2REFA

Crystal structure of the loading gnatl domain of cura from lyngbya majuscula soaked with malonyl-coa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
203
structure length
203
Chain Sequence
CFENNYYNLRHPKIEDLRDLIALETLCWSENLQVDNEEIYRRIFKIPQGQFILELEDKIVGAIYSQRIDNPQLLDNKTCTQVPLLHTESGVVVQLLAVNILPELQNQGLGDRLLEFMLQYCAQISGVEKVVAVTLCRNYPDYSPMPMAEYIHQKNESGLLVDPLLRFHQIHGAKIEKLLPGYRPKDWENQTCGVLVSYDIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CurA
publication title GNAT-like strategy for polyketide chain initiation.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase, lyase
total genus 56
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.3.1.38: [Acyl-carrier-protein] S-acetyltransferase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2refA01
3S6FA 2A4NA 1S7LA 3DDDA 2G3TA 1S3ZA 2NMTA 4R57A 2RC4A 4II9A 4YRHA 1YVKA 4LX9A 3TOBA 3EC4A 4U9ZA 1PU9A 4RS2A 4AB7A 4AVCA 4AVBA 1Y7RA 4KZTA 1S7FA 1YVOA 2BSWA 3DR8A 2FXFA 5IV0A 5F46A 2VZYA 4L89A 3FB3A 2Z10A 4UWJA 4FD6A 2IL4A 3R9FA 4QBJA 1I1DA 5E96A 5C88A 1MJBA 2P0WA 2R98A 4OAEA 2CNMA 2GE3A 1QSMA 4XNHB 4KVOE 1U6MA 3UY5A 2I79A 4NSQA 3R9EA 3VWEA 4FD7A 4OADA 4JXRA 2OB0A 1VKCA 3TCVA 1S7NA 3S6GA 4HNYB 2GANA 1IYKA 4XPDC 2FCKA 2FS5A 2ZXVA 3W6SA 3T90A 1XE4A 2KCWA 2PR8A 1MK4A 3GY9A 3E0KA 4PK2A 3SHPA 1Y9KA 3TO6A 2G0BA 5HH1A 2ZW5A 2D4PA 3GKRA 1KUYA 2PDOA 4Y49C 3QAHA 4R87A 3QB8A 2JDDA 2Z11A 2PRBA 1NSLA 1L0CA 2Q7BA 1M4DA 1YREA 3FBUA 4ZBGA 4E0AA 4K30A 2FT0A 3DR6A 1K4JA 2CNTA 5J8FA 5C82A 2VXKA 1YX0A 3PP9A 2ATRA 5CNPA 1NE9A 2FIAA 1LRZA 2EVNA 3G8WA 2REFA 1YLEA 1I21A 1QSOA 1YGHA 4CAWA 4KOVA 2BEIA 3F5BA 4J3GA 3FYNA 1Z9UA 3I3GA 1KZFA 1M1DA 1NMTA 4R9MA 1PUAA 4MHDA 2GIVA 2P6EA 1Q2CA 2J8NA 3NE7A 3EO4A 1QSNA 4NCZA 2OZGA 1XIXA 2B3UA 2HQYA 4KVME 4JJXA 2Z0ZA 5F49A 4KOSA 4B5OA 3BJ7A 4KOYA 1VHSA 2B4DB 2JEVA 2B4DA 2FIWA 4U5YA 1KUVA 3EFAA 2Q4YA 4QUSA 3C26A 3W91A 5J8CA 1YK3A 4H6UA 5EC4A 2WPWA 4I49A 4F6AA 4X5KA 3RYOA 1QSTA 3S6HA 2QMLA 4JXQA 