2REFA

Crystal structure of the loading gnatl domain of cura from lyngbya majuscula soaked with malonyl-coa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
203
structure length
203
Chain Sequence
CFENNYYNLRHPKIEDLRDLIALETLCWSENLQVDNEEIYRRIFKIPQGQFILELEDKIVGAIYSQRIDNPQLLDNKTCTQVPLLHTESGVVVQLLAVNILPELQNQGLGDRLLEFMLQYCAQISGVEKVVAVTLCRNYPDYSPMPMAEYIHQKNESGLLVDPLLRFHQIHGAKIEKLLPGYRPKDWENQTCGVLVSYDIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title GNAT-like strategy for polyketide chain initiation.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase, lyase
molecule keywords CurA
total genus 56
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.3.1.38: [Acyl-carrier-protein] S-acetyltransferase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2refA01
1M4IA 3KKWA 3R9GA 4KOTA 1CM0A 4U5YA 1IYKA 5DWMA 3ZZIA 4HNYB 2FCKA 1J4JA 4FD4A 3UY5A 4F0YA 5C88A 3R96A 3TCVA 1Z9UA 2BEIA 1MJBA 4KOXA 3PZJA 3P2FA 3SXNA 1RXTA 4CAVA 4AG9A 1Y9WA 1M1DA 4FD7A 4LUAA 4FD6A 4KUAA 1M4DA 4II9A 2REFA 3G3SA 3TOBA 3RYOA 3MGDA 4UWIA 3LD2A 3LODA 4PV6A 3FRMA 1QSNA 4MY0A 1CJWA 1Q2DA 3W6XA 1RO5A 2VZZA 2HV2A 1YLEA 4QC6A 4R9MA 2VZYA 3D2PA 5J8CA 2RC4A 1SQHA 1P0HA 5HMNA 5JQ4A 1S7NA 4OADA 5H86A 1M44A 2ZW5A 1YX0A 3S6GA 3JVNA 4KUBA 1TIQA 3W91A 3TE4A 2DXQA 1V0CA 4UWJA 2VI7A 4KLVA 4XPKA 3DNSA 4R57A 3IGRA 4QBJA 2C27A 3SHPA 4HNXB 4XPDB 1I21A 4R3LA 2FSRA 2OZUA 5DWNA 4HKFA 3GY9A 2EVNA 4KOSA 2PR1A 4PK2A 2IL4A 2FT0A 2G0BA 4E0AA 4RI1A 2D4OA 4AVBA 1QSRA 3H4QA 4Y49C 4YFJA 4MJ8A 2ATRA 4PK3A 2B4DB 3EO4A 4JD6A 4K30A 2KCWA 4XPDC 4KOWA 3TO7A 5IV0A 3D8PA 3TOAA 3TO9A 3W6SA 4KVME 5J8FA 4JWPA 1UFHA 2Z0ZA 3QB8A 1YREA 1QSTA 4LX9A 1KUYA 3JUWA 2Q7BA 2REEA 4QUSA 3F5BA 2Z10A 4BMHA 2QIRA 4EVYA 1KUVA 4U9ZA 3WR7A 1N71A 3TO6A 4B5OA 4U9YA 3T90A 2FXFA 3R95A 4AB7A 3PP9A 1YR0A 5KTAA 5IB0A 1I12A 5JPHA 1BOBA 3R9EA 3ZJ0A 4DNCA 2OZGA 3TTHA 4GS4A 2G3TA 5H84A 4JLYA 4B5PA 1B6BA 2Q0YA 4H89A 1VHSA 2BL1A 4Y49B 4NSQA 1XIXA 3P2HA 1Q2CA 3SXOA 4UA3A 3VWEA 3V8IA 3F8KA 1Z4EA 2Q4YA 4XNHB 4QVTA 4R87A 4KORA 3S6HA 2B3UA 1I1DA 4M85A 2GANA 4RS2A 5C82A 1PU9A 1Y7RA 4IUSA 4M3SA 3F0AA 2AJ6A 5I0CA 2R98A 3EC4A 4NXYA 2OB0A 3DR6A 2H5MA 1IIDA 2FE7A 3GYAA 2PC1A 3C26A 3NE7A 4ZBGA 3GKRA 4CAXA 5EBVA 2R8VA 3K9UA 5GCNA 2R7HA 2WPWA 4CS0B 4ORFA 4KOVA 4FD5A 2I00A 2QMLA 2Z11A 1PUAA 1IB1E 5F48A 3QAHA 1S60A 2ARHA 3VWDA 4KLWA 2FL4A 3DSBA 2A4NA 2FIWA 5F49A 1NE9A 1XMTA 3CXQA 4KOUA 2VBQA 3R9FA 1S7LA 2F5IA 3IWGA 1S7KA 4IF5A 1Z4RA 2D4PA 3OWCA 4JXRA 2FIAA 2WPXA 1S3ZA 3PGPA 3R1KA 4X5KA 2ZW4A 4J3GA 2Q04A 4CRYB 4ONUA 5F46A 3TFYA 3FXTA 2B4BA 2J8RA 2Q4VA 1GHEA 3TT2A 3FYNA 2O28A 4F6AA 2ZXVA 4H6ZA 1WWZA 2I79A 4E8OA 1P4NA 3CXPA 4KZTA 4MBUA 2PR8A 1ON0A 2BSWA 1KZFA 1XE4A 1LRZA 2HQYA 2J8NA 2B3VA 2BUEA 3E0KA 2P6EA 2X7BA 4NCZA 1IYLA 5KTCA 3FNCA 2JLMA 4KVXA 3BJ7A 4NF1A 3FIXA 1XF8A 4OAEA 1B87A 1K4JA 1MJAA 3EY5A 2K5TA 4HNWB 1OZPA 1YK3A 2ZW6A 4KVOE 1L0CA 4QB9A 1BO4A 3DDDA 2P6FA 2ZW7A 1Q2YA 4CRZB 1MK4A 5FVJA 1VKCA 2CNTA 4R3KA 5ISVA 2B58A 2VQYA 2CNSA 2QECA 2NMTA 2P0WA 2Q44A 4E2AA 1FY7A 2CY2A 1KUXA 3DR8A 4XPLA 2R1IA 4I49A 4AVAA 5IX3A 4KOYA 3CXSA 2PRBA 1QSMA 4YRHA 2VXKA 4H6UA 5F47A 3D3SA 4OLLA 2OU2A 1R57A 1YVOA 2B5GB 1S5KA 3N7ZA 2B5GA 3I3GA 1XEBA 4AG7A 4MHDA 3FBUA 3B8GA 3I9SA 3D2MA 3S6KA 2CNMA 1QSOA 2JDCA 2JEVA 5HH1A 2ZPAA 5E96A 1MJ9A 2G3AA 2Y0MA 3G8WA 5CNPA 4AVCA 2B4DA 4JXQA 4PSXA 4L89A 2GIVA 2PQ8A 3T9YA 4B5PB 4NEXA 2PDOA 2J8MA 2P6GA 1NSLA 1S7FA 2OH1A 1NMTA 1U6MA 4PSWA 3BLNA 4XNHC 5EC4A 5KTDA 1WK4A 3EXNA 2OZHA 2FS5A 4CAWA 4L8AA 1YVKA 1YGHA 2HUZA 2AE6A 2GE3A 2JDDA 2VEZA 3FB3A 1M4GA 4YGOA 2EUIA 1Y9KA 4JJXA 4MY3A 1IICA 2PSWA 4MI4A 3S6FA 4UBRA 3BJ8A 3EFAA
chains in the Genus database with same CATH superfamily
