 2YNGB 4OZ1A 4TN2A 5JXSA 2DHHA 2WVDA 3D1OA 4K5SA 3V6KA 2YWGA 3K8VA 2MKCA 3LP0B 1EHWA 3AJ2A 2QIFA 1E6VA 4NLQA 4FNIA 5H9FK 1JLGA 2E5GA 1VC5A 5T14A 3TVKA 3BREA 4AXIA 1UCNA 3MI7X 4WXOA 2AGQA 2I0XA 2QX0A 4N41A 4OI0A 1VQ6S 3EE3A 1RT1A 1WG5A 4ZHRB 1QVGR 4FPRA 1TMJA 3IM9A 3CC4S 2ZE2A 4FNHA 4ZS6A 2AYBA 4ILLA 3CC7S 4ANDA 4ZPBA 4HLBA 4CH1A 2V5HG 2ZH3A 5D4LA 3GYXB 3K5MA 4ZVHA 2QA2A 2WVEA 3ET6B 2YX4A 4I6YA 1H2UX 4OLOA 1HKAA 2JRSA 2OUGA 5FDLA 1RP5A 3NS5A 3JQMA 4XTTA 2IM2A 3OR2A 3OL6A 1FWPA 3H25A 1OWXA 2MQ8A 1TK0A 3R5JB 2DNPA 4KRWA 2XMAA 4FXDA 3FGVA 5K20B 2QGFB 4OQJA 4K4TA 4EGLA 4RKUC 1B0PA 2BXJA 5KFGA 4NLRA 1HBMA 2BE2A 4MIBA 4OYIA 1LW0A 2CRLA 3ETOA 2IVMA 4LT6A 4MFBA 1FNMA 3D6HB 1YRTA 3TQEA 4PG8A 4JI3F 4ZP7A 4LF5F 4OYBA 3KHHA 1HNWJ 3B78A 5JVHQ 4LSLA 5E3PA 3N5BA 2N4CA 5LM7E 2Z4PA 2W9CA 5K8OA 3OTDA 1XR5A 2FJEB 4O0NA 1LXNA 4KGZB 3M4XA 3BQ2A 5GMKa 3MTJA 2CJ9A 1RHMB 4IG3B 4DR4J 2FC8A 3TVZA 4QYZJ 3NY0A 1T3OA 2QN6B 3M6WA 4GO5X 5JVGQ 3P96A 1SL2A 3D28A 4U7CA 4NASA 3CDWA 2YH0A 2WW8A 4ZIWA 5HP1A 1YI2S 3P4UB 3QAUA 4HL9A 4N77A 4X84A 2HQDA 2XMJA 3QZ7A 4C8OA 2ERRA 3RG6A 2RQMA 3SSSA 2MQQA 3BYPA 1RBLA 2QO3A 1XR7A 3HVTB 5ETVA 3M8RA 1X8DA 4PUOB 3PIOQ 2D3ZA 1FD8A 2OPQA 2XULA 3KG0A 3PDNA 3HFZB 2CIMA 4OZJA 2FHMA 2GAGC 3VTIA 4DV3J 4CYUA 1DLOB 3DDNA 2C2RA 3BV8A 4USUA 3CCWA 4DUYJ 2IC3B 2OLWA 4I68A 2LQ9A 4E98A 1CPZA 3TUPA 1F1BB 2PFDA 2DGTA 4DQIA 4NLVA 1CSJA 4LF1A 4QBUA 2DJWA 5E3CA 5SUHA 3OL8A 1IBLF 2OFHX 4EFAC 3Q24A 2ZOFA 2JHEA 5J1EB 2DBBA 1NK0A 1CVJA 2F4VF 3BBFA 3CCSS 2HIYA 2F9JA 4A47A 3NWRA 1RU2A 1NKEA 4JB8B 1IM6A 3IAS9 3L9ZA 3CW2C 5EX3A 5FLXY 3BO3A 4DX7A 1M90T 2K3IA 4IO9Q 2HQFA 3LANA 1AROP 5L39A 1S49A 3OL9A 3H20A 3UCUP 1B7YB 1RADB 2U1AA 3DRXA 4HH0A 1MWQA 4NLTA 3HLUA 4WIQA 4Z7YA 3TJAA 4DV2F 3KNAA 1ZPVA 1FRIA 2VG6A 2O66A 3PVXA 4I6AA 1S6PB 1NDKA 1ZM4A 2C3PA 2VBYA 3KUGA 4LRFA 2LEBA 2LEAA 1C4AA 1B0TA 7FDRA 2CNKB 5DDQC 3NWGA 2C2OB 3AXKA 1YVFA 1WACA 2AJ4A 2HPUA 2WW4A 3DOLB 4X4SA 4DQSA 2HVZA 1JLBB 3Q8VA 3UVJB 4LRBA 4WK1A 4X65F 1IUJA 3QLHB 3NNAA 4M63A 2OKQA 1EP4A 1PC4A 1XQIA 5CZXA 5D0RA 3IC1A 2W7PA 1HD1A 4UY85 1JJ4A 1WC5A 3C19A 4GKKJ 3QWPA 1RDRA 3MM9B 2VG6B 2DNQA 2OD6A 1WUUA 4YUDA 2OMOA 1FFWB 1HBUA 1Q8IA 2CQ1A 3JQJA 2LKZA 5ETRA 2DIVA 2R7QA 5BYQA 1QTMA 3M8YA 1FEHA 5LT5A 2I8EA 3MEDB 3G8QA 4XDCA 3EPGA 4WYLA 5C24A 3R1HA 4DV6F 4HYKA 2KRRA 4YN3B 1GXTA 2DGVA 2RQKA 4RL1A 2DO0A 3FUYA 3KKFA 4ZLPA 1R7IA 1ZOTA 2CPJA 2W2NP 3N79A 5HI7A 4ED2A 1KLMB 1S7HA 2MSTA 2HVHA 5KOXA 4OX8A 4B3MF 2FHJA 4UQGA 3I96A 5ETQA 3R27A 3VWSA 3LWMA 3EGZA 3KJFB 1PO6A 2NPIA 2HW3A 1CEZA 2HEKA 2MLYA 4M5DA 5HJXA 3PW4A 4H4KC 1HPZA 4PWDB 1SV5A 3GR0A 2H4YB 5F8JA 4MK9A 3GQCA 2QFJA 3EZUA 4E2FB 3W9HA 2DRAA 1YTYA 3W9IA 2DNHA 2CPIA 2PSZA 5CYMB 1NK9A 2UUBJ 3HHLA 1OPIA 2HK3A 2D3OR 4DV0F 1JQGA 1BY9A 4YEAA 4F04B 1C1BA 1YBAA 4EMDA 3KK2B 3OV7A 1NJXA 3IXQA 3M6UA 4JV2A 1JLCA 2XHCA 1Q78A 1OPZA 1RWWB 1HMVA 4HDHA 1HI0P 1HQUA 4X62F 1KP6A 1R8BA 1UAWA 1HHQA 2RU9A 3BN4A 3UR3C 5JJBA 3KMSA 1AUDA 1QSLA 2VODA 1UPPA 2CPXA 2GNKA 2MYFA 3T1HJ 2CNOB 1KR4A 3HHKA 5T41A 1GAOA 1V6HA 1BQNA 2AYMA 2DH8A 4DS5A 1RCXB 4TLQA 4F02A 1CBKA 1PYTA 3G6ES 4LSNA 3JS9A 1HW8A 1R31A 2BDPA 3A13A 3DRRB 4UOHA 4X62J 4R25A 3KK2A 1QJHA 1V5IB 1AFIA 2QZ8A 3T1AA 2P5VA 4NX9A 4CT9A 5CABA 1Y5NB 5L38A 1S9FA 1RAGB 3RRHA 1UEVA 2FJBB 4TLRA 4UUXA 1DTQB 