2CY2A 2ARHA 4HNWB 5JPHA 2DXQA 4M85A 2R1IA 1S7KA 3MGDA 4FD4A 4R3KA 2Y0MA 2VQYA 2B3VA 3H4QA 2QIRA 4LUAA 4NEXA 4XNHC 4XPLA 2PR1A 2Q0YA 1Y9WA 4UBRA 5IX3A 3W6XA 3PZJA 4XPDB 4AG7A 4PSWA 4CRYB 4AVAA 2AJ6A 4KLWA 3TO9A 4HNXB 2QECA 2REEA 4F0YA 5DWNA 3GYAA 4QB9A 1KUXA 1IB1E 4RI1A 5F48A 2FL4A 3FNCA 2VEZA 1B87A 4PSXA 2B4BA 2FSRA 4NF1A 2G3AA 3DSBA 1Q2YA 3TOAA 4KORA 4B5PB 4B5PA 4MI4A 3F0AA 3P2HA 4FD5A 3IWGA 3TE4A 5I0CA 1BO4A 3JUWA 3R95A 2B58A 3F8KA 5KTCA 5GCNA 1XMTA 1CM0A 2O28A 3SXOA 2D4OA 4EVYA 5F47A 2OZHA 3D8PA 3R9GA 3B8GA 4R3LA 2CNSA 4UA3A 1YR0A 4HKFA 2Q04A 2ZW6A 4MJ8A 3EY5A 3SXNA 1S60A 2BL1A 4BMHA 3I9SA 3D2MA 4AG9A 2HV2A 1M44A 2ZW7A 1S5KA 4KLVA 2P6FA 3FXTA 5ISVA 1RXTA 4QVTA 2PC1A 2PQ8A 4YFJA 5FVJA 1XEBA 1MJ9A 3FRMA 4QC6A 1QSRA 1SQHA 2VZZA 1M4GA 2P6GA 2F5IA 4KOUA 4MY3A 1J4JA 4KUAA 3CXQA 1P4NA 3BLNA 4ONUA 3PGPA 4KVXA 5H84A 4JWPA 1IYLA 4MBUA 3CXPA 3TO7A 1GHEA 2HUZA 2ZW4A 4U9YA 4KUBA 4H6ZA 4L8AA 2JDCA 2OZUA 4KOTA 4PV6A 1FY7A 4JD6A 3ZZIA 2R8VA 3LODA 2Q44A 2ZPAA 5KTDA 2AE6A 1M4IA 3BJ8A 3D3SA 3R1KA 4XPKA 4CAVA 2H5MA 3TTHA 4ORFA 2OH1A 4E8OA 1WWZA 3DNSA 4CS0B 2Q4VA 3P2FA 2I00A 1CJWA 4YGOA 5H86A 4JLYA 5IB0A 1N71A 3LD2A 3TT2A 3N7ZA 4H89A 4PK3A 4Y49B 3G3SA 4GS4A 2R7HA 2J8MA 4DNCA 3KKWA 3IGRA 1Z4RA 1P0HA 3TFYA 3OWCA 3S6KA 1I12A 3V8IA 3VWDA 2FE7A 2X7BA 2K5TA 2BUEA 5HMNA 4IUSA 1IIDA 2VI7A 4UWIA 4KOWA 1UFHA 1RO5A 1B6BA 2WPXA 1WK4A 2C27A 3ZJ0A 4KOXA 4NXYA 1MJAA 1V0CA 1TIQA 3T9YA 1IICA 4CRZB 2VBQA 4MY0A 5DWMA 5EBVA 4E2AA 3WR7A 2JLMA 2EUIA 1OZPA 2B5GB 1XF8A 2B5GA 4OLLA 5KTAA 1R57A 1ON0A 1Q2DA 2PSWA 3D2PA 3K9UA 4IF5A 3CXSA 4M3SA 5JQ4A 3FIXA 2J8RA 3JVNA 3R96A 4CAXA 3EXNA 1Z4EA 1BOBA 2OU2A
chains in the Genus database with same CATH superfamily