2RFHA 4R76A 3D7HA 4IHMA 1M4IA 3PB6X 4B11A 3PRTA 3I1UA 1TKFA 4F0XA 3KKWA 3SI1A 3R9GA 2ZEFA 1CM0A 3B3SA 3B3VA 4KOTA 4U5YA 2PCUA 4ZY2A 1TXRA 2PVVA 1IYKA 1EE3P 5DWMA 3ZZIA 2XEIA 4HNYB 4ONWA 4NGMA 2O4HA 2FCKA 2ODFA 3VARA 1J4JA 2NYQA 4FD4A 3UY5A 1BAVA 4F0YA 5C88A 4PXDA 3R96A 3TCVA 1Z9UA 1QMUA 2BEIA 3WC7A 5HVHA 1MJBA 4KOXA 3PZJA 5K8MA 2AFSA 3P2FA 3SXNA 5DS0A 1RXTA 3B3WA 3KI9A 4CAVA 4AG9A 2Q51A 4PXBA 2GLFA 4NFRA 4P45A 1Y9WA 2HB6A 4CGLA 3FMCA 3QNVA 3VATA 3PBEA 5LYFA 1M1DA 4FD7A 5CBMA 4MXUA 4TWEA 4KSAA 4LUAA 3SJXA 4FD6A 1ELMP 3V38A 4KUAA 3LMSA 2PJ9A 1M4DA 4MFPA 2REFA 3G3SA 4X3RA 3RYOA 2BCOA 3PB7X 3TOBA 4II9A 3MGDA 4UEZA 4UWIA 2Z3LA 3LD2A 2ABZA 4TNUA 3LODA 4PV6A 3FRMA 1QSNA 2BO9A 4MY0A 5K8PA 3NA6A 3PB4X 1CJWA 1Q2DA 2CTCA 2YNCC 3W6XA 1RO5A 2VZZA 3DGVA 1F2PA 2HV2A 5LYLA 1YLEA 2CTBA 3K2KA 4QC6A 4OC2A 4R9MA 1ARMA 4A32A 2VZYA 3D2PA 1PCAA 2AFZA 4MFQA 2PJ5A 5J8CA 2RC4A 3SJEA 1SQHA 1P0HA 5AG7A 5HMNA 5I4MA 3RZAA 5JQ4A 1S7NA 4OADA 5H86A 4UCPA 1IOIA 1M44A 1VIXA 2ZW5A 1YX0A 2ZEEA 3S6GA 3KHXA 5LRGA 3JVNA 3PFEA 4KUBA 1TIQA 3D7GA 3W91A 3TE4A 2DXQA 1V0CA 2GU2A 4P4EA 4UWJA 4DYOA 4B12A 2ANPA 2VI7A 1Y0RA 4KLVA 4XPKA 3DNSA 3KR4A 3FEDA 4R57A 3IGRA 2Z3MA 4QBJA 2C27A 3SHPA 3KASA 4A37A 4C2YA 4EMEA 4HNXB 4M6IA 4XPDB 1I21A 4LQ6A 1Y0YA 4R3LA 2FSRA 2OZUA 3D7FA 5DWNA 4HKFA 3GY9A 3CPAA 1ZLHA 2EVNA 3LWUA 4KOSA 2PVWA 4UCNA 2PR1A 1AMPA 2IL4A 4PK2A 3B2YA 2FVGA 3K9TA 2FT0A 2G0BA 4E0AA 1BLLE 4RI1A 2D4OA 2Z3NA 1AUGA 1IU8A 2C6PA 1ARLA 3NE8A 4Q36A 1X10A 1Y7EA 4C7IA 4AVBA 1QSRA 3H4QA 4Y49C 4YFJA 4MJ8A 2ATRA 4ZGYB 3NH4A 4PK3A 3PB9X 3PBBA 2B4DB 3EO4A 4JD6A 4ZY0A 4K30A 3H8GA 2KCWA 1ZO0A 4KOWA 4XPDC 3TO7A 4NGQA 5IV0A 6CPAA 1Z8LA 2ZENA 3D8PA 3TOAA 2CIJA 2WUUA 3TO9A 3W6SA 4KVME 5J8FA 2GREA 2CF4A 4JWPA 5HVGA 1UFHA 2Z0ZA 4F9UA 3QB8A 1YREA 1QSTA 3SJGA 2PJ2A 3H8FA 3L2NA 4MMOA 1ZLIA 3CZXA 4LX9A 3MN8A 4P4FA 5HXDA 1KUYA 4DJLA 3JUWA 3RO0A 2Q7BA 1Z8XA 3FH4A 2QYVA 2REEA 4FAIA 3BXMA 3FJUA 4A33A 3DLJA 5AGEA 1DTDA 1DE4C 3IJ3A 4QUSA 3F5BA 2ZEDA 4RUHA 4X8IA 2Z10A 4OC1A 1LAPA 2Q43A 4BMHA 3FF3A 3IU2A 4C7HA 5D8NA 4Q7AA 1LANA 4MCPA 2QIRA 4CGPA 2AFUA 4EVYA 1KUVA 2RB7A 2F8HA 5IB9A 4U9ZA 5G1ZA 3WR7A 2DPSA 1N71A 3TO6A 4B5OA 4ZI6A 2IQ6A 4CAEA 4F8ZA 4U9YA 4O23A 3T90A 2FXFA 3R95A 4AB7A 5A27A 3PP9A 1YR0A 2G9DA 5KTAA 3PB8X 5IB0A 1I12A 2JBJA 5JPHA 1BOBA 3R9EA 3ZJ0A 4DNCA 3BI1A 4G1PA 3SJFA 1BPMA 4NGPA 3SI2A 3FX6A 2F7VA 4UFVA 2OZGA 2PJ7A 3TTHA 3GUXA 5EMIA 4GS4A 2PJBA 2G3TA 2PE3A 4FBEA 5H84A 2XEJA 4JLYA 4YWYA 4A2ZA 3WABA 4B5PA 2Q0YA 1B6BA 4H89A 1GYTA 1VHSA 4NJQA 4WJBA 5G22A 2JEWA 3B35A 2BL1A 4Y49B 2EK8A 4NSQA 3JRUA 2QVPA 4ZYQA 5LYIA 4OC5A 1XIXA 1LCPA 1H8LA 3MRUA 3H8EA 2PRQA 1LAMA 4CYNA 3P2HA 3CDXA 1Q2CA 3SXOA 4UA3A 3VWEA 3V8IA 2C1CA 4B10A 5AG4A 3F8KA 1BPNA 1Z4EA 2Q4YA 4XNHB 4QVTA 4CAFA 1KWMA 2YNDA 4R87A 4KORA 3S6HA 2B3UA 1I1DA 1YMEA 5JH9A 4ZY1A 1IY7A 2CXAA 4M85A 2GANA 4RS2A 5C82A 2DEAA 1PU9A 1Y7RA 4IUSA 4PXEA 1TKJA 5ELYA 5G20A 4M3SA 3ISXA 2YNEA 3F0AA 4R7MA 2AJ6A 2PJ1A 5I0CA 2R98A 2XEFA 3EC4A 4NXYA 2OB0A 3DR6A 4M6GA 4X2TA 2H5MA 2V77A 1IIDA 5AG6A 4LQGA 3NH8A 1XRYA 1Z2LA 8CPAA 2Z3KA 5LYDA 1VHOA 2FE7A 3D67A 3GYAA 1YW6A 2PC1A 3RAMA 4C68A 3C26A 3NE7A 4ZBGA 3D66A 3GKRA 4M6HA 4NJRA 4CAXA 5EBVA 2R8VA 3K9UA 5GCNA 2R7HA 2WPWA 3BHXA 1LFWA 4CS0B 4MHNA 4ORFA 1HEEA 3IIBA 1LOKA 4KOVA 4A30A 4CGNA 4UIAA 3N5FA 2PJAA 4FD5A 4GM5A 4MHYA 3TC8A 2I00A 2QMLA 1M4LA 4OIDA 2Z11A 1PUAA 2IMOA 3H5ZA 1IB1E 4KSFA 5BWAB 5F48A 5G21A 3QAHA 1S60A 2ARHA 2O53A 1F57A 2V8VA 3VWDA 4A31A 2GLJA 4UEFA 4KLWA 2FL4A 4MHZA 3DSBA 2BOAA 4ZX8A 4MFKA 3D4UA 2A4NA 1YW4A 2PJ0A 3HLPA 2FIWA 4A38A 4OC0A 3S9LA 3IEHA 1XBUA 5F49A 1NE9A 1XMTA 4H2KA 3CXQA 4KOUA 2VBQA 3R9FA 5K8NA 1FT7A 1S7LA 2F5IA 3IWGA 3NH5A 4W9YA 2AFOA 5K8OA 1S7KA 4IF5A 1Z4RA 2D4PA 2PIYA 2OR4A 3OWCA 4AXVA 4RN7A 4JXRA 2FIAA 4MFLA 1FNOA 2WPXA 1S3ZA 3PGPA 3GIUA 3R1KA 4NGNA 4X5KA 2ZW4A 1JQGA 4J3GA 1QQ9A 3KR5A 4NGSA 2Q04A 4CRYB 4EFDA 1Q7LA 4ONUA 1X12A 4P4BA 5F46A 4P4JA 3TFYA 1CP7A 2DPTA 3FXTA 4C2XA 2J9AA 2C6CA 4MCRA 2B4BA 5JM6A 4EWTA 3S9NA 2ZOGA 2J8RA 2Q4VA 3GB0A 1GHEA 4UF4A 3TT2A 5LRJA 3FYNA 2V8DA 4OP4A 3FECA 2O28A 4F6AA 2ZXVA 4JYWA 2EWBA 4H6ZA 1Z8WA 4P6YA 4BD9A 1WWZA 2I79A 2ZELA 4E8OA 1P4NA 3CXPA 4IK2A 4KZTA 4BBHA 3KQZA 3NFZA 4PQAA 4PPZA 4MBUA 2PR8A 3ISZA 1RTQA 4K3NA 2ZEHA 1ON0A 4F9VA 5JGFA 2BSWA 1KZFA 5HVFA 1XE4A 1IGBA 4KS9A 3WC6A 1LRZA 2HQYA 2J8NA 1R3NA 1YQEA 3LACA 1OBRA 2B3VA 2BUEA 2QJ8A 1ZG7A 4GXHA 2Z3PA 2AFXA 3FVLA 4OMEA 3JTKA 