1LW0B 2KH9A 2B7CB 1WTBA 5U47A 4KR0B 2RE1A 1X0FA 4PKDB 2OPRB 2Q3PA 3DRPB 1DY3A 4JI1F 2M70A 3VHQA 2GVDB 2MHEA 1VBYA 4C9DA 4M5KA 3HO1A 2BUNA 3M8QB 3BEGB 1B3TA 2RJZA 3DGPB 3N9UC 2UVWA 2V34A 5IWAJ 4DV6J 2L41A 1LK7A 4MYUA 4QWCA 4Y2KA 1UWAA 2WTFA 3HVAA 1UTAA 2K3KA 5DQGA 2PN6A 3Q8RB 4FS1A 3MWBA 5KFSA 1VQPS 1RGVA 3DM2A 2MKKA 2W2MP 1SL0A 1M5VC 5A2QU 1DFDA 2OJ3A 1Q95G 1VHIA 2BJDA 1SUQA 2LCWA 1LFPA 3P5BP 2HS0A 1RK8A 3RAMA 2DNNA 3ULHA 1G7CB 3NG8A 3SSQA 4C0HA 2NXUA 4NPOA 4B3SJ 4LVNP 3A1YG 3M2RB 5B0FA 3FKBA 2HWHA 3CUNA 3UCZP 3FCWA 2C3YA 3LGMA 3OD2A 4ENOA 4B9TA 2EW9A 3W64A 1PYSB 4A8XA 2E1CA 1GMUA 4DG1A 2NYIA 4AYBD 2AQ4A 2QYGA 4BDPA 1NUEA 3K58A 5J2QB 3BBCA 2MKHA 2A2CA 3EGWB 4Q2LA 1TK5A 3VV2B 1VYAA 3DFEA 1X60A 2XGQA 1RTJA 4WKYA 1AZSB 1RA6A 4YR2A 3M1VB 5KG4A 3DMJB 2L9DA 3HSGA 4QJVA 4ED0A 5J2MA 1I5OB 2VDHA 4JI0F 1HBOA 3I0SA 1S77D 1REGX 2IVYA 4ZVTB 3HI9A 3MM6B 1BXNA 2E5JA 1HI1A 4ZVQB 3I31A 5KFEA 1JJHA 3BQ1A 1HNWF 4DG1B 1RI7A 2C2NA 1X5OA 4CI0B 2ASDA 3GMGA 1Y4ZB 1SI9A 1JLAB 2GGPB 4IOBA 1RBOB 1RTDA 4NRTA 5K8MA 4P71A 5T7LA 4WZMA 3W5XA 3DLGA 4K4WA 2ASYA 2FVRA 4EZ9A 4ZVOB 1RSCA 1UPMB 3J81U 2ZUGA 2YTCA 2RDJA 4LFBF 1I51B 2JVOA 4HACB 4X4TA 4DMZA 2HS4A 3GSIA 3L09A 1E6YA 1JLBA 1XERA 3GJQB 3VZHA 4KHRA 1XNRF 3DXBA 1P8GA 2YH1A 4W4MA 2IY5B 2NZCA 4RNHA 1J5OA 2Y9HA 1F3FA 5GMEA 4ZJQA 3UD4P 3IRXA 3NNHA 1S12A 4C7QA 1H7XA 4KAIA 4J37A 3HKZD 1T03A 3R9LA 3LGHA 1F9HA 1YBTA 4G6VB 5GADI 3RB4A 2VC0A 2AU0A 5GAEU 4F4AA 5F9LA 5B7WA 2CZ4A 5DS7A 3FNNA 1FX2A 3RJMB 5CD4A 4ES2A 3TR5A 2P2CB 1T8EA 1E6YB 3AOAA 4A46A 3PHTA 3TO8A 4ECXA 3TJ8A 3T3FA 3V4IB 1T9UA 4GRSA 5BXIA 5LJ3Y 1SCJB 2LP4A 3DLHA 2EG1A 2PFFB 2JLFA 4C3LA 2CPHA 3J81j 4A8KA 5L9XA 2F63A 2R42A 1NPRA 2GMLA 2H54B 1VOMA 3R6LB 3FEZA 1U26A 2H4WB 4X4OA 3MDFA 3MEGA 2RVJA 4CCHA 2KU7A 1X9WA 2G2ZA 2VQFJ 2ZH1A 5BYSA 4P2FA 1SVDA 1YZ6A 3HSDA 1N5TA 4KH0B 5KG6A 4WKRA 3IWXA 1DBDA 2AF6A 1BQXA 2EG2A 3C15B 3CD5A 5A8RB 1U6FA 4Q43A 3SIPB 2A1BA 1KSPA 1IN0A 3IG1B 1F9EB 2LFVA 3E8OA 4DV1F 1VQ9S 1NO8A 1EP4B 1O51A 3AAWB 1MMNA 5I3UB 5CYQA 1U1MA 2H5EA 3LW5C 3QQCD 4WP3A 3E51A 5ETOA 3K5LA 3T41A 2R7TA 1LQ9A 5HJYA 5EUHA 1U6BA 2JL9A 4ZCKA 2EC0A 2X1BA 2M8HA 3R3TA 3W60A 5KTQA 4DR6J 1FRJA 3QWUA 3W3SA 2VH7A 5GMDA 5HANA 5EWGA 5F8MA 4I7FA 1J27A 2Z30B 1IXKA 1X4FA 3BGRA 4JV0A 3GJRB 5HAOA 2B0GA 3P8BB 1SH2A 1TELA 4BCAA 5DDOC 4QWAA 4M5JA 1WF0A 3ISZA 3QGHA 2EI5A 5A8RA 1X0PA 3L4BC 4NEZA 1RABB 2I38A 4Q2MA 4FS2A 1MN9A 1LWXA 2X1GA 3IFEA 2XLIA 3GCXP 2GHVC 3NS7B 1ZA1B 4KH1B 3M8SA 2AEFA 2JOQA 1VRUA 1JIHA 4IRDA 2W9BA 3GV8B 2ZHAA 5A6WA 4KTQA 4PPZA 2ZUAA 3FMWA 1L3SA 1Y7PA 4QOTA 1F2HA 2I9SA 1T05B 1KFSA 3PEHA 1R8AA 1C1CA 5C42A 3EXYA 5CXTA 4LVOP 3MCNA 4YHHF 4ZCMA 3PJWA 1T03B 3NMAA 1XBWA 2QLBB 2RQ4A 5DO2A 4OZ5A 2AMCB 4K2JA 2E1PA 2YNIA 1SBRA 1UVLA 3DRSA 2KM8B 4ED7A 3C2PA 1F5CA 1WI6A 2IDLA 2QSWA 4PYAA 2DNKA 4ZP8A 4OJHA 2YPZA 1FFGB 9RUBA 3H4DA 3P6YC 2QLFB 3O5TB 2IBOA 4WP9A 4ZJLA 1NK5A 2YBVA 3Q8PB 4ECRA 1N32J 4MKBA 3G96A 2FB0A 4ZVRB 1RAIB 4NLXA 1QAIA 5ETNA 4DN9A 2LYVA 4NYZA 5ETMA 5KFTA 3ILJA 2RAQA 2H51B 2Z58B 4RPFA 1EQ0A 2ZH7A 2NPFA 4OHYA 5KT4A 3MAHA 5IT4A 2FZKB 4O3OA 4F25A 2HQ3A 2RF2A 4ZJOA 1H2TZ 1YJ9S 3F73A 3I5CA 3HFVA 1FEEA 4TY9A 4DCPB 3PTWA 4XDDA 3SDEA 5D8HB 1CLFA 1T95A 5G0RA 1FNOA 2FJAB 4RW9A 2O1PA 3J80Y 3UNGC 3KLIB 4X4RA 3GJTB 3Q2SC 3CJSA 1ZPWX 1ZZFA 4ED1A 