2REDA

Crystal structures of c2alpha-pi3 kinase px-domain domain indicate conformational change associated with ligand binding.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
114
Chain Sequence
MDGRIKEVSVFTYHKKYNPDKHYIYVVRILREGQIEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMRTHIKDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHGSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containi
publication title Crystal structures of PI3K-C2alpha PX domain indicate conformational change associated with ligand binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 27
structure length 114
sequence length 117
ec nomenclature ec 2.7.1.154: Phosphatidylinositol-4-phosphate 3-kinase.
pdb deposition date 2007-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2redA00
1H6HA 2I4KA 4P2IA 2DYBA 4OXWA 3DYTA 3IQ2A 3P0CA 4IKBB 4AKVA 4IKBA 3HPCX 2REAA 2CZOA 4PQPA 1XTNA 4PQOA 4AZ9A 4HASA 2IWLX 2AR5A 2RAIA 2V14A 1OCUA 1O7KA 4PZGA 2CSKA 2YPSA 3HPBA 4BGJA 3LUIA 1OCSA 1KMDA 4ON3A 1XTEA 2WWEA 4IKDA 2RAKA 2REDA 1KQ6A 3FOGA 4P2JA 2RAJA 2L73A 2V6VA 1GD5A 2ETTA
chains in the Genus database with same CATH superfamily
1H6HA 2I4KA 4P2IA 2DYBA 4OXWA 3DYTA 3IQ2A 3P0CA 4IKBB 4AKVA 4IKBA 3HPCX 2REAA 2CZOA 4PQPA 1XTNA 4PQOA 4AZ9A 4HASA 2IWLX 2AR5A 2RAIA 2V14A 1OCUA 1O7KA 4PZGA 2CSKA 2YPSA 3HPBA 4BGJA 3LUIA 1OCSA 1KMDA 4ON3A 1XTEA 2WWEA 4IKDA 2RAKA 2REDA 1KQ6A 3FOGA 4P2JA 2RAJA 2L73A 2V6VA 1GD5A 2ETTA
chains in the Genus database with same CATH topology
1H6HA 2I4KA 4P2IA 2DYBA 4OXWA 3DYTA 3IQ2A 3P0CA 4IKBB 4AKVA 4IKBA 3HPCX 2REAA 2CZOA 4PQPA 1XTNA 4PQOA 4AZ9A 4HASA 2IWLX 2AR5A 2RAIA 2V14A 1OCUA 1O7KA 4PZGA 2CSKA 2YPSA 3HPBA 4BGJA 3LUIA 1OCSA 1KMDA 4ON3A 1XTEA 2WWEA 4IKDA 2RAKA 2REDA 1KQ6A 3FOGA 4P2JA 2RAJA 2L73A 2V6VA 1GD5A 2ETTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6H A;  2I4K A;  4P2I A;  2DYB A;  4OXW A;  3DYT A;  3IQ2 A;  3P0C A;  4IKB B;  4AKV A;  4IKB A;  3HPC X;  2REA A;  2CZO A;  4PQP A;  1XTN A;  4PQO A;  4AZ9 A;  4HAS A;  2IWL X;  2AR5 A;  2RAI A;  2V14 A;  1OCU A;  1O7K A;  4PZG A;  2CSK A;  2YPS A;  3HPB A;  4BGJ A;  3LUI A;  1OCS A;  1KMD A;  4ON3 A;  1XTE A;  2WWE A;  4IKD A;  2RAK A;  2RED A;  1KQ6 A;  3FOG A;  4P2J A;  2RAJ A;  2L73 A;  2V6V A;  1GD5 A;  2ETT A; 
#chains in the Genus database with same CATH topology
 1H6H A;  2I4K A;  4P2I A;  2DYB A;  4OXW A;  3DYT A;  3IQ2 A;  3P0C A;  4IKB B;  4AKV A;  4IKB A;  3HPC X;  2REA A;  2CZO A;  4PQP A;  1XTN A;  4PQO A;  4AZ9 A;  4HAS A;  2IWL X;  2AR5 A;  2RAI A;  2V14 A;  1OCU A;  1O7K A;  4PZG A;  2CSK A;  2YPS A;  3HPB A;  4BGJ A;  3LUI A;  1OCS A;  1KMD A;  4ON3 A;  1XTE A;  2WWE A;  4IKD A;  2RAK A;  2RED A;  1KQ6 A;  3FOG A;  4P2J A;  2RAJ A;  2L73 A;  2V6V A;  1GD5 A;  2ETT A; 
#chains in the Genus database with same CATH homology
 1H6H A;  2I4K A;  4P2I A;  2DYB A;  4OXW A;  3DYT A;  3IQ2 A;  3P0C A;  4IKB B;  4AKV A;  4IKB A;  3HPC X;  2REA A;  2CZO A;  4PQP A;  1XTN A;  4PQO A;  4AZ9 A;  4HAS A;  2IWL X;  2AR5 A;  2RAI A;  2V14 A;  1OCU A;  1O7K A;  4PZG A;  2CSK A;  2YPS A;  3HPB A;  4BGJ A;  3LUI A;  1OCS A;  1KMD A;  4ON3 A;  1XTE A;  2WWE A;  4IKD A;  2RAK A;  2RED A;  1KQ6 A;  3FOG A;  4P2J A;  2RAJ A;  2L73 A;  2V6V A;  1GD5 A;  2ETT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...