3IWWA 3E0KA 2P6EA 3KZWA 2X7BA 3IC1A 4NCZA 1IYLA 4Q38A 7CPAA 5KTCA 3FNCA 4UIBA 2JLMA 2OOTA 4KVXA 3BJ7A 1IOFA 4NF1A 1VGYA 2EBJA 2V8GA 3FIXA 1XF8A 4OAEA 4OC4A 3A9LA 1B87A 5AG5A 4CPAA 4OIWA 1K4JA 1MJAA 3EY5A 3PFOA 4B6ZA 2K5TA 4HNWB 3KQXA 2IJZA 3WT4A 1VHEA 4B14A 3KHZA 4P4DA 3WC5A 1OZPA 3D68A 1XMBA 3GLJA 1TF8A 4WWVA 4HPSA 1PYTB 2Z3OA 4P44A 4CYPA 1YK3A 2ZW6A 3IU1A 1XOVA 4KVOE 1F2OA 1L0CA 1CG2A 1CPXA 1ELLP 4QB9A 1BO4A 3T8WA 3DDDA 4UFXA 4A39A 2P6FA 3CT9A 2ZW7A 5CPAA 1XFOA 1A2ZA 1Q2YA 1ZG8A 4MRIA 4B13A 4CRZB 5F09A 1MK4A 5FVJA 2PIZA 1VKCA 3FEEA 2CNTA 2Q4ZA 2ZEMA 3CPXA 4R3KA 5ISVA 2POKA 2B58A 4MFJA 3V7ZA 1UWYA 2VQYA 2CNSA 1AYEA 2NMTA 2QECA 2P0WA 2WZNA 3RBUA 1CBXA 2Q44A 2YNCA 1FY7A 3IO1A 2CY2A 2GFQA 3KL9A 4YU9A 4E2AA 1TKHA 5THWA 2V8HA 1KUXA 2DF5A 3DR8A 4XPLA 2R1IA 4I49A 4AVAA 5IX3A 2PJCA 4KOYA 1TF9A 3CXSA 2EO8A 3IWEA 2PRBA 4FUUA 1QSMA 3PEIA 4YRHA 2VXKA 4MCQA 4BINA 4P10A 2C6GA 1Z5RA 4H6UA 2PJ3A 4OKOA 5F47A 3D3SA 2PJ8A 3TX8A 4MHPA 4MFZA 3B7IA 2OU2A 2ZEGA 4OLLA 4ZX9A 3RNZA 4CGOA 1YLOA 1R57A 5A28A 1YVOA 2B5GB 2Q7SA 4R6TA 1S5KA 5LRKA 3B3TA 3N7ZA 2PJ4A 4A95A 2B5GA 1XJOA 3I3GA 3BI0A 4C2ZA 4NGRA 1XEBA 4AG7A 4MHDA 3FBUA 2I3CA 2WSAA 3B8GA 3I9SA 2AFWA 3D2MA 2EK9A 3S6KA 1CX8A 2CNMA 1NSAA 1QSOA 3HUVA 1YSJA 2VL1A 2NSMA 4KSIA 2JDCA 2JEVA 5HH1A 2ZEPA 4CGMA 2ZPAA 5E96A 4A94A 4CYQA 1MJ9A 1HDUA 2G3AA 4MCSA 2Y0MA 4P4IA 3G8WA 5CNPA 4AVCA 2B4DA 4JXQA 4PSXA 2WYRA 4Z65A 4L89A 1R43A 2GIVA 2PQ8A 3D7DA 3T9YA 2ZEOA 4B5PB 4OC3A 4PXCA 4IAVA 3B3CA 4UCMA 3SI0A 4CYOA 5D29A 4NEXA 2PDOA 2J8MA 2XEGA 2JBKA 2P6GA 1ZG9A 3KGQA 1NSLA 1S7FA 2OH1A 4FWUA 1NMTA 1U6MA 4PSWA 3BLNA 4XNHC 5EC4A 5KTDA 5J1QA 1WK4A 3EXNA 4UEEA 4R8FA 2HC9A 1CP6A 4UFWA 2OZHA 4NGTA 2FS5A 3S9MA 3QAYA 4CAWA 4L8AA 1YVKA 2AFMA 2ZOFA 1YGHA 1Z8TA 2HUZA 2AE6A 1CPSA 2GE3A 2JDDA 2YGWA 2VEZA 2PJ6A 3FB3A 1M4GA 4JZ0A 1JWQA 4YGOA 1HDQA 2EUIA 1Y9KA 4JJXA 4MY3A 3VH9A 1IICA 2PSWA 4MI4A 3S6FA 4DUKA 4UBRA 3BJ8A 3EFAA 3IFEA
chains in the Genus database with same CATH topology
1M4IA 4B11A 4F0XA 3KKWA 3R9GA 4KOTA 1CM0A 4U5YA 1IYKA 5DWMA 3ZZIA 4HNYB 2FCKA 1J4JA 4FD4A 3UY5A 4F0YA 5C88A 3R96A 3TCVA 1Z9UA 2BEIA 1MJBA 4KOXA 3PZJA 3P2FA 3SXNA 1RXTA 4CAVA 4AG9A 4CGLA 1Y9WA 1M1DA 4FD7A 4KSAA 4LUAA 4FD6A 4KUAA 4MFPA 1M4DA 4II9A 2REFA 3G3SA 3TOBA 3RYOA 3MGDA 4UWIA 2Z3LA 3LD2A 3LODA 4PV6A 3FRMA 1QSNA 4MY0A 1CJWA 1Q2DA 2YNCC 3W6XA 1RO5A 2VZZA 2HV2A 1YLEA 4QC6A 4R9MA 4A32A 2VZYA 3D2PA 4MFQA 5J8CA 2RC4A 1SQHA 1P0HA 5AG7A 5HMNA 5JQ4A 1S7NA 4OADA 5H86A 4UCPA 1M44A 2ZW5A 1YX0A 3S6GA 3JVNA 4KUBA 1TIQA 3W91A 3TE4A 2DXQA 1V0CA 4UWJA 4B12A 2VI7A 4KLVA 4XPKA 3DNSA 4R57A 3IGRA 2Z3MA 4QBJA 2C27A 3SHPA 4C2YA 4HNXB 4XPDB 1I21A 4R3LA 2FSRA 2OZUA 5DWNA 4HKFA 3GY9A 2EVNA 4KOSA 4UCNA 2PR1A 4PK2A 2IL4A 2FT0A 2G0BA 4E0AA 4RI1A 2D4OA 2Z3NA 4Q36A 4C7IA 4AVBA 1QSRA 3H4QA 4Y49C 4YFJA 4MJ8A 2ATRA 4ZGYB 4PK3A 2B4DB 3EO4A 4JD6A 4K30A 2KCWA 1ZO0A 4KOWA 4XPDC 3TO7A 5IV0A 3D8PA 3TOAA 2WUUA 3TO9A 3W6SA 4KVME 5J8FA 4JWPA 1UFHA 2Z0ZA 3QB8A 1YREA 1QSTA 4LX9A 1KUYA 3JUWA 2Q7BA 2REEA 4A33A 5AGEA 4QUSA 3F5BA 2Z10A 4BMHA 3IU2A 4C7HA 2QIRA 4CGPA 4EVYA 1KUVA 4U9ZA 5G1ZA 3WR7A 2DPSA 1N71A 3TO6A 4B5OA 4CAEA 4U9YA 3T90A 2FXFA 3R95A 4AB7A 5A27A 3PP9A 1YR0A 5KTAA 5IB0A 1I12A 5JPHA 1BOBA 3R9EA 3ZJ0A 4DNCA 4UFVA 2OZGA 3TTHA 4GS4A 2G3TA 5H84A 4JLYA 4A2ZA 4B5PA 1B6BA 2Q0YA 4H89A 1VHSA 5G22A 2BL1A 4Y49B 4NSQA 1XIXA 4CYNA 3P2HA 1Q2CA 3SXOA 4UA3A 3VWEA 3V8IA 4B10A 5AG4A 3F8KA 1Z4EA 2Q4YA 4XNHB 4QVTA 4CAFA 2YNDA 4R87A 4KORA 3S6HA 2B3UA 1I1DA 2CXAA 4M85A 2GANA 4RS2A 5C82A 1PU9A 1Y7RA 4IUSA 5G20A 4M3SA 2YNEA 3F0AA 2AJ6A 5I0CA 2R98A 3EC4A 4NXYA 2OB0A 3DR6A 2H5MA 1IIDA 5AG6A 2Z3KA 2FE7A 3GYAA 2PC1A 4C68A 3C26A 3NE7A 4ZBGA 3GKRA 4CAXA 5EBVA 2R8VA 3K9UA 5GCNA 2R7HA 2WPWA 4CS0B 4ORFA 4A30A 4CGNA 4KOVA 4FD5A 2I00A 2QMLA 2Z11A 1PUAA 3H5ZA 4KSFA 1IB1E 5BWAB 5F48A 5G21A 3QAHA 1S60A 2ARHA 3VWDA 4A31A 4KLWA 2FL4A 3DSBA 4MFKA 2A4NA 2FIWA 5F49A 1NE9A 1XMTA 3CXQA 4KOUA 2VBQA 3R9FA 1S7LA 2F5IA 3IWGA 1S7KA 4IF5A 1Z4RA 2D4PA 3OWCA 4JXRA 2FIAA 4MFLA 2WPXA 1S3ZA 3PGPA 3R1KA 4X5KA 2ZW4A 4J3GA 2Q04A 4CRYB 