3B8HA 4ZVPB 3B4DA 3P3DA 2B9YA 1CC8A 4F26A 4MTPA 2LQJA 3M6XA 3OR1B 1HNVB 1S1XA 2J7UA 1YJNS 3BO2A 5BR8J 1N34F 3BDPA 2DPJA 1LK5A 1NCLA 2CG4A 1UFWA 2V67A 2NLWA 2B5JB 3GFZA 5G4DA 4QR1A 2HKEA 2UVRA 4BC7A 3MMCB 4KO0B 1V9OA 3OFHA 1KWMA 1XR6A 2KYXA 4DDFA 3DLEB 3RW7A 2BM1A 1QE1B 5MLCV 5DGBA 1X5SA 2CG8A 3OSNA 3I6PA 4IOCQ 3SCIE 4A8OA 3KLEA 3CF5Q 3PZPA 4OHVA 3KHRA 4ICLB 2FLNA 3QATA 2MY7A 3LP2B 2JC1A 4H4OB 4B08A 3I0SB 1VISA 3PRDA 2B8PA 2MTLA 5I42B 5L1JA 2BQUA 2XM3A 3AXMA 2KN4A 5B09A 2DH9A 3TUIC 4RWWA 2M4MA 1KEKA 1JLAA 4YB1P 2W7OA 1RTDB 3VQTA 2W01A 1SJ4P 4JI7F 2W1BA 4DWIA 3G9CA 1QE1A 1FCAA 4JI4F 4PAAA 3UVJA 4P75A 4ALZA 1OQ6A 1LXJA 3WX4A 2XI3A 2YKOA 1DJ0A 1CJUA 2RQCA 2BJEA 4KHPF 3QO9B 2B43A 3TA0A 1BE4A 3CJ2A 2HFUA 2WAQD 2YWWA 2RHQB 3FQKA 4F4YA 3V81B 2F3JA 4ZITA 4UZCA 2I1RA 3ISND 1ZYQA 5AT1B 3CJKB 1YGYA 1FDNA 2Y1JA 1F6TA 1C0TA 2KT5A 5ETTA 3MM5B 4FF2A 2W4DA 4IO1A 4C0OC 1M5KC 5A2QY 4Q5VA 3QZ8A 2BRKA 5H1SV 5K8PA 1ROFA 4FYVB 5GVQA 4BS2A 4KJIA 2FTRA 1ITPA 4OZNA 2E1AA 3HPOA 4KT0C 3SZ2A 2XI2A 5EGYA 1UEUA 2WONA 4NMXA 3B6BA 2N3OA 4RZRA 1RTZA 2KM8C 3SCLE 5AXNA 4KQZA 2C22A 2GJIA 4GVBA 4DX8H 2AT1B 4DI6A 2V2VA 8ATCB 3KJVB 3HJVA 2R2UA 2DR8A 2CADA 3HFKA 1VQKS 2R8JA 3MM7B 3D3CJ 4L75A 4RW8B 3CJKA 2ZJPQ 2G2OA 5DZ6A 4RW6B 2GHWA 2YVSA 4J91A 1AXQA 3QGIA 1RWPB 4OI4A 4OX6A 4PG5A 4IH5A 4CLUA 1N5YA 3VGUA 1MMDA 1ELOA 1IWGA 1BWVA 4A4JA 3I0RB 2X1FA 1S9EA 1N32F 1B64A 1IKXB 2M7SA 2R2SA 1T9TA 2LA6A 2OP5A 1X4BA 1FK9A 2HSEB 1GEHA 2ZWPA 3NEKA 3QFWA 4AFFA 4NA3A 2ZNZA 2UV8G 5CYQB 3MURP 2C2DA 3NBPB 1R43A 2NCKL 2NXNA 4M5GA 4F4KA 4KSEB 2B4PA 4JI8J 1FTRA 3CD0A 2B6AA 1SQEA 2RIJA 2D3O1 5KG3A 5KFHA 3A4TA 3MM7A 1HMVB 4LBHA 4HHJA 4YMEA 1U02A 2IJNA 1KQSR 2MGZA 1IKVB 1UFLA 3W65A 3DHXA 1P27B 4QZVB 5KFJA 3HD1A 1SKUB 2HMIB 2BW2A 4E0DA 1RHRB 1CC7A 1O5JA 5C2GA 4OYOA 1FDAA 1Q8LA 2CPFA 4DLGA 1IBMJ 1FJEB 2GAHC 3G6XA 3H59A 4IQXA 2D69A 4FKYA 3OBIA 4WBFA 3UQSA 4TVAB 3W2VB 2YNGA 2HFNA 3CULA 2FJXA 1QVFR 4N56A 2CQGA 1SJFA 4H54A 1F0XA 4JI2F 2BVZA 2RRNA 4LIWA 2B7BB 5F3TA 2MQOA 2FGOA 2JLEA 3L7UA 3MCMA 3MMBA 2ZJQQ 3CGIA 4ETXA 4DV7F 1MN7A 7FD1A 3PX6A 1G1XA 2VG5B 1WHVA 2VOPA 4CLSA 1IJFB 4I1TA 1U4BA 1Y11A 1EZZB 2A0FB 4F2RA 3LAKA 2VQEF 3K59A 3UDEA 3UWTA 3KLHA 2K06A 3E3XA 3KXDA 4Y3CA 3OL7A 3AB4B 1K73T 5KG0A 3PW2A 3QLHA 2QA4S 1ZS6A 1K8AT 3ISNC 2FZGB 3KDOA 3D6FB 1DTTA 2MKJA 1GTHA 2XZWA 2CZVC 1R8CA 2MZRA 3H90A 4LFAJ 4NZ7A 1UEKA 2YNHA 4RUCA 1H0HB 2DHXA 1HBNA 3HSZA 1RWKB 1NBEB 5KFAA 3CDUA 5A8WA 3G82B 4QPXA 3IRWP 5I3UA 3GYNA 2PD1A 4FN5A 4JI1J 1PJ7A 1YDLA 1QY7A 2ZD1B 1PC5A 4OMFG 3H2VE 3Q2TC 1FRKA 3LPEA 3POTB 3WC0A 4DUYF 1RJJA 5GAGI 3T1HF 1DQAA 2QRRA 2C1EB 4S0MA 4E8UA 2CVEA 1KDNA 2K1RB 5IM0A 4TY8A 4J9QA 3W1YC 3GG0A 2RRAA 3K0JA 2WBMA 1M1HA 2XG8A 1RT6B 3VF0B 2ZKTA 4LRCA 2ZC4A 4DZDA 3CXCR 2ZHBA 3PX0A 4EK2A 3JYTA 4B3TJ 1U8WA 4M5LA 2KJVA 4ZVGA 3CMES 2RMLA 1S1WA 3T5KA 1YK9A 3LO3A 4BHQA 3MAAB 1XMOF 5KFIA 1ZTWA 2YWHA 1NJYA 2OSRA 3AT1B 3EUNA 4OLPA 5DDPC 2VJUA 1IBCB 2W4CA 1UA1A 1MMLA 2FD2A 1ZM2A 1B7FA 2VV5A 3A3OB 2ZITA 4ZCLA 1IVZA 3U27A 1RLDA 4DU8A 2DNGA 4UQTA 4DR2J 5I3QA 5IM0B 1N4LA 1WC3A 4HKQA 3NGUA 1RU1A 1Q82T 4YP3A 2HQCA 1NEEA 2CQIA 2H48B 2VFVA 1Q8BA 3ILIA 3IGVA 4KE5A 5EWFA 2P6SA 2OPRA 4MK7A 2V69A 3CD6S 3FDSA 3OPKA 2C2MB 4LBPA 4RW9B 3VVTA 1S97A 3D1HA 2QL7B 3M32A 2HNDA 2GIFA 2LU1A 3U02A 1NRKA 