3S6FA 2PJCA 3ISXA 3H8GA 2A4NA 3D68A 1S7LA 2PIZA 3DDDA 2G3TA 1ELMP 1S3ZA 4RUHA 3IO1A 2NMTA 4R57A 2RC4A 4II9A 2PJ2A 3KQZA 3V7ZA 2YNCA 2Z3LA 1VIXA 1YVKA 3FVLA 4LX9A 4YRHA 4IK2A 4BINA 3D7DA 3TOBA 5D29A 2PJ3A 4CGLA 1IU8A 3EC4A 4U9ZA 4PPZA 2XEGA 1PU9A 2IQ6A 4NGSA 4RS2A 4AB7A 4AVCA 4MRIA 4AVBA 4ZX8A 1Z2LA 1Y7RA 4KZTA 2NYQA 1ZG8A 1XOVA 1S7FA 3NH5A 3PB7X 4JZ0A 3SI1A 5I4MA 3HLPA 4C2YA 1YVOA 3SJEA 1IOFA 2BSWA 4NGTA 1KWMA 3D4UA 3DR8A 3SJGA 2FXFA 5IV0A 5F46A 3H8EA 2VZYA 2ZEOA 4L89A 3FB3A 1LAPA 5EMIA 4UCPA 5JGFA 2CF4A 2Z10A 4UWJA 3B3WA 4FD6A 2IL4A 3R9FA 4QBJA 1I1DA 3NH4A 3K2KA 5E96A 4EMEA 4MFPA 5C88A 1TKFA 1MJBA 3WABA 1Z8XA 2V8HA 2P0WA 2R98A 4C7HA 4LQ6A 4OMEA 4OAEA 2CNMA 2GE3A 1QSMA 1YQEA 4IHMA 4XNHB 4DJLA 1PYTB 4KVOE 2PJ4A 1U6MA 4OP4A 3UY5A 3SJFA 4P44A 2I79A 4NSQA 4OC2A 4PQAA 3R9EA 3PRTA 3VWEA 3K9TA 4FD7A 4OADA 4JXRA 2OB0A 5AG5A 5HXDA 1VKCA 4P6YA 1XBUA 2V8DA 3QNVA 4W9YA 3I1UA 4X3RA 3TCVA 3B2YA 1S7NA 3PFOA 3S6GA 2AFUA 1UWYA 4HNYB 2GANA 1IYKA 3IWEA 2PJ6A 2DEAA 5LYLA 3D7GA 4XPDC 2FCKA 3PB4X 4Q36A 1VHEA 4R76A 1JQGA 2FS5A 2ZENA 2ZXVA 3W6SA 3T90A 1XE4A 2KCWA 4MFZA 3SJXA 2PJ7A 2PR8A 1MK4A 4FAIA 3GY9A 1ZLIA 2Z3MA 3KI9A 2Z3NA 4CGOA 3E0KA 2PIYA 4PK2A 5CBMA 4MFQA 2RFHA 2Z3OA 3SHPA 2Q51A 1Y9KA 3TO6A 4C68A 1H8LA 3B35A 2G0BA 5HH1A 4ONWA 2ZW5A 2D4PA 2QYVA 2JBKA 3GKRA 1KUYA 2PDOA 3FMCA 4Y49C 3D7FA 3QAHA 2QVPA 5HVHA 2EO8A 4R87A 1CPXA 3QB8A 2XEJA 2VL1A 1HEEA 2JDDA 2Z3KA 2Z11A 2PRBA 4CAFA 1NSLA 1OBRA 2AFOA 4CPAA 1L0CA 2ZEFA 1Y0RA 2Q7BA 1M4DA 4CAEA 3FEDA 4A30A 1YREA 4Q7AA 3FBUA 4ZBGA 4E0AA 4MXUA 4CYQA 4K30A 2FT0A 4F8ZA 2PJBA 3DR6A 2IMOA 4B14A 1K4JA 2CNTA 4NGMA 5J8FA 5C82A 1F2OA 2VXKA 2O4HA 1YX0A 2Q43A 3PP9A 2ATRA 2F8HA 1NE9A 2PJ8A 2FIAA 1LRZA 2EVNA 5CNPA 5DS0A 3V38A 3G8WA 1TKJA 4EFDA 2REFA 4UFVA 1YLEA 1I21A 1LCPA 1QSOA 3GIUA 3FEEA 1YGHA 4CAWA 4KOVA 2BEIA 3IU2A 2ZOGA 1BPMA 4OIDA 4MCRA 3IFEA 4A38A 3F5BA 3BI1A 2PJ0A 4J3GA 3FYNA 3TX8A 1Z9UA 2C6CA 4A95A 3I3GA 1CP6A 2ZOFA 4P10A 1KZFA 1M1DA 4MHNA 1NSAA 4UCMA 4UF4A 1NMTA 1ZO0A 4R9MA 1QMUA 4WJBA 1PUAA 3IU1A 4MHDA 2GIVA 4DUKA 4FBEA 2P6EA 1Q2CA 2C1CA 2J8NA 3NE7A 2GU2A 6CPAA 3EO4A 4MCPA 1QSNA 3KL9A 4NCZA 2OZGA 1XIXA 2AFZA 2AFXA 2ZEHA 2B3UA 2HQYA 4C2ZA 3LWUA 4KVME 4JJXA 3BI0A 2Z0ZA 5F49A 4KOSA 1XRYA 