4ONUA 5F46A 3TFYA 2DPTA 3FXTA 4C2XA 2B4BA 2J8RA 2Q4VA 1GHEA 3TT2A 3FYNA 2O28A 4F6AA 2ZXVA 4H6ZA 1WWZA 2I79A 4E8OA 1P4NA 3CXPA 4BBHA 4KZTA 4MBUA 2PR8A 1ON0A 2BSWA 1KZFA 1XE4A 4KS9A 1LRZA 2HQYA 2J8NA 2B3VA 2BUEA 2Z3PA 3JTKA 3E0KA 2P6EA 2X7BA 4Q38A 4NCZA 1IYLA 5KTCA 3FNCA 2JLMA 4KVXA 3BJ7A 4NF1A 3FIXA 1XF8A 4OAEA 3A9LA 1B87A 5AG5A 1K4JA 1MJAA 3EY5A 2K5TA 4HNWB 4B14A 1OZPA 2Z3OA 4CYPA 1YK3A 2ZW6A 3IU1A 4KVOE 1L0CA 4QB9A 1BO4A 3DDDA 4UFXA 2P6FA 2ZW7A 1Q2YA 4B13A 4CRZB 1MK4A 5FVJA 1VKCA 2CNTA 4R3KA 5ISVA 2B58A 4MFJA 2VQYA 2CNSA 2QECA 2NMTA 2P0WA 2YNCA 2Q44A 4E2AA 1FY7A 2CY2A 1KUXA 3DR8A 4XPLA 2R1IA 4I49A 4AVAA 5IX3A 4KOYA 3CXSA 3IWEA 2PRBA 1QSMA 4YRHA 2VXKA 4H6UA 5F47A 3D3SA 4OLLA 4MFZA 4CGOA 2OU2A 5A28A 1R57A 1YVOA 2B5GB 1S5KA 4A95A 3N7ZA 2B5GA 3I3GA 4C2ZA 1XEBA 4AG7A 4MHDA 3FBUA 2WSAA 3B8GA 3I9SA 3D2MA 3S6KA 2CNMA 1QSOA 2JDCA 2JEVA 5HH1A 4CGMA 4CYQA 2ZPAA 5E96A 1MJ9A 2G3AA 2Y0MA 3G8WA 5CNPA 4AVCA 2B4DA 4JXQA 4PSXA 4L89A 2GIVA 2PQ8A 3T9YA 4B5PB 4UCMA 4CYOA 4NEXA 2PDOA 2J8MA 2P6GA 1NSLA 1S7FA 2OH1A 1NMTA 1U6MA 4PSWA 3BLNA 4XNHC 5EC4A 5KTDA 1WK4A 3EXNA 4UFWA 2OZHA 2FS5A 4CAWA 4L8AA 1YVKA 1YGHA 2HUZA 2AE6A 2GE3A 2JDDA 2YGWA 2VEZA 3FB3A 1M4GA 4YGOA 2EUIA 1Y9KA 4JJXA 4MY3A 1IICA 2PSWA 4MI4A 3S6FA 4UBRA 3BJ8A 3EFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4I A;  3KKW A;  3R9G A;  4KOT A;  1CM0 A;  4U5Y A;  1IYK A;  5DWM A;  3ZZI A;  4HNY B;  2FCK A;  1J4J A;  4FD4 A;  3UY5 A;  4F0Y A;  5C88 A;  3R96 A;  3TCV A;  1Z9U A;  2BEI A;  1MJB A;  4KOX A;  3PZJ A;  3P2F A;  3SXN A;  1RXT A;  4CAV A;  4AG9 A;  1Y9W A;  1M1D A;  4FD7 A;  4LUA A;  4FD6 A;  4KUA A;  1M4D A;  4II9 A;  2REF A;  3G3S A;  3TOB A;  3RYO A;  3MGD A;  4UWI A;  3LD2 A;  3LOD A;  4PV6 A;  3FRM A;  1QSN A;  4MY0 A;  1CJW A;  1Q2D A;  3W6X A;  1RO5 A;  2VZZ A;  2HV2 A;  1YLE A;  4QC6 A;  4R9M A;  2VZY A;  3D2P A;  5J8C A;  2RC4 A;  1SQH A;  1P0H A;  5HMN A;  5JQ4 A;  1S7N A;  4OAD A;  5H86 A;  1M44 A;  2ZW5 A;  1YX0 A;  3S6G A;  3JVN A;  4KUB A;  1TIQ A;  3W91 A;  3TE4 A;  2DXQ A;  1V0C A;  4UWJ A;  2VI7 A;  4KLV A;  4XPK A;  3DNS A;  4R57 A;  3IGR A;  4QBJ A;  2C27 A;  3SHP A;  4HNX B;  4XPD B;  1I21 A;  4R3L A;  2FSR A;  2OZU A;  5DWN A;  4HKF A;  3GY9 A;  2EVN A;  4KOS A;  2PR1 A;  4PK2 A;  2IL4 A;  2FT0 A;  2G0B A;  4E0A A;  4RI1 A;  2D4O A;  4AVB A;  1QSR A;  3H4Q A;  4Y49 C;  4YFJ A;  4MJ8 A;  2ATR A;  4PK3 A;  2B4D B;  3EO4 A;  4JD6 A;  4K30 A;  2KCW A;  4XPD C;  4KOW A;  3TO7 A;  5IV0 A;  3D8P A;  3TOA A;  3TO9 A;  3W6S A;  4KVM E;  5J8F A;  4JWP A;  1UFH A;  2Z0Z A;  3QB8 A;  1YRE A;  1QST A;  4LX9 A;  1KUY A;  3JUW A;  2Q7B A;  2REE A;  4QUS A;  3F5B A;  2Z10 A;  4BMH A;  2QIR A;  4EVY A;  1KUV A;  4U9Z A;  3WR7 A;  1N71 A;  3TO6 A;  4B5O A;  4U9Y A;  3T90 A;  2FXF A;  3R95 A;  4AB7 A;  3PP9 A;  1YR0 A;  5KTA A;  5IB0 A;  1I12 A;  5JPH A;  1BOB A;  3R9E A;  3ZJ0 A;  4DNC A;  2OZG A;  3TTH A;  4GS4 A;  2G3T A;  5H84 A;  4JLY A;  4B5P A;  1B6B A;  2Q0Y A;  4H89 A;  1VHS A;  2BL1 A;  4Y49 B;  4NSQ A;  1XIX A;  3P2H A;  1Q2C A;  3SXO A;  4UA3 A;  3VWE A;  3V8I A;  3F8K A;  1Z4E A;  2Q4Y A;  4XNH B;  4QVT A;  4R87 A;  4KOR A;  3S6H A;  2B3U A;  1I1D A;  4M85 A;  2GAN A;  4RS2 A;  5C82 A;  1PU9 A;  1Y7R A;  4IUS A;  4M3S A;  3F0A A;  2AJ6 A;  5I0C A;  2R98 A;  3EC4 A;  4NXY A;  2OB0 A;  3DR6 A;  2H5M A;  1IID A;  2FE7 A;  3GYA A;  2PC1 A;  3C26 A;  3NE7 A;  4ZBG A;  3GKR A;  4CAX A;  5EBV A;  2R8V A;  3K9U A;  5GCN A;  2R7H A;  2WPW A;  4CS0 B;  4ORF A;  4KOV A;  4FD5 A;  2I00 A;  2QML A;  2Z11 A;  1PUA A;  1IB1 E;  5F48 A;  3QAH A;  1S60 A;  2ARH A;  3VWD A;  4KLW A;  2FL4 A;  3DSB A;  2A4N A;  2FIW A;  5F49 A;  1NE9 A;  1XMT A;  3CXQ A;  4KOU A;  2VBQ A;  3R9F A;  1S7L A;  2F5I A;  3IWG A;  1S7K A;  4IF5 A;  1Z4R A;  2D4P A;  3OWC A;  4JXR A;  2FIA A;  2WPX A;  1S3Z A;  3PGP A;  3R1K A;  4X5K A;  2ZW4 A;  4J3G A;  2Q04 A;  4CRY B;  4ONU A;  5F46 A;  3TFY A;  3FXT A;  2B4B A;  2J8R A;  2Q4V A;  1GHE A;  3TT2 A;  3FYN A;  2O28 A;  4F6A A;  2ZXV A;  