1WEYA 3M2VA 3CB4A 4U8YA 2D1CA 4EZ6A 2IC3A 3THVA 2E1RA 3EVMA 1UVNA 2HQIA 1D3WA 1VJWA 3AH6A 3GZ7A 4IFVA 4DUZJ 1K1SA 5LSRA 1I1GA 4HH1A 4L72B 5J1PA 2XB2D 2YXLA 4O3RA 1TVRB 2FPHX 2GGPA 3NLCA 2VJVA 4EYIB 2YKAA 1RWVB 3MXHP 2BRLA 4RWXA 1NSPA 4Z2XA 3GIIA 4ZPAA 4WFYA 4ZPCA 4EU0A 5DQIA 3CCRS 3VAMA 4FXVA 3VAKA 4DR3F 1YIJS 1KVIA 2R2TA 2CNLB 2LA4A 1R89A 3ZC4A 4DR3J 2HAIA 5D6GA 2J7KA 1KBRA 2KVIA 5F0UA 4U95A 3JSMB 3RW6A 3FEYB 1TKTB 2CYYA 2XTJP 2IM1A 3DDIA 3NP5A 1FWLA 1AB8A 1VMBA 3M9NB 3QBCA 3IS9A 2B51A 1S1UA 1GMVA 3AOCA 3V81A 3D6MB 2DR5A 2GMJA 1LWCB 4EI2A 2UUCJ 4LQ9A 2J76E 1X5TA 3Q8YA 4AQYF 3HSJA 4WTYA 4DV5F 1WC4A 2DGQA 1TL7A 1LEOA 2MQLA 4IYQA 4PUOA 2GVDA 3MD1A 2GV1A 2P9GA 3W5ZA 5KFWA 2PDAA 3RBEA 2J0SD 4TQRA 2DNYA 3FSIA 5KFVA 3OVAA 4OYAA 4LF7J 4MKYA 1V3SA 1WKJA 4J90A 2JLGA 1AYEA 1GFWB 1QAYA 3NGKA 2DNLA 3ZZTA 5IZHA 3DI6B 2ZH5A 3RTVA 1NKCA 1HBMB 2BE2B 4FDFA 4EBCA 1MWZA 2HQGA 3IWNC 4WTOB 4MFBB 2J6SA 4HHUA 1MG7A 2ZZMA 3HHLC 2HRTA 4NLDA 3QRPA 3M30A 4G1IA 3VGSA 2JEGA 2HHUA 2E29A 2BEFA 3MPWA 4I2QB 4L3NA 4CLPA 1CJKA 3G71S 3RB0A 3DLBA 4YR0A 2YWFA 3BS9A 1S9EB 1RT7A 1VC6A 3H0PA 1RAHB 4OYMA 2QMWA 5C5JA 5DM7Q 3DOMA 3JXOA 4TQSA 1VQ7S 4CWBA 5KFDA 2HVIA 4ZN1A 2GO9A 2JFKA 4FKXA 2W4PA 2VHGA 3VALA 4LRAA 2DIUA 1YLXA 5HSPA 2DB1A 5DETA 4NCGA 3J7ZT 3BSNA 1HR0J 2MZ1A 1JXLA 5FJ4A 3BGRB 4U67Q 4IFYA 4PABA 1PKUA 1LNQA 5IC4B 1C0TB 4C6AA 2XC9A 4NLGA 2OMLA 5CZVA 1D9DA 1M5SA 3DRYA 1IWAA 1X4CA 5KG2A 5I4MA 2KHCA 4QYZK 3MUVP 3TZYA 1DQ9A 5CCMA 4RU9A 4K4VA 4KFBB 3OFFA 1V5VA 3C14B 4IOAQ 3EWGA 3NCRA 4O4RA 2MJUA 2VA3A 4PQUA 3EXCX 2YQ0A 1C1BB 2Z57B 3IS9B 2V2ZA 4DLEA 3N6MA 4HI1A 3P49B 3GG1A 1PIEA 2H9ZA 2KFYA 1LV5A 2CQ3A 3OFEA 5CH7B 3CEDA 3DDKA 4J9NA 2XSJB 4DR5F 2DR6A 3V6DA 5AXLA 3SV3A 3HULA 4LRDA 3GIRA 3S7RA 1OY6A 3G6VA 4CO2A 1R27B 3R7NB 4NLWA 1K0TA 2QA4G 1GMWD 2DTJA 2MJNA 1VGYA 4BLGA 4CLZA 4OI2A 1U2RA 4IDKB 3G82A 3D0IE 1FRXA 2DITA 1H72C 2AKWB 1C0UA 1VDHA 3VAHA 2Y1IA 1U0SA 3Q23A 4M5NA 3FFIB 4ATNA 1M1KT 2Z2ZA 3BH6B 2CPYA 3BR8A 1X4EA 3NOGA 4CNZA 5HQ8A 4IRKA 2XSJA 2HMIA 3SSRA 1S72S 1EARA 2H65B 4ZOSA 1LFWA 3F44A 3P45B 4JOUA 3MR3A 1WKLA 1UZDA 2Y8WA 2FC9A 1GK8A 3R5DA 3SDEB 2YNHB 1V3RA 1VRUB 2ZOMA 5E3QA 2CWXA 3M2UB 3KJQB 3JYTB 2OFGX 1FT8A 3HD2A 4OHZA 2MXYA 3CCUS 5DGAA 4UOFA 1Q81T 4OX9J 4YDXA 4MAKA 3TAMA 2ZC3A 3P5TL 2CDRB 1VQ8S 5JMNA 3LOUA 2ROGA 5ETLA 2XO7A 2HBQB 3ZZUA 1S76D 2QSFA 1N5SA 5KFBA 3CCJS 2GHPA 2XMUA 2AYEA 1SKSA 1X4GA 1YRXA 3H5XA 1YRUA 4UW2A 1TKXB 4FVCA 4ILRA 4Y34A 5KFLA 3W2WA 5J2PA 3PKMA 1T0TV 2CQDA 3DM2B 2DH7A 2HFVA 3MMCA 1BGXT 4KO0A 4OFZA 2CQHA 3BKTA 4URSA 1S5ZA 1RHQB 3UN3A 2ASLA 1YJUA 2O5DA 2BM0A 3W9JA 2W9AA 4LF6F 3QAEA 1SUQB 4DSJA 1GMWA 3HDSA 1HWLA 2VASA 5HK4A 1RAOA 2DKOB 4N5SA 4IKAA 4DPUA 3D54A 2XBPA 3FC9A 1NB2A 3FMBA 2KT2A 2XWYA 1HQEA 5A8WB 1RTIB 2QC3A 1TL5A 1WSRA 1KLNA 4RBTA 3PYGA 4RNFA 2HHHJ 2C2KB 3BZQA 3FZ2A 4C8LA 1VQNS 3C46A 3KLVA 3ILOA 3R97A 3LPYA 3V6DB 1EJ7L 3V4MA 4F3QA 2DNMA 2P9EA 3H7HB 2MZTA 4JI5F 2UUBF 3J81Y 1FESA 2HZCA 3MMAB 2GS8A 4ED6A 3CDEA 1S10A 4Q7AA 1K47A 2N4DA 3MEKA 1S0NA 3MR5A 5GAEI 3GFYA 4F4WA 1UL3A 1VQ5S 1XNQF 1RWNB 2BJ1A 4ELUA 1WF1A 2MY8A 4IR9A 5HROB 4EO6A 1RAAB 4KHMA 3SQOP 4W90B 3WZ0A 2PA8D 3TWZA 2DCLA 4QWEA 2AJFE 4KY3A 3ZFVA 5D3GA 3FZBA 3HHNB 5F41A 3UDVA 4PXDA 4ED8A 2VFRA 2DHSA 1VQLS 3NGRA 2E5LF 4PPDA 2MKIA 3PACA 1NSAA 2AP6A 