1IY7A 4NFRA 5G21A 4B5OA 3B3VA 3BJ7A 1VHOA 4KOYA 2AFWA 2PRQA 2WUUA 1VHSA 2Q4ZA 2AFSA 2B4DB 2JEVA 2B4DA 2Z3PA 4MFJA 5THWA 4C2XA 5LRKA 2FIWA 4U5YA 4K3NA 8CPAA 1KUVA 2PCUA 3EFAA 1BPNA 2YNCC 2Q4YA 4QUSA 3A9LA 3NH8A 4Q38A 3SI2A 4IAVA 3C26A 1XMBA 4X2TA 3S9LA 2IJZA 2ZELA 3IJ3A 5AGEA 5K8PA 1DTDA 1ZG9A 3W91A 1YW6A 5J8CA 1YK3A 4H6UA 5EC4A 2WPWA 3RBUA 4UFXA 4I49A 4F6AA 4JYWA 2CTBA 2FVGA 2BO9A 4MHPA 1TF9A 4FWUA 1CPSA 4X5KA 3RYOA 1QSTA 4KSIA 4G1PA 5G22A 3S6HA 3KHZA 2QMLA 4OIWA 4CGNA 4JXQA 2JEWA 3NFZA 3B3CA 5LRGA 1FT7A 4OC3A 3FJUA 5JH9A 2CY2A 4WWVA 2C6PA 2ARHA 4HNWB 5JPHA 2DXQA 3GUXA 4M85A 1HDUA 2R1IA 1TF8A 2PVVA 3JRUA 1S7KA 1TXRA 3MGDA 3D7HA 3WC5A 4FD4A 4R3KA 2Y0MA 2VQYA 2B3VA 3H4QA 2QIRA 4LUAA 4NEXA 4XNHC 1XJOA 4XPLA 2PR1A 3WT4A 4P4EA 3PB9X 4X8IA 3SI0A 3TC8A 2Q0YA 2EK9A 1Y9WA 4UBRA 5IX3A 4LQGA 2GLFA 3W6XA 3PZJA 4F0XA 4OC1A 2ANPA 4XPDB 4M6GA 2ODFA 2WSAA 4AG7A 4PSWA 1YSJA 3L2NA 3QAYA 3N5FA 4CRYB 4AVAA 2QJ8A 2AJ6A 2BOAA 2GFQA 4KLWA 3TO9A 4M6IA 4B13A 4HNXB 2QECA 2REEA 3BXMA 4CYNA 5DWNA 4F0YA 3GYAA 4QB9A 2DPSA 2XEIA 4MMOA 5AG4A 4P4BA 3VARA 1IOIA 1IB1E 1KUXA 1LOKA 2FL4A 1X12A 4RI1A 4TNUA 1IGBA 5F48A 3FNCA 3RAMA 2VEZA 5K8OA 3MN8A 1B87A 4PSXA 5LRJA 4CYPA 2PJ1A 2B4BA 2CIJA 4BD9A 4ZY1A 2FSRA 4NF1A 2G3AA 3DSBA 1Q2YA 4BBHA 2OR4A 1ZG7A 2F7VA 4KORA 3TOAA 3PBEA 4B12A 3CPXA 4B5PB 3CZXA 4MI4A 4B5PA 1JWQA 1BLLE 4M6HA 2PJ5A 2PVWA 3F0AA 3P2HA 4FD5A 3IEHA 3IWGA 3PB6X 4A94A 3DLJA 4PXEA 3TE4A 5AG7A 5I0CA 1BO4A 1GYTA 4A2ZA 1R3NA 3JUWA 1YW4A 3R95A 4DYOA 2B58A 4OC5A 5K8MA 3F8KA 5KTCA 5GCNA 1XMTA 4MHZA 1CM0A 4NJQA 2O28A 4KS9A 3SXOA 3B3TA 4F9UA 2D4OA 4UFWA 4P4FA 4EVYA 3S9NA 4UIAA 5F47A 2OZHA 2ZEMA 3D8PA 4PXBA 3R9GA 5A28A 2ZEEA 4UEZA 3B8GA 2V77A 4R3LA 1AMPA 4F9VA 2CNSA 3T8WA 4UA3A 1YR0A 4HKFA 2Q04A 2ZW6A 5G20A 3BHXA 2ZEPA 2C6GA 3KQXA 4MJ8A 4R7MA 3EY5A 3SXNA 1S60A 2BL1A 3LMSA 1ZLHA 1Z5RA 4MFLA 4BMHA 2HC9A 4R8FA 3I9SA 3D2MA 4AG9A 4B10A 1Y7EA 1ARMA 1PCAA 2HV2A 2XEFA 5JM6A 1M44A 2ZW7A 1S5KA 3FH4A 4HPSA 