4H6Z A;  1WWZ A;  2I79 A;  4E8O A;  1P4N A;  3CXP A;  4KZT A;  4MBU A;  2PR8 A;  1ON0 A;  2BSW A;  1KZF A;  1XE4 A;  1LRZ A;  2HQY A;  2J8N A;  2B3V A;  2BUE A;  3E0K A;  2P6E A;  2X7B A;  4NCZ A;  1IYL A;  5KTC A;  3FNC A;  2JLM A;  4KVX A;  3BJ7 A;  4NF1 A;  3FIX A;  1XF8 A;  4OAE A;  1B87 A;  1K4J A;  1MJA A;  3EY5 A;  2K5T A;  4HNW B;  1OZP A;  1YK3 A;  2ZW6 A;  4KVO E;  1L0C A;  4QB9 A;  1BO4 A;  3DDD A;  2P6F A;  2ZW7 A;  1Q2Y A;  4CRZ B;  1MK4 A;  5FVJ A;  1VKC A;  2CNT A;  4R3K A;  5ISV A;  2B58 A;  2VQY A;  2CNS A;  2QEC A;  2NMT A;  2P0W A;  2Q44 A;  4E2A A;  1FY7 A;  2CY2 A;  1KUX A;  3DR8 A;  4XPL A;  2R1I A;  4I49 A;  4AVA A;  5IX3 A;  4KOY A;  3CXS A;  2PRB A;  1QSM A;  4YRH A;  2VXK A;  4H6U A;  5F47 A;  3D3S A;  4OLL A;  2OU2 A;  1R57 A;  1YVO A;  2B5G B;  1S5K A;  3N7Z A;  2B5G A;  3I3G A;  1XEB A;  4AG7 A;  4MHD A;  3FBU A;  3B8G A;  3I9S A;  3D2M A;  3S6K A;  2CNM A;  1QSO A;  2JDC A;  2JEV A;  5HH1 A;  2ZPA A;  5E96 A;  1MJ9 A;  2G3A A;  2Y0M A;  3G8W A;  5CNP A;  4AVC A;  2B4D A;  4JXQ A;  4PSX A;  4L89 A;  2GIV A;  2PQ8 A;  3T9Y A;  4B5P B;  4NEX A;  2PDO A;  2J8M A;  2P6G A;  1NSL A;  1S7F A;  2OH1 A;  1NMT A;  1U6M A;  4PSW A;  3BLN A;  4XNH C;  5EC4 A;  5KTD A;  1WK4 A;  3EXN A;  2OZH A;  2FS5 A;  4CAW A;  4L8A A;  1YVK A;  1YGH A;  2HUZ A;  2AE6 A;  2GE3 A;  2JDD A;  2VEZ A;  3FB3 A;  1M4G A;  4YGO A;  2EUI A;  1Y9K A;  4JJX A;  4MY3 A;  1IIC A;  2PSW A;  4MI4 A;  3S6F A;  4UBR A;  3BJ8 A;  3EFA A; 
#chains in the Genus database with same CATH topology
 2RFH A;  4R76 A;  3D7H A;  4IHM A;  1M4I A;  3PB6 X;  4B11 A;  3PRT A;  3I1U A;  1TKF A;  4F0X A;  3KKW A;  3SI1 A;  3R9G A;  2ZEF A;  1CM0 A;  3B3S A;  3B3V A;  4KOT A;  4U5Y A;  2PCU A;  4ZY2 A;  1TXR A;  2PVV A;  1IYK A;  1EE3 P;  5DWM A;  3ZZI A;  2XEI A;  4HNY B;  4ONW A;  4NGM A;  2O4H A;  2FCK A;  2ODF A;  3VAR A;  1J4J A;  2NYQ A;  4FD4 A;  3UY5 A;  1BAV A;  4F0Y A;  5C88 A;  4PXD A;  3R96 A;  3TCV A;  1Z9U A;  1QMU A;  2BEI A;  3WC7 A;  5HVH A;  1MJB A;  4KOX A;  3PZJ A;  5K8M A;  2AFS A;  3P2F A;  3SXN A;  5DS0 A;  1RXT A;  3B3W A;  3KI9 A;  4CAV A;  4AG9 A;  2Q51 A;  4PXB A;  2GLF A;  4NFR A;  4P45 A;  1Y9W A;  2HB6 A;  4CGL A;  3FMC A;  3QNV A;  3VAT A;  3PBE A;  5LYF A;  1M1D A;  4FD7 A;  5CBM A;  4MXU A;  4TWE A;  4KSA A;  4LUA A;  3SJX A;  4FD6 A;  1ELM P;  3V38 A;  4KUA A;  3LMS A;  2PJ9 A;  1M4D A;  4MFP A;  2REF A;  3G3S A;  4X3R A;  3RYO A;  2BCO A;  3PB7 X;  3TOB A;  4II9 A;  3MGD A;  4UEZ A;  4UWI A;  2Z3L A;  3LD2 A;  2ABZ A;  4TNU A;  3LOD A;  4PV6 A;  3FRM A;  1QSN A;  2BO9 A;  4MY0 A;  5K8P A;  3NA6 A;  3PB4 X;  1CJW A;  1Q2D A;  2CTC A;  2YNC C;  3W6X A;  1RO5 A;  2VZZ A;  3DGV A;  1F2P A;  2HV2 A;  5LYL A;  1YLE A;  2CTB A;  3K2K A;  4QC6 A;  4OC2 A;  4R9M A;  1ARM A;  4A32 A;  2VZY A;  3D2P A;  1PCA A;  2AFZ A;  4MFQ A;  2PJ5 A;  5J8C A;  2RC4 A;  3SJE A;  1SQH A;  1P0H A;  5AG7 A;  5HMN A;  5I4M A;  3RZA A;  5JQ4 A;  1S7N A;  4OAD A;  5H86 A;  4UCP A;  1IOI A;  1M44 A;  1VIX A;  2ZW5 A;  1YX0 A;  2ZEE A;  3S6G A;  3KHX A;  5LRG A;  3JVN A;  3PFE A;  4KUB A;  1TIQ A;  3D7G A;  3W91 A;  3TE4 A;  2DXQ A;  1V0C A;  2GU2 A;  4P4E A;  4UWJ A;  4DYO A;  4B12 A;  2ANP A;  2VI7 A;  1Y0R A;  4KLV A;  4XPK A;  3DNS A;  3KR4 A;  3FED A;  4R57 A;  3IGR A;  2Z3M A;  4QBJ A;  2C27 A;  3SHP A;  3KAS A;  4A37 A;  4C2Y A;  4EME A;  4HNX B;  4M6I A;  4XPD B;  1I21 A;  4LQ6 A;  1Y0Y A;  4R3L A;  2FSR A;  2OZU A;  3D7F A;  5DWN A;  4HKF A;  3GY9 A;  3CPA A;  1ZLH A;  2EVN A;  3LWU A;  4KOS A;  2PVW A;  4UCN A;  2PR1 A;  1AMP A;  2IL4 A;  4PK2 A;  3B2Y A;  2FVG A;  3K9T A;  2FT0 A;  2G0B A;  4E0A A;  1BLL E;  4RI1 A;  2D4O A;  2Z3N A;  1AUG A;  1IU8 A;  2C6P A;  1ARL A;  3NE8 A;  4Q36 A;  1X10 A;  1Y7E A;  4C7I A;  4AVB A;  1QSR A;  3H4Q A;  4Y49 C;  4YFJ A;  4MJ8 A;  2ATR A;  4ZGY B;  3NH4 A;  4PK3 A;  3PB9 X;  3PBB A;  2B4D B;  3EO4 A;  4JD6 A;  4ZY0 A;  4K30 A;  3H8G A;  2KCW A;  1ZO0 A;  4KOW A;  4XPD C;  3TO7 A;  4NGQ A;  5IV0 