4OI1A 4OZLA 5LMUF 3QIDA 3UCGA 1WOOA 3EMTA 2E5HA 4YB6A 4EBEA 1VQOS 2PIIA 2Q79A 5KT6A 2KYZA 4HACA 5D4OA 1JLEA 4ZPDA 4Q0BB 4P7TA 2KTQA 2EK6A 2XLJA 2UUTA 4V19J 1JJCB 1N8RT 5F8IA 3IP0A 2LMIA 3A3PB 3ZTQA 5DZ7A 2DGXA 2LDIA 4CRJA 6FD1A 2ZJRQ 2VOOA 3PKYA 1Q7LB 2IMOA 4A8YA 2YX1A 2BKNA 3MM8B 2HGNA 5J2PB 4WJBA 2FVPA 2XY5A 4PRFA 2SXLA 3PFEA 2IVFB 3J7A1 2B3TB 3TUZC 4K8RA 5H9EJ 2V0NA 4L3KA 3QRQA 1WG4A 2HHSA 4JYAF 3H98A 1SXLA 1Y3KA 2Y0BB 1HNZF 1F60B 4EUVA 2APOA 1VRTA 1SKWA 1S9GB 1C4CA 3FJ2A 3UR0A 3KOAA 5B0CA 3TX8A 1QM9A 2HBYB 2AX0A 4CTAB 3I4PA 1N6QA 3RRKA 4DR5J 4DR1F 1HNIA 4KB7A 3KK3B 5FD1A 2J5AA 1DAXA 2E44A 5DJBA 3HMJG 3C66A 4IQMA 2F8HA 1Y3JA 1QUPA 3HK2A 1FTCA 1W25A 2FHOB 4O44A 4F4XA 2GW8A 4G65A 3EVWA 4PEOA 1IKWA 1RXOB 2PGCA 2HG4A 3DOLA 4PXBA 4QCLA 2YWEA 2K7KA 3DU5A 2WSCC 4QW9A 2CDQA 3NOCA 5IQQA 1F2GA 4OJGA 4KFBA 3GIJA 2VPZB 4H4OA 2B9WA 1WC0A 5KAKA 2LQ8A 4M5HA 4OX9F 1NJZA 1H98A 1R6VA 3D7SB 3ELHA 4AL7A 3D4JA 1RWUA 4YOEA 2KG1A 2JSXA 1HARA 3B82A 2BE9B 5LXRA 3UDCA 3PYFA 3VVUA 3KTQA 3MOJB 2Y3YA 5HMXA 1VI7A 4NOHA 4F0HA 1LWEB 2I5JB 3KMQA 4KGVB 3RGIA 3T9NA 4NXMJ 1WWHA 4ECUA 1JLEB 3BSOA 4USJC 3V4IA 3QPIA 1OSCA 1RT7B 4MIAA 3PW5A 2C42A 1HLWA 1N34J 1S59A 1WDTA 2NXJA 2EXUA 3TA1A 4C11A 4B9NA 2ZZNA 2MMYA 2J6UA 3GU0A 2ATCB 5KFXA 1NU4A 4DV0J 4Y6IA 1B99A 4QQBA 2PI4A 2MKSA 3L95X 2RS2A 2HWTA 1H2VZ 4ZPTR 4A48A 5ADZA 2ABYA 4G1PA 4AE5A 2ZDOA 4DL2A 2E9ZA 4LFBJ 2K1RA 2L3MA 3DLGB 1ZM9A 2J0QD 2GJFA 1T9VA 2IIHA 1LW2B 3BPSP 3IWLA 4FPIA 1HWKA 4CDIA 4HEA9 2V50A 5C24B 3S8SA 3VAJA 4M1KA 3Q89A 2G13A 4GMKA 3BJYA 3D0GE 4DV7J 4K4UA 3O6QA 1TKDA 3BBBA 3QIPA 2JC0A 2JVRA 3V6HA 3BSCA 1TU0B 1PAUB 2FVCA 4RO0A 5F8LA 4M5MA 4ECTA 4JI6J 4WFBQ 3PM9A 2G2YA 2WB1D 3IR7B 4RUBA 3MFIA 3EX7B 2CPDA 1IBLJ 5IC6B 4DSEA 1WHXA 1JLQA 2XMVA 4ZCIA 2EWHA 2IHR1 2OEMA 3PFOA 5LMUJ 2NREA 3NNCA 1PG5B 2E7VA 3FK4A 3DGVA 4RLEA 3OLBA 1WC1A 3TZWA 3RR7A 4ECYA 1OJ4A 1NLKL 3W2WB 4WFAQ 3A3NB 1QSYA 1YJRA 3IM8A 1IKXA 2NXCA 4ZMMA 4WYWA 3MUTP 4C97A 3CCMS 2PI5A 3MCSA 2FY1A 3I87A 1RBAA 1Z2LA 3M9MB 1S1TB 2RNEA 1CS4B 3EM1A 4H4KA 4K5RA 3JAMU 3NBPA 2DPIA 2HYIB 2DGOA 2EKYA 4NXNJ 5C42B 4MKVA 3UE2A 4NEYA 2G0CA 5LSLA 1JLQB 1FXLA 1PSDA 4A8QA 1U1NA 1HQUB 2Z56B 2R8KA 4OV1A 1WNEA 1Q4RA 1ZBTA 1BQMB 4KV8A 3TVYA 1IR0A 2AGPA 2AZ3A 2CQ0A 1SIZA 3BPDA 1HWJA 4YB5A 2MLZA 2R7OA 4Y28C 4ELTA 2M5YA 4LF2A 2NR0A 2GMHA 2XMMA 3M2UA 3NMRA 4PG7A 3TUJC 2GQ2A 4LBIA 4AD6A 4DQRA 4DOZA 5KFFA 4KPYA 1FRLA 2IM3A 1MW7A 2YKMB 3N0VA 3AD9C 3OR2B 1X4DA 5E3RA 2F8MA 4URGA 1CQNA 2V4RA 5L1IA 3C6UB 3OTEA 5KT5A 2V4QA 3WIUA 2QEXS 4TXSA 3TP2A 3C3LA 1RWXB 3FBCA 4JP8A 2KFNA 1S1UB 1X5PA 4FP9A 3LWLA 2ZZTA 1FRHA 3GP9A 5EWEA 2IFXA 4DF4A 2ATLA 4O3PA 1IBKF 1BQMA 1TKXA 1TUGB 4KV8B 2EFVA 5EN1A 1XMBA 5B0AA 2XYHB 2M3DA 3BGLA 3IR5B 2CQCA 5THWA 3G86A 1SPBP 3WC2A 1I6JA 1ZAXA 2BKPA 4QYRA 5B08A 1QD1A 1RHUB 3M2VB 5DG7A 1Y5LB 3OJUA 2FVSA 1JLGB 3HM9A 2F8EX 9ATCB 3CWJA 1L3KA 1NM2A 1N0UA 2HRUA 4QU7A 3KYLA 2FYXA 4IFVB 4OI6A 1N0VC 1VC0A 5E7OB 1WJ9A 1URRA 2LXIA 4CH7A 2MLXA 2U2FA 2IRUA 3LP1B 2QT7A 3Q8SB 1N36J 2VU5A 1M0SA 2ZE2B 3L7PA 2UV8A 4DS4A 3N28A 3W7BA 1X9SA 4QU6A 2HHWA 2XY7A 3MECB 4QIFA 4QPTA 3F41A 3WQPA 4B3OB 3VQSA 3L7OA 4P2XA 2JEJA 1KHVA 3VGTA 3DLKB 3ENAA 4USKA 4GC7A 2HHTA 2NSBA 1ICEB 3MEEB 4P10A 3F56A 3TARA 1T3NA 2KXNB 1YQHA 1UMJA 3BGFA 2EK1A 4N8OA 2R7SA 2KJWA 