2REAA

Crystal structures of c2alpha-pi3 kinase px-domain domain indicate conformational change associated with ligand binding.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
DGRIKEVSVFTYHKKYNPDKHYIYVVRILREGQIEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHGSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containi
publication title Crystal structures of PI3K-C2alpha PX domain indicate conformational change associated with ligand binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 30
structure length 116
sequence length 116
ec nomenclature ec 2.7.1.154: Phosphatidylinositol-4-phosphate 3-kinase.
pdb deposition date 2007-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2reaA00
1KQ6A 1OCSA 3LUIA 3P0CA 3HPCX 4HASA 4OXWA 2IWLX 4PQPA 4AKVA 4BGJA 1XTEA 2AR5A 4PQOA 2RAJA 2RAKA 4PZGA 2L73A 4IKDA 4IKBB 4AZ9A 1O7KA 2REAA 2CZOA 4ON3A 2CSKA 2ETTA 3FOGA 2V14A 2DYBA 4P2JA 1XTNA 3IQ2A 1OCUA 4IKBA 1KMDA 2I4KA 2RAIA 2REDA 1H6HA 3DYTA 4P2IA 2WWEA 2V6VA 3HPBA 1GD5A 2YPSA
chains in the Genus database with same CATH superfamily
1KQ6A 1OCSA 3LUIA 3P0CA 3HPCX 4HASA 4OXWA 2IWLX 4PQPA 4AKVA 4BGJA 1XTEA 2AR5A 4PQOA 2RAJA 2RAKA 4PZGA 2L73A 4IKDA 4IKBB 4AZ9A 1O7KA 2REAA 2CZOA 4ON3A 2CSKA 2ETTA 3FOGA 2V14A 2DYBA 4P2JA 1XTNA 3IQ2A 1OCUA 4IKBA 1KMDA 2I4KA 2RAIA 2REDA 1H6HA 3DYTA 4P2IA 2WWEA 2V6VA 3HPBA 1GD5A 2YPSA
chains in the Genus database with same CATH topology
1KQ6A 1OCSA 3LUIA 3P0CA 3HPCX 4HASA 4OXWA 2IWLX 4PQPA 4AKVA 4BGJA 1XTEA 2AR5A 4PQOA 2RAJA 2RAKA 4PZGA 2L73A 4IKDA 4IKBB 4AZ9A 1O7KA 2REAA 2CZOA 4ON3A 2CSKA 2ETTA 3FOGA 2V14A 2DYBA 4P2JA 1XTNA 3IQ2A 1OCUA 4IKBA 1KMDA 2I4KA 2RAIA 2REDA 1H6HA 3DYTA 4P2IA 2WWEA 2V6VA 3HPBA 1GD5A 2YPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ6 A;  1OCS A;  3LUI A;  3P0C A;  3HPC X;  4HAS A;  4OXW A;  2IWL X;  4PQP A;  4AKV A;  4BGJ A;  1XTE A;  2AR5 A;  4PQO A;  2RAJ A;  2RAK A;  4PZG A;  2L73 A;  4IKD A;  4IKB B;  4AZ9 A;  1O7K A;  2REA A;  2CZO A;  4ON3 A;  2CSK A;  2ETT A;  3FOG A;  2V14 A;  2DYB A;  4P2J A;  1XTN A;  3IQ2 A;  1OCU A;  4IKB A;  1KMD A;  2I4K A;  2RAI A;  2RED A;  1H6H A;  3DYT A;  4P2I A;  2WWE A;  2V6V A;  3HPB A;  1GD5 A;  2YPS A; 
#chains in the Genus database with same CATH topology
 1KQ6 A;  1OCS A;  3LUI A;  3P0C A;  3HPC X;  4HAS A;  4OXW A;  2IWL X;  4PQP A;  4AKV A;  4BGJ A;  1XTE A;  2AR5 A;  4PQO A;  2RAJ A;  2RAK A;  4PZG A;  2L73 A;  4IKD A;  4IKB B;  4AZ9 A;  1O7K A;  2REA A;  2CZO A;  4ON3 A;  2CSK A;  2ETT A;  3FOG A;  2V14 A;  2DYB A;  4P2J A;  1XTN A;  3IQ2 A;  1OCU A;  4IKB A;  1KMD A;  2I4K A;  2RAI A;  2RED A;  1H6H A;  3DYT A;  4P2I A;  2WWE A;  2V6V A;  3HPB A;  1GD5 A;  2YPS A; 
#chains in the Genus database with same CATH homology
 1KQ6 A;  1OCS A;  3LUI A;  3P0C A;  3HPC X;  4HAS A;  4OXW A;  2IWL X;  4PQP A;  4AKV A;  4BGJ A;  1XTE A;  2AR5 A;  4PQO A;  2RAJ A;  2RAK A;  4PZG A;  2L73 A;  4IKD A;  4IKB B;  4AZ9 A;  1O7K A;  2REA A;  2CZO A;  4ON3 A;  2CSK A;  2ETT A;  3FOG A;  2V14 A;  2DYB A;  4P2J A;  1XTN A;  3IQ2 A;  1OCU A;  4IKB A;  1KMD A;  2I4K A;  2RAI A;  2RED A;  1H6H A;  3DYT A;  4P2I A;  2WWE A;  2V6V A;  3HPB A;  1GD5 A;  2YPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...