A;  6CPA A;  1Z8L A;  2ZEN A;  3D8P A;  3TOA A;  2CIJ A;  2WUU A;  3TO9 A;  3W6S A;  4KVM E;  5J8F A;  2GRE A;  2CF4 A;  4JWP A;  5HVG A;  1UFH A;  2Z0Z A;  4F9U A;  3QB8 A;  1YRE A;  1QST A;  3SJG A;  2PJ2 A;  3H8F A;  3L2N A;  4MMO A;  1ZLI A;  3CZX A;  4LX9 A;  3MN8 A;  4P4F A;  5HXD A;  1KUY A;  4DJL A;  3JUW A;  3RO0 A;  2Q7B A;  1Z8X A;  3FH4 A;  2QYV A;  2REE A;  4FAI A;  3BXM A;  3FJU A;  4A33 A;  3DLJ A;  5AGE A;  1DTD A;  1DE4 C;  3IJ3 A;  4QUS A;  3F5B A;  2ZED A;  4RUH A;  4X8I A;  2Z10 A;  4OC1 A;  1LAP A;  2Q43 A;  4BMH A;  3FF3 A;  3IU2 A;  4C7H A;  5D8N A;  4Q7A A;  1LAN A;  4MCP A;  2QIR A;  4CGP A;  2AFU A;  4EVY A;  1KUV A;  2RB7 A;  2F8H A;  5IB9 A;  4U9Z A;  5G1Z A;  3WR7 A;  2DPS A;  1N71 A;  3TO6 A;  4B5O A;  4ZI6 A;  2IQ6 A;  4CAE A;  4F8Z A;  4U9Y A;  4O23 A;  3T90 A;  2FXF A;  3R95 A;  4AB7 A;  5A27 A;  3PP9 A;  1YR0 A;  2G9D A;  5KTA A;  3PB8 X;  5IB0 A;  1I12 A;  2JBJ A;  5JPH A;  1BOB A;  3R9E A;  3ZJ0 A;  4DNC A;  3BI1 A;  4G1P A;  3SJF A;  1BPM A;  4NGP A;  3SI2 A;  3FX6 A;  2F7V A;  4UFV A;  2OZG A;  2PJ7 A;  3TTH A;  3GUX A;  5EMI A;  4GS4 A;  2PJB A;  2G3T A;  2PE3 A;  4FBE A;  5H84 A;  2XEJ A;  4JLY A;  4YWY A;  4A2Z A;  3WAB A;  4B5P A;  2Q0Y A;  1B6B A;  4H89 A;  1GYT A;  1VHS A;  4NJQ A;  4WJB A;  5G22 A;  2JEW A;  3B35 A;  2BL1 A;  4Y49 B;  2EK8 A;  4NSQ A;  3JRU A;  2QVP A;  4ZYQ A;  5LYI A;  4OC5 A;  1XIX A;  1LCP A;  1H8L A;  3MRU A;  3H8E A;  2PRQ A;  1LAM A;  4CYN A;  3P2H A;  3CDX A;  1Q2C A;  3SXO A;  4UA3 A;  3VWE A;  3V8I A;  2C1C A;  4B10 A;  5AG4 A;  3F8K A;  1BPN A;  1Z4E A;  2Q4Y A;  4XNH B;  4QVT A;  4CAF A;  1KWM A;  2YND A;  4R87 A;  4KOR A;  3S6H A;  2B3U A;  1I1D A;  1YME A;  5JH9 A;  4ZY1 A;  1IY7 A;  2CXA A;  4M85 A;  2GAN A;  4RS2 A;  5C82 A;  2DEA A;  1PU9 A;  1Y7R A;  4IUS A;  4PXE A;  1TKJ A;  5ELY A;  5G20 A;  4M3S A;  3ISX A;  2YNE A;  3F0A A;  4R7M A;  2AJ6 A;  2PJ1 A;  5I0C A;  2R98 A;  2XEF A;  3EC4 A;  4NXY A;  2OB0 A;  3DR6 A;  4M6G A;  4X2T A;  2H5M A;  2V77 A;  1IID A;  5AG6 A;  4LQG A;  3NH8 A;  1XRY A;  1Z2L A;  8CPA A;  2Z3K A;  5LYD A;  1VHO A;  2FE7 A;  3D67 A;  3GYA A;  1YW6 A;  2PC1 A;  3RAM A;  4C68 A;  3C26 A;  3NE7 A;  4ZBG A;  3D66 A;  3GKR A;  4M6H A;  4NJR A;  4CAX A;  5EBV A;  2R8V A;  3K9U A;  5GCN A;  2R7H A;  2WPW A;  3BHX A;  1LFW A;  4CS0 B;  4MHN A;  4ORF A;  1HEE A;  3IIB A;  1LOK A;  4KOV A;  4A30 A;  4CGN A;  4UIA A;  3N5F A;  2PJA A;  4FD5 A;  4GM5 A;  4MHY A;  3TC8 A;  2I00 A;  2QML A;  1M4L A;  4OID A;  2Z11 A;  1PUA A;  2IMO A;  3H5Z A;  1IB1 E;  4KSF A;  5BWA B;  5F48 A;  5G21 A;  3QAH A;  1S60 A;  2ARH A;  2O53 A;  1F57 A;  2V8V A;  3VWD A;  4A31 A;  2GLJ A;  4UEF A;  4KLW A;  2FL4 A;  4MHZ A;  3DSB A;  2BOA A;  4ZX8 A;  4MFK A;  3D4U A;  2A4N A;  1YW4 A;  2PJ0 A;  3HLP A;  2FIW A;  4A38 A;  4OC0 A;  3S9L A;  3IEH A;  1XBU A;  5F49 A;  1NE9 A;  1XMT A;  4H2K A;  3CXQ A;  4KOU A;  2VBQ A;  3R9F A;  5K8N A;  1FT7 A;  1S7L A;  2F5I A;  3IWG A;  3NH5 A;  4W9Y A;  2AFO A;  5K8O A;  1S7K A;  4IF5 A;  1Z4R A;  2D4P A;  2PIY A;  2OR4 A;  3OWC A;  4AXV A;  4RN7 A;  4JXR A;  2FIA A;  4MFL A;  1FNO A;  2WPX A;  1S3Z A;  3PGP A;  3GIU A;  3R1K A;  4NGN A;  4X5K A;  2ZW4 A;  1JQG A;  4J3G A;  1QQ9 A;  3KR5 A;  4NGS A;  2Q04 A;  4CRY B;  4EFD A;  1Q7L A;  4ONU A;  1X12 A;  4P4B A;  5F46 A;  4P4J A;  3TFY A;  1CP7 A;  2DPT A;  3FXT A;  4C2X A;  2J9A A;  2C6C A;  4MCR A;  2B4B A;  5JM6 A;  4EWT A;  3S9N A;  2ZOG A;  2J8R A;  2Q4V A;  3GB0 A;  1GHE A;  4UF4 A;  3TT2 A;  5LRJ A;  3FYN A;  2V8D A;  4OP4 A;  3FEC A;  2O28 A;  4F6A A;  2ZXV A;  4JYW A;  2EWB A;  4H6Z A;  1Z8W A;  4P6Y A;  4BD9 A;  1WWZ A;  2I79 A;  2ZEL A;  4E8O A;  1P4N A;  3CXP A;  4IK2 A;  4KZT A;  4BBH A;  3KQZ A;  3NFZ A;  4PQA A;  4PPZ A;  4MBU A;  2PR8 A;  3ISZ A;  1RTQ A;  4K3N A;  2ZEH A;  1ON0 A;  4F9V A;  5JGF A;  2BSW A;  1KZF A;  5HVF A;  1XE4 A;  1IGB A;  4KS9 A;  3WC6 A;  1LRZ A;  2HQY A;  2J8N A;  1R3N A;  1YQE A;  3LAC A;  1OBR A;  2B3V A;  2BUE