1Y10A 3ZZPA 1Q53A 3MM6A 4KIAA 2C2EA 1FERA 3FBFA 1RWOB 4C0BA 3J7YU 2R7WA 5KFUA 5KG1A 2V9WA 2FY8A 2VC1A 2XCPA 1Z1ZA 3CDAA 4OHWA 3NS6A 2ZM6J 1ZTTA 3K5NA 5L9NA 4IR1A 1RLCL 3AA8A 1XWLA 2B56A 2YKNA 4J9OA 5KFCA 5J2QA 2O3DA 1NJWA 4B3OA 5CQGA 4CZCA 4DX6A 2WSEC 4JI2J 3E01A 1NPPA 5HO4A 4ZP6A 2BQ3A 2JZ5A 3H8YA 1G6BA 2OIHA 1OSDA 2UXBJ 5F3ZA 3MEEA 2UVUA 3OW2R 3SMZA 3EICA 3I5AA 3RB6A 3QO9A 4B3MJ 2G1DA 2PMWA 5JUMA 3NKYA 2ZM6F 1VBZA 3OR1A 4JI5J 5F0WA 5J2MB 2HFZA 5AE2A 1SKRA 1RB0A 4MT1A 3T1YJ 3I32A 1L3TA 2XS5A 4F36A 3PJXA 2F4FA 2Q43A 1HPZB 2GQCA 1EKRA 2B5JA 3OT9A 1YSJA 2CQ4A 1FFSB 4O44B 2V63A 5HVGA 1JKHA 1NKBA 3KUEA 3TOQA 2YX7A 2DISA 5CA5A 2HGMA 4UOGA 3E01B 2E5LJ 4I56A 2V8VA 2F7VA 5DQHA 1NHUA 2MZSA 2YY3A 1BUXA 2W8LA 3W62A 2ZH6A 4JI7J 1RUSA 1UFKA 4KGMA 2R7UA 4W92B 4LJMA 1U1QA 3HT3A 3DOMB 1VRTB 2RT3A 2R9LA 4J9UE 2BZ2A 1HQ2A 2DXFA 2V4JA 5HBMB 4J9RA 2F5GA 3U1MA 3B54A 4IDKA 2GIQA 1TFWA 2HLTA 4K50A 4ANEA 5FLXU 2B4OA 1TR0A 4U8VA 5AJ3J 4NCGB 3QFHA 2K7JA 3OHAA 4RW7B 1RT5A 2L9NA 3EGNA 1HBUB 1V3ZA 5J2NB 2OAUA 3PRVA 1R3NA 1KHWA 2CUYA 4X65J 5AJ3F 5J1EA 1HR0F 1JXEA 3DKDA 1TL7B 4M8LA 4WK3A 1RTHB 4MH8A 4ZDNA 2XHWA 1TKZA 2VFTA 2WB4A 5BYRA 1HHTP 1IM4A 1VQMS 3CD7A 3IBWA 3PW0A 1HNXF 4K4YA 1R8PA 5KG5A 2Z2MA 4KC5A 2RHSB 2CJKA 5ETSA 3NAIA 2XNQA 2HK2A 3D67A 4J7CA 1FK9B 2BYCA 2Z2YB 2PMZD 5GAGU 4RUHA 4KBIA 1J5EF 4AL5A 2CJXB 2RSQA 4NL5A 2GA7A 2WHOA 1ACMB 3AFGA 1ZA2B 5HQMA 5ETPA 1SL1A 1D8YA 2WCXA 2VONA 2X7IA 4FVMA 3ZZRA 3F0NA 1I94J 1Q16B 3PO4A 4USWA 3TRGA 3U1LA 3C6TB 3R6GB 2H3EB 3BGUA 4O0IA 1HNZJ 3TX0A 2UUCF 3BKFA 1MLAA 1NDPA 1RZMA 3EZ5A 1DQ8A 2JEFA 3IG1A 4C8YA 4Y2AA 2LDYA 2XYGB 4R8UA 2DR7A 4YDDB 2M9KA 4OX7A 4DUTA 2K8GA 4HTJA 5I3PA 3M8QA 3BM7A 3MTKA 3GV7B 1R0AA 2P9CA 2UU9F 1HQEB 2DHGA 4OZ2A 1TQLA 1U1PA 2BJ8A 4GKJF 1ZM3A 3FFIA 3ZTOA 5L8RC
chains in the Genus database with same CATH topology
1Z4UA 1A9NB 3ZZZA 4NXMF 4CO3A 3NCPA 1N33F 4WFZA 5HN0A 5HMWA 5E2QA 2DGUA 3DN9A 3ENWA 4NLOA 3UI3A 1N36F 2ZBCA 3CPWR 2XS2A 5KFOA 1BQNB 2W8KA 4NLYA 4QR0A 2KRBA 2JX2A 1QAXA 2V4JB 3FEXB 3I82A 4ZPWR 3DRRA 2R7RA 3QGPA 2IA6A 2YKQA 4O3SA 3PIPQ 1KVJA 2F1FA 5EHHA 4U6PA 2VBZA 3R1LA 5L1LA 2J9DE 3DU6A 1RT1B 1X4AA 1RAJA 4I64A 4UY8T 4CQ1A 4DSFA 3MPVA 3IR6B 3LALA 4LF7F 4RNMA 4QIEA 2ZHOA 4IRCA 1EETB 1MROA 4XIUA 2DK2A 2Q6BA 2D9PA 2HNZB 3JTNA 3G8TA 2HIQA 2CPZA 3TW0A 4P2SA 4HDGA 3KLFA 4I69A 1FJCA 4C8NA 5KFMA 1UJ5A 5F9NA 2M52A 2OH2A 2LQ5A 1ULRA 2KB2A 2IMWP 4OL8A 1EETA 2J9CA 4M94A 3M32B 2UXDF 3GSDA 3DLKA 1IQZA 5A0YB 1QSSA 1XTZA 3KLIA 2XCAA 3TI0A 2VQFF 4ED3A 2R7VA 3CO9A 1M5PC 3LP2A 3IN5A 3POTA 4U9RA 4PR6A 4EBDA 2VA2A 2QE5A 1S1XB 3LP1A 1SJQA 1HNIB 3HHEA 4I4BA 2WBRA 3UDLA 4NWBA 6FDRA 3LQVA 3H40A 1YITS 2RF2B 2BR0A 2KT3A 3BQ0A 4P6QA 2BBEA 1UA0A 5F8GA 3KLGA 2XEXA 2YKPA 4I6WA 3DRPA 4LFCF 1RT4A 3PY8A 1QLNA 1FVSA 1S1WB 1I94F 3CC2S 5E41A 4GKKF 2JEIA 1JNZB 5L1KA 4RUAA 2MQNA 3M1VA 4MJKA 3ZZOA 3KHLA 2R4FA 1HNVA 3PHEA 3CCQS 1Y5IB 4ELVA 2FJVA 2VFUA 3JSYA 3MPYA 2UP1A 3ITHA 1RKIA 1GX5A 1NK8A 1L5UA 2R8HA 3DCAA 1N5VA 2OSQA 3VCDA 4IFYB 1WEZA 2RRBA 2YWKA 3ZZYA 3J7YI 2Y0SD 3PW7A 2DT9A 4DN0A 1LWFA 4L6V3 1U6ZA 4X66F 3N6LA 4RW4B 1YJTA 4K4XA 4RBUA 1CG2A 4IG3A 2DGWA 2ZBIA 4JUZA 3V2UC 4B9MA 4ERDA 3MR6A 4DHVA 4UOCA 4MMOA 2F40A 4I2PB 3ITHB 3SCJE 5HP1B 2QLWA 1UKUA 3BF4A 1QUVA 5K8NA 2Q66A 1N54B 2EFQA 4C8ZA 3GV5B 5B0DA 3CCES 3CDBA 2VB6A 1RTHA 2E5IA 1RT2A 1U1KA 2A3JA 3D0HE 5LSOA 3R5CA 3TANA 1GXLA 3OTBA 3T6BA 3X1LB 2FHJD 3RBDA 4HT5A 4C4WA 1RKJA 4Z37A 1HA1A 1R6YA 4DV3F 1U49A 2UVVA 4Y0FA 1C1CB 1VQYA 4ED5A 4DJBA 1RT5B 4I2PA 4ID5A 4QWDA 2XWXA 1OS5A 1U25A 2Z2LA 2LXFA 3OJSA 4X4QA 3MM5A 4A8WA 2OPPB 1N5YB 2MZQA 3CCVS 4ZK7M 4Y2MA 3BB5A 3GFXA 1P9QC 4ECSA 4NA2A 3SFUA 4F3OA 3T5HA 3SEOA 1NH7A 3M8PB 5A8KA 2FLLA 3T6JA 4TU7A 4BBYA 3HHDA 4RW8A 4P7VA 1JMTA 1S99A 5KT3A 4X4UA 4DFKA 1AFJA 5KFZA 3CSKA 1RTJB 1LW2A 3QMQA 2Q1LA 1GT8A 4Y2IA 3GR1A 3JB9k 2UUAF 2MPUA 1APSA 3OUYB 3CMAS 1G2EA 2D3UA 3DMJA 1TFYA 1Q1KA 1ZAWA 2VZ9A 1U1OA 3HHLB 5D77A 2OTLS 1FVQA 3PR4A 2D9OA 1DURA 2FJWA 3G6YA 2J9EA 1TL1B 3MUMP 4I0WA 3MFHA 4B3TF 3OFGA 4B9UA 1NK6A 2ILYA 3CJ0A 4TY8B 2I5JA 5B0GA 3MEDA 3DRSB 3JSRA 3KLHB 2O67A 2HGLA 2NQPA 2W7AA 1KOOA 2QA1A 3K8WA 1OO0B 2E66A 2FLOA 3KWMA 4URQU 4ETZA 4B3SF 3QJPA 2E9RX 1FRMA 1HD0A 2MSSA 1KTVA 3MMBB 2HNZA 2VPYB 2VKZG 4AL6A 2J8AA 1R0AB 1FJGF 4CT8A 4D3HA 1GQEA 1KQGB 3LH2S 4MKAA 4ID5B 3GILA 1P1LA 1UJ6A 1Z2ZA 4J5OA 4LQ3A 3LGNA 4PCQA 4HI2A 5I42A 3H5YA 2BANA 3H4BA 2FVQA 1JK9B 2GIRA 1BD6A 1MROB 3ENQA 4DFJA 1H38A 1Y0HA 2YNFA 2PT0A 2W9BB 4CIOA 3FQLA 5E33A 2GC8A 4Q0BA 3CIZA 2ZOGA 4NLPA 3I5BA 2JDJA 1K1QA 4NLSA 3U1NA 3SXLA 1D1UA 4G1QB 3DLLQ 1KQFB 1GXUA 2MQMA 2YNIB 2KXFA 3B4MA 4N47A 2M8DB 1B0VA 1RT6A 1KS2A 3MHYA 5ITHA 2HHHF 2FDNA 4ZVFA 3MD3A 3PV8A 4WCEQ 4J9LA 3OUYA 3FVYA 2C3OA 4JI8F 3NL0A 2AV5A 4DLGA 2BACA 3DGPA 4LSNB 1BWEA 4GC6A 5KFKA 3HXMA 4QW8A 3T5LA 1M5HA 4H4MA 5C25B 3GIMA 3M2RA 2J0WA 2AWZA 3FRYA 3AY0A 4OHXA 4YR3A 1FF2A 2RS8A 1MWYA 1YJVA 3S6EA 5D3GB 5CCLA 3ZZ0A 1TVRA 2AD9A 2ZVSA 5M2UA 2EVZA 1Q7YT 1J2VA 1N56A 2ZH2A 1VBXA 4HT7A 1XC9A 5K9FA 4J9MA 3TAPA 3VAGA 3R5BA 1FKAF 1VK8A 3TNVA 4QWBA 1W2BR 3HVRA 1LWFB 1OIAA 3SYZA 1E6VB 4QIWD 3DHWC 5CHCB 2D74B 4RNOA 4EEYA 4ES3A 2HLUA 1DHMA 5C25A 5SZTA 1IJEB 2GJ2A 3DI6A 1TKTA 4WU3A 3V6JA 5HLFA 3I56S 2B6AB 2KHDA 3D1QA 5J2NA 4CO1A 4PQAA 2IRXA 1X9MA 1RQ0A 4FYDA 4GO7X 4ZA1A 4DL4A 1HHSA 4TYBA 4F50A 3K5PA 2MZJA 3CJ5A 5AXKA 4CNYA 4Q8FA 4XK8C 5HMYA 3UD3P 1NZAA 4WXWA 5DDRC 5GADU 3H2LA 3K2YA 4RW4A 1YWXA 3AB2B 2FUG9 2O01C 2WONB 2AGOA 1HBOB 2V8DA 3N01A 4Y00A 3KOAA 5DM6Q 4CO0A 4QIGA 1S79A 1UP1A 4G1QA 1S6QB 1BLUA 3RYLA 5HL7Q 3KJVA 2CQPA 1NB7A 4DV4F 1SL0A 1S0MA 1TAQA 3KNGA 3AJ1A 5JVGQ 1JKHB 1LOUA 2B4UA 2EFPA 2CJBA 4PWUA 1S0VA 3G4SS 2E1MC 4QIVA 3HF5A 4YFUA 3FSYA 2FJDB 5IQ6A 2EFNA 1KD1T 4DBQA 3WDOA 3FSXA 5E0OA 1HBNB 1OQ3A 5HBMA 2AJ0A 3CIMA 5K14A 3Q8QB 2BOPA 4JV1A 2VG7B 4RW7A 4C3KA 5GAHI 3SQGA 1S1VB 1UWBB 5DLGA 1HL6A 1SV5B 3T19A 2WRMA 2X51A 2CQBA 4ECWA 3PR5B 1TL3B 1RT3A 2B9XA 3DLEA 1O0PA 2Q6CA 3VAIA 2FGCA 4EWTA 3OVBA 3LAMA 1Y00A 4DL7A 4X4VA 2W25A 2YQ3A 4R5PB 2C3UA 2DRBA 4O3QA 3WBZA 2OD4A 2HS3A 3JTOA 2AYGA 3BO4A 1DARA 1VQSA 3DXSX 3D2WA 4A8SA 2VG5A 1S0OA 1S1VA 2J9DA 1TL1A 5FIIA 2KKHA 3MGJA 5DRKA 2UXCF 2V9KA 4J9KA 4R0JA 3GWCA 1Y9OA 2GCFA 3N6NA 1MNEA 1XN9A 2HHPA 2ZKUA 1TK8A 3AHPA 3I0RA 1VFJA 1JX4A 2VBXA 4X4NA 4O4GB 4FXWA 1DTTB 3D5MA 1KLMA 1HWIA 4CO4A 3VZIA 2NS1B 5E5NA 3LP0A 3OVSA 5KFRA 2QV6A 1KN6A 2CQ2A 1S6PA 3NAHA 1F5AA 4NZ0A 3KFWX 3C6UA 3M6VA 2HRYA 4OIXA 2AW0A 4KKOB 1FA0A 4PWDA 2N3LA 3IO1A 1REVB 2A18A 4IH7A 2XMKA 2POKA 3M9OB 2NUHA 3AQOA 1WD6A 4MK8A 2PE8A 3JAMY 4DR4F 2DVIA 2IM0A 1RA7A 2D41A 3TAQA 2XGPA 1WELA 1WHYA 