A;  2QJ8 A;  1ZG7 A;  4GXH A;  2Z3P A;  2AFX A;  3FVL A;  4OME A;  3JTK A;  3IWW A;  3E0K A;  2P6E A;  3KZW A;  2X7B A;  3IC1 A;  4NCZ A;  1IYL A;  4Q38 A;  7CPA A;  5KTC A;  3FNC A;  4UIB A;  2JLM A;  2OOT A;  4KVX A;  3BJ7 A;  1IOF A;  4NF1 A;  1VGY A;  2EBJ A;  2V8G A;  3FIX A;  1XF8 A;  4OAE A;  4OC4 A;  3A9L A;  1B87 A;  5AG5 A;  4CPA A;  4OIW A;  1K4J A;  1MJA A;  3EY5 A;  3PFO A;  4B6Z A;  2K5T A;  4HNW B;  3KQX A;  2IJZ A;  3WT4 A;  1VHE A;  4B14 A;  3KHZ A;  4P4D A;  3WC5 A;  1OZP A;  3D68 A;  1XMB A;  3GLJ A;  1TF8 A;  4WWV A;  4HPS A;  1PYT B;  2Z3O A;  4P44 A;  4CYP A;  1YK3 A;  2ZW6 A;  3IU1 A;  1XOV A;  4KVO E;  1F2O A;  1L0C A;  1CG2 A;  1CPX A;  1ELL P;  4QB9 A;  1BO4 A;  3T8W A;  3DDD A;  4UFX A;  4A39 A;  2P6F A;  3CT9 A;  2ZW7 A;  5CPA A;  1XFO A;  1A2Z A;  1Q2Y A;  1ZG8 A;  4MRI A;  4B13 A;  4CRZ B;  5F09 A;  1MK4 A;  5FVJ A;  2PIZ A;  1VKC A;  3FEE A;  2CNT A;  2Q4Z A;  2ZEM A;  3CPX A;  4R3K A;  5ISV A;  2POK A;  2B58 A;  4MFJ A;  3V7Z A;  1UWY A;  2VQY A;  2CNS A;  1AYE A;  2NMT A;  2QEC A;  2P0W A;  2WZN A;  3RBU A;  1CBX A;  2Q44 A;  2YNC A;  1FY7 A;  3IO1 A;  2CY2 A;  2GFQ A;  3KL9 A;  4YU9 A;  4E2A A;  1TKH A;  5THW A;  2V8H A;  1KUX A;  2DF5 A;  3DR8 A;  4XPL A;  2R1I A;  4I49 A;  4AVA A;  5IX3 A;  2PJC A;  4KOY A;  1TF9 A;  3CXS A;  2EO8 A;  3IWE A;  2PRB A;  4FUU A;  1QSM A;  3PEI A;  4YRH A;  2VXK A;  4MCQ A;  4BIN A;  4P10 A;  2C6G A;  1Z5R A;  4H6U A;  2PJ3 A;  4OKO A;  5F47 A;  3D3S A;  2PJ8 A;  3TX8 A;  4MHP A;  4MFZ A;  3B7I A;  2OU2 A;  2ZEG A;  4OLL A;  4ZX9 A;  3RNZ A;  4CGO A;  1YLO A;  1R57 A;  5A28 A;  1YVO A;  2B5G B;  2Q7S A;  4R6T A;  1S5K A;  5LRK A;  3B3T A;  3N7Z A;  2PJ4 A;  4A95 A;  2B5G A;  1XJO A;  3I3G A;  3BI0 A;  4C2Z A;  4NGR A;  1XEB A;  4AG7 A;  4MHD A;  3FBU A;  2I3C A;  2WSA A;  3B8G A;  3I9S A;  2AFW A;  3D2M A;  2EK9 A;  3S6K A;  1CX8 A;  2CNM A;  1NSA A;  1QSO A;  3HUV A;  1YSJ A;  2VL1 A;  2NSM A;  4KSI A;  2JDC A;  2JEV A;  5HH1 A;  2ZEP A;  4CGM A;  2ZPA A;  5E96 A;  4A94 A;  4CYQ A;  1MJ9 A;  1HDU A;  2G3A A;  4MCS A;  2Y0M A;  4P4I A;  3G8W A;  5CNP A;  4AVC A;  2B4D A;  4JXQ A;  4PSX A;  2WYR A;  4Z65 A;  4L89 A;  1R43 A;  2GIV A;  2PQ8 A;  3D7D A;  3T9Y A;  2ZEO A;  4B5P B;  4OC3 A;  4PXC A;  4IAV A;  3B3C A;  4UCM A;  3SI0 A;  4CYO A;  5D29 A;  4NEX A;  2PDO A;  2J8M A;  2XEG A;  2JBK A;  2P6G A;  1ZG9 A;  3KGQ A;  1NSL A;  1S7F A;  2OH1 A;  4FWU A;  1NMT A;  1U6M A;  4PSW A;  3BLN A;  4XNH C;  5EC4 A;  5KTD A;  5J1Q A;  1WK4 A;  3EXN A;  4UEE A;  4R8F A;  2HC9 A;  1CP6 A;  4UFW A;  2OZH A;  4NGT A;  2FS5 A;  3S9M A;  3QAY A;  4CAW A;  4L8A A;  1YVK A;  2AFM A;  2ZOF A;  1YGH A;  1Z8T A;  2HUZ A;  2AE6 A;  1CPS A;  2GE3 A;  2JDD A;  2YGW A;  2VEZ A;  2PJ6 A;  3FB3 A;  1M4G A;  4JZ0 A;  1JWQ A;  4YGO A;  1HDQ A;  2EUI A;  1Y9K A;  4JJX A;  4MY3 A;  3VH9 A;  1IIC A;  2PSW A;  4MI4 A;  3S6F A;  4DUK A;  4UBR A;  3BJ8 A;  3EFA A;  3IFE A; 
#chains in the Genus database with same CATH homology
 1M4I A;  4B11 A;  4F0X A;  3KKW A;  3R9G A;  4KOT A;  1CM0 A;  4U5Y A;  1IYK A;  5DWM A;  3ZZI A;  4HNY B;  2FCK A;  1J4J A;  4FD4 A;  3UY5 A;  4F0Y A;  5C88 A;  3R96 A;  3TCV A;  1Z9U A;  2BEI A;  1MJB A;  4KOX A;  3PZJ A;  3P2F A;  3SXN A;  1RXT A;  4CAV A;  4AG9 A;  4CGL A;  1Y9W A;  1M1D A;  4FD7 A;  4KSA A;  4LUA A;  4FD6 A;  4KUA A;  4MFP A;  1M4D A;  4II9 A;  2REF A;  3G3S A;  3TOB A;  3RYO A;  3MGD A;  4UWI A;  2Z3L A;  3LD2 A;  3LOD A;  4PV6 A;  3FRM A;  1QSN A;  4MY0 A;  1CJW A;  1Q2D A;  2YNC C;  3W6X A;  1RO5 A;  2VZZ A;  2HV2 A;  1YLE A;  4QC6 A;  4R9M A;  4A32 A;  2VZY A;  3D2P A;  4MFQ A;  5J8C A;  2RC4 A;  1SQH A;  1P0H A;  5AG7 A;  5HMN A;  5JQ4 A;  1S7N A;  4OAD A;  5H86 A;  4UCP A;  1M44 A;  2ZW5 A;  1YX0 A;  3S6G A;  3JVN A;  4KUB A;  1TIQ A;  3W91 A;  3TE4 A;  2DXQ A;  1V0C A;  4UWJ A;  4B12 A;  2VI7 A;  4KLV A;  4XPK A;  3DNS A;  4R57 A;  3IGR A;  2Z3M A;  4QBJ A;  2C27 A;  3SHP A;  4C2Y A;  4HNX B;  4XPD B;  1I21 A;  4R3L A;  2FSR A;  