1U8SA 4USHA 4JI6F 3SI8A 1T05A 2R8GA 3AA9A 4NZ6A 2IA0A 2L08A 3OTCA 5K14B 4F2SA 2UXBF 3R5AA 2EBEA 2OPSB 4WE1B 3O2IA 3CCLS 2DNOA 1YJWS 3C8YA 4KKOA 3OXFA 2KDOA 4I7FB 5CYJA 2J7WA 4LF8F 3AQPA 2EFOA 1FKOA 3HHLD 3L3CA 3PO5A 1YHQS 1LWCA 3C6TA 1U09A 2N7YA 4RX6A 2EBGA 5HMZA 1U1LA 5CXTA 2A2DA 1N52B 4FBTA 4DR2F 4LSLB 1ZTWA 2DPIA 2QMXA 4NA1A 3GB0A 4R8UB 2LQBA 5D4PA 1FE4A 2W9CB 1GX6A 4DR6F 3ONQA 1N48A 2M2BA 4ID8A 2GX8A 4NMLA 1FD2A 4X64F 4ITSA 4EYHB 5DG9A 1PILA 4F67A 5F8NA 5DLFA 3MAQA 1GNKA 4IUFA 2CJQA 5B0EA 4B9SA 1FKOB 1HW9A 2GFFA 4NLUA 1RYRA 2MHNA 2DR9A 2JWNA 1SC6A 3H5UA 3UFCX 2M0GB 2HHXA 1ZAVA 3FRZA 3M30B 1FXDA 4ZKAA 4FF4A 2V2KA 3T5JA 5IFMA 5IXUA 4N76A 4C8KA 5K5MA 1DRZA 4DR7F 5FDLB 1RTIA 4B9VA 3JSMA 4DUZF 1JJ2R 3G8SA 4K4ZA 5HROA 3S1TA 4TKTA 2WOMB 1NK7A 2RUGA 2DHAA 1FXRA 4X2BA 4ECVA 3KHGA 3SV4A 4IG0A 3KK1B 1P6TA 2HWIA 1KTQA 4NCBA 2MQPA 3CVKA 2HHQA 4LF9F 1D8ZA 3DC2A 3J7Z5 4C98A 2RDIA 4DL0C 1N88A 2CKWA 2VPXB 3I9ZA 3I55S 1S48A 2WK4A 2DNRA 3IA0A 4XAKA 2FLPA 2ZH9A 4F3MA 1J5OB 4H4MB 2LLZA 3PXGa 3QYYA 2LEPA 2OO4A 4OI3A 3SFGA 4M95A 1XMQF 2LECA 4DQQA 4C2MA 1W2IA 4DSKA 3OXGA 3RZAA 1WI8A 1IKWB 1WEXA 2YKNB 2BV3A 3US5A 5KT7A 1FO1A 1JNRB 4PG4A 3TQ1A 4A8FA 4NCAA 3OTOF 2ASJA 1SJRA 2BABA 2W24A 4OJ1A 5A0YA 3THTA 3GIKA 1T7PA 1D0EA 3KLEB 1DZ5A 2G9OA 2IYGA 1JWWA 5KOWA 1WTFA 2I2YA 4N8NA 1S9GA 1YG0A 2RKIA 1CQMA 4FF1A 3U7JA 5CD4H 2JJ4D 4OJ3A 1GTEA 2KG0A 2J0XA 5T7LB 3EPIA 3TA2A 4DL5A 1LWEA 3PNIA 1TL3A 4BWMA 4LFAF 2ILZA 2GQQA 1KONA 1D9AA 4BWJA 1U1RA 1UJ4A 5J1NA 2V94A 2DCUB 1N5QA 1XEZA 3BR9A 4J9PA 4B9LA 2G4BA 2HHVA 1FDDA 3GE9A 4WF9Q 4G3IA 3GFHA 4CTAA 2VUGA 3ENVA 3DLJA 3KK3A 1UWBA 1VHFA 3OQ2A 2XY6A 2BQRA 1NAQA 4IG0B 3KK1A 1K0VA 2CVIA 1VS3A 2DNZA 2BA9A 4WIIA 1U48A 1IKVA 3LUYA 4KGKA 2HFOA 3HJFA 2VFSA 3CCZA 1NJIT 1TKZB 4ZPVR 4EO8A 4ZP9A 3MR2A 1HYSA 3MZIA 3OLAA 1UVMA 1JLFA 3TYTA 3W2VA 3OSPA 4XO0A 4B02A 1SJ3P 3M8PA 5A8KB 1TUVA 1UVJA 2AJ1A 3S01A 3MEGB 1JLCB 3E2EA 3N4WA 3SQGB 2ZH4A 2IAJA 3DOKA 5KFYA 4XPEA 1L3UA 5LL6d 3FCHA 1FKPB 1ZZNA 3QJLA 4NRUA 5LXYA 2PO4A 3MMAA 2ZH8A 1IQTA 3NRBA 2NZ4A 3Q22A 5IT0A 5AXMA 4B17A 4A8MP 4U7UK 4FBUA 1QAJA 4OZ0A 2DD8S 1HFEL 3JTPA 1S6UA 3QIPB 3IAM9 4LUBA 1HI8A 4WE1A 4C3MA 2KI2A 2J6TA 5EX0A 4C8MA 4ILMA 2IAJB 2RH3A 2MGZB 1RYSA 1KC8T 1TP7A 3RU0A 4BC9A 3JSBA 1FKPA 2E7WA 3HVWA 1U7LA 3K57A 1L3VA 3O3LA 5D4NA 4D3GA 5AE3A 3PEJA 4ES1A 3SCKE 4R0EA 2YKMA 2K2PA 3Q0AA 3X3UA 4F8RA 4USIA 4TU8A 3MOZA 4HVZA 1U2FA 2VD3A 1ZETA 3EYZA 1FDBA 5M2PA 2D7SA 2ZDPA 5H9FJ 4Y65A 1VLYA 4F4ZA 5IS2A 3DYAB 5BR8F 2RB7A 4PG6A 2NSCA 2YNFB 1KFDA 4Y2CA 1TV6A 2HNYB 1RT4B 4X4PA 4O3NA 4DF8A 1C2PA 4DSIA 4PQUB 2A10A 1H7WA 4ICLA 3LF0A 5KFNA 1HWUA 2C28A 2VKRA 1MU2A 2UZAA 3MF5A 1U24A 3VR1A 4DFPA 4JV5F 2V8HA 4YY3F 2KZZA 2NUUG 3K5OA 1SIWB 1F9FA 2HNDB 2QYCA 2DO4A 1BC6A 1A7GE 1WF2A 3HZGA 2X3GA 2F9DA 5M2RA 1NHVA 5DG8A 3PRBA 2WOMA 3CT9A 3OXLA 1NK4A 2EPIA 2RILA 3UW1A 2X1AA 4LF4F 2VL1A 3BN7A 4PXEA 1AW0A 3T1YF 2XMWA 2RU3A 2RD5C 1F5BA 4AUKA 4UUWA 5D78A 3KLGB 2R7XA 3K7RA 4DEZA 2EFGA 3UPFA 2AJQA 5IWAF 2XMTA 2B4VA 3N5FA 1O8BA 4MYTA 3NGDA 1N6QB 2PEHA 2RKIB 3IRXB 4NXNF 4LIRA 5BJRA 3CJ4A 2N7CA 3H2UB 2CJAA 1DTQA 1WHWA 5GAHU 2JFDA 1RT3B 1WG1A 1KOHA 2R8IA 3OHBA 1TV6B 2HNYA 2ZFHA 1M5OC 2IRYA 3RAQA 3RRGA 1UVKA 4PXCA 1IKYB 5LJ5Y 1SH3A 5EDWA 4CH0S 4DFMA 1P1TA 2R2RA 1VQ4S 2OTJS 4WZQA 1DLOA