2OZU A;  5DWN A;  4HKF A;  3GY9 A;  2EVN A;  4KOS A;  4UCN A;  2PR1 A;  4PK2 A;  2IL4 A;  2FT0 A;  2G0B A;  4E0A A;  4RI1 A;  2D4O A;  2Z3N A;  4Q36 A;  4C7I A;  4AVB A;  1QSR A;  3H4Q A;  4Y49 C;  4YFJ A;  4MJ8 A;  2ATR A;  4ZGY B;  4PK3 A;  2B4D B;  3EO4 A;  4JD6 A;  4K30 A;  2KCW A;  1ZO0 A;  4KOW A;  4XPD C;  3TO7 A;  5IV0 A;  3D8P A;  3TOA A;  2WUU A;  3TO9 A;  3W6S A;  4KVM E;  5J8F A;  4JWP A;  1UFH A;  2Z0Z A;  3QB8 A;  1YRE A;  1QST A;  4LX9 A;  1KUY A;  3JUW A;  2Q7B A;  2REE A;  4A33 A;  5AGE A;  4QUS A;  3F5B A;  2Z10 A;  4BMH A;  3IU2 A;  4C7H A;  2QIR A;  4CGP A;  4EVY A;  1KUV A;  4U9Z A;  5G1Z A;  3WR7 A;  2DPS A;  1N71 A;  3TO6 A;  4B5O A;  4CAE A;  4U9Y A;  3T90 A;  2FXF A;  3R95 A;  4AB7 A;  5A27 A;  3PP9 A;  1YR0 A;  5KTA A;  5IB0 A;  1I12 A;  5JPH A;  1BOB A;  3R9E A;  3ZJ0 A;  4DNC A;  4UFV A;  2OZG A;  3TTH A;  4GS4 A;  2G3T A;  5H84 A;  4JLY A;  4A2Z A;  4B5P A;  1B6B A;  2Q0Y A;  4H89 A;  1VHS A;  5G22 A;  2BL1 A;  4Y49 B;  4NSQ A;  1XIX A;  4CYN A;  3P2H A;  1Q2C A;  3SXO A;  4UA3 A;  3VWE A;  3V8I A;  4B10 A;  5AG4 A;  3F8K A;  1Z4E A;  2Q4Y A;  4XNH B;  4QVT A;  4CAF A;  2YND A;  4R87 A;  4KOR A;  3S6H A;  2B3U A;  1I1D A;  2CXA A;  4M85 A;  2GAN A;  4RS2 A;  5C82 A;  1PU9 A;  1Y7R A;  4IUS A;  5G20 A;  4M3S A;  2YNE A;  3F0A A;  2AJ6 A;  5I0C A;  2R98 A;  3EC4 A;  4NXY A;  2OB0 A;  3DR6 A;  2H5M A;  1IID A;  5AG6 A;  2Z3K A;  2FE7 A;  3GYA A;  2PC1 A;  4C68 A;  3C26 A;  3NE7 A;  4ZBG A;  3GKR A;  4CAX A;  5EBV A;  2R8V A;  3K9U A;  5GCN A;  2R7H A;  2WPW A;  4CS0 B;  4ORF A;  4A30 A;  4CGN A;  4KOV A;  4FD5 A;  2I00 A;  2QML A;  2Z11 A;  1PUA A;  3H5Z A;  4KSF A;  1IB1 E;  5BWA B;  5F48 A;  5G21 A;  3QAH A;  1S60 A;  2ARH A;  3VWD A;  4A31 A;  4KLW A;  2FL4 A;  3DSB A;  4MFK A;  2A4N A;  2FIW A;  5F49 A;  1NE9 A;  1XMT A;  3CXQ A;  4KOU A;  2VBQ A;  3R9F A;  1S7L A;  2F5I A;  3IWG A;  1S7K A;  4IF5 A;  1Z4R A;  2D4P A;  3OWC A;  4JXR A;  2FIA A;  4MFL A;  2WPX A;  1S3Z A;  3PGP A;  3R1K A;  4X5K A;  2ZW4 A;  4J3G A;  2Q04 A;  4CRY B;  4ONU A;  5F46 A;  3TFY A;  2DPT A;  3FXT A;  4C2X A;  2B4B A;  2J8R A;  2Q4V A;  1GHE A;  3TT2 A;  3FYN A;  2O28 A;  4F6A A;  2ZXV A;  4H6Z A;  1WWZ A;  2I79 A;  4E8O A;  1P4N A;  3CXP A;  4BBH A;  4KZT A;  4MBU A;  2PR8 A;  1ON0 A;  2BSW A;  1KZF A;  1XE4 A;  4KS9 A;  1LRZ A;  2HQY A;  2J8N A;  2B3V A;  2BUE A;  2Z3P A;  3JTK A;  3E0K A;  2P6E A;  2X7B A;  4Q38 A;  4NCZ A;  1IYL A;  5KTC A;  3FNC A;  2JLM A;  4KVX A;  3BJ7 A;  4NF1 A;  3FIX A;  1XF8 A;  4OAE A;  3A9L A;  1B87 A;  5AG5 A;  1K4J A;  1MJA A;  3EY5 A;  2K5T A;  4HNW B;  4B14 A;  1OZP A;  2Z3O A;  4CYP A;  1YK3 A;  2ZW6 A;  3IU1 A;  4KVO E;  1L0C A;  4QB9 A;  1BO4 A;  3DDD A;  4UFX A;  2P6F A;  2ZW7 A;  1Q2Y A;  4B13 A;  4CRZ B;  1MK4 A;  5FVJ A;  1VKC A;  2CNT A;  4R3K A;  5ISV A;  2B58 A;  4MFJ A;  2VQY A;  2CNS A;  2QEC A;  2NMT A;  2P0W A;  2YNC A;  2Q44 A;  4E2A A;  1FY7 A;  2CY2 A;  1KUX A;  3DR8 A;  4XPL A;  2R1I A;  4I49 A;  4AVA A;  5IX3 A;  4KOY A;  3CXS A;  3IWE A;  2PRB A;  1QSM A;  4YRH A;  2VXK A;  4H6U A;  5F47 A;  3D3S A;  4OLL A;  4MFZ A;  4CGO A;  2OU2 A;  5A28 A;  1R57 A;  1YVO A;  2B5G B;  1S5K A;  4A95 A;  3N7Z A;  2B5G A;  3I3G A;  4C2Z A;  1XEB A;  4AG7 A;  4MHD A;  3FBU A;  2WSA A;  3B8G A;  3I9S A;  3D2M A;  3S6K A;  2CNM A;  1QSO A;  2JDC A;  2JEV A;  5HH1 A;  4CGM A;  4CYQ A;  2ZPA A;  5E96 A;  1MJ9 A;  2G3A A;  2Y0M A;  3G8W A;  5CNP A;  4AVC A;  2B4D A;  4JXQ A;  4PSX A;  4L89 A;  2GIV A;  2PQ8 A;  3T9Y A;  4B5P B;  4UCM A;  4CYO A;  4NEX A;  2PDO A;  2J8M A;  2P6G A;  1NSL A;  1S7F A;  2OH1 A;  1NMT A;  1U6M A;  4PSW A;  3BLN A;  4XNH C;  5EC4 A;  5KTD A;  1WK4 A;  3EXN A;  4UFW A;  2OZH A;  2FS5 A;  4CAW A;  4L8A A;  1YVK A;  1YGH A;  2HUZ A;  2AE6 A;  2GE3 A;  2JDD A;  2YGW A;  2VEZ A;  3FB3 A;  1M4G A;  4YGO A;  2EUI A;  1Y9K A;  4JJX A;  4MY3 A;  1IIC A;  2PSW A;  4MI4 A;  3S6F A;  4UBR A;  3BJ8 A;  3EFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...