1XFOA 2P6FA 3FXTA 4KLVA 4OC4A 5ISVA 1RXTA 4QVTA 4KSFA 2PC1A 2PQ8A 4YFJA 5FVJA 1AUGA 5ELYA 4A31A 2RB7A 1XEBA 3IC1A 1Z8TA 4P4IA 1MJ9A 3D67A 3FRMA 4O23A 3PEIA 4QC6A 1QSRA 1SQHA 1CX8A 4A32A 3PFEA 2VZZA 4FUUA 2DF5A 1M4GA 2P6GA 2F5IA 4KOUA 2WYRA 2POKA 4MY3A 4NJRA 1J4JA 3MRUA 3CXQA 4KUAA 4ZY0A 1P4NA 4B11A 3KZWA 3BLNA 4ONUA 4UEFA 3PGPA 4P45A 4KVXA 3B3SA 3PB8X 3RNZA 5H84A 4JWPA 1IYLA 4EWTA 3CDXA 5D8NA 4MBUA 4A37A 3CXPA 4UEEA 2J9AA 1BAVA 4A39A 3TO7A 1GHEA 2YGWA 2HUZA 3B7IA 2ZW4A 1M4LA 3KASA 4P4DA 4KUBA 4U9YA 4H6ZA 2YNDA 4L8AA 2GLJA 2DPTA 4AXVA 2JDCA 2OZUA 3NE8A 4KOTA 4MCQA 5HVGA 4PV6A 1FY7A 4KSAA 1R43A 4RN7A 4ZI6A 1Y0YA 2V8GA 4JD6A 3ZZIA 2R8VA 1A2ZA 3LODA 2Q44A 2ZPAA 3LACA 5KTDA 4OKOA 2AE6A 1M4IA 3BJ8A 3D3SA 3R1KA 4XPKA 4CGMA 4CAVA 4OC0A 5IB9A 5HVFA 2H5MA 3TTHA 4A33A 4ORFA 4NGNA 2ABZA 1HDQA 1LFWA 2OH1A 2NSMA 4E8OA 1ELLP 1WWZA 3DNSA 5K8NA 2G9DA 4CS0B 5BWAB 2Q4VA 3P2FA 5AG6A 4ZGYB 3WC7A 3GB0A 2I00A 4CGPA 4H2KA 1CJWA 4YGOA 1AYEA 4JLYA 5H86A 1LAMA 4YU9A 5IB0A 1N71A 1ARLA 3LD2A 3TT2A 3N7ZA 1TKHA 4PXCA 1DE4C 2I3CA 4H89A 4PK3A 4MFKA 3G3SA 4GS4A 2R7HA 4Y49B 3S9MA 4C7IA 4CYOA 1Z8LA 2YNEA 2J8MA 4DNCA 3KKWA 3IGRA 1Z4RA 1P0HA 3H8FA 2BCOA 1YLOA 2ZEGA 4NGPA 2Q7SA 3TFYA 3OWCA 1YMEA 3S6KA 1I12A 3CPAA 1F2PA 1X10A 3WC6A 4NGRA 3V8IA 3VWDA 1CBXA 4UCNA 1RTQA 2O53A 2FE7A 2X7BA 4MCSA 5CPAA 3RZAA 2K5TA 3VATA 2ZEDA 5F09A 2BUEA 5HMNA 7CPAA 4IUSA 1IIDA 3FF3A 2VI7A 4UWIA 1EE3P 1UFHA 2WZNA 1CG2A 3DGVA 4GM5A 4KOWA 3VH9A 5LYFA 1RO5A 1B6BA 1CP7A 1LANA 2WPXA 1VGYA 1WK4A 2C27A 2EK8A 3ZJ0A 1Z8WA 3PBBA 3RO0A 3KGQA 2V8VA 4KOXA 3IIBA 3NA6A 4NXYA 4B6ZA 2EWBA 5LYDA 2GREA 4ZYQA 1MJAA 1F57A 1TIQA 1V0CA 1QQ9A 1IICA 2CTCA 2PJ9A 4R6TA 4ZX9A 3T9YA 4MHYA 4CRZB 2VBQA 4MY0A 5DWMA 5EBVA 4E2AA 3WR7A 2JBJA 2JLMA 5G1ZA 2EUIA 1OZPA 1Q7LA 4TWEA 4UIBA 5LYIA 4PXDA 3H5ZA 2CXAA 2B5GB 1XF8A 2B5GA 3HUVA 5A27A 4OLLA 5KTAA 2HB6A 1R57A 3FECA 2OOTA 4Z65A 1ON0A 3JTKA 4YWYA 1Q2DA 2PSWA 3D2PA 3IWWA 3GLJA 3CXSA 3K9UA 3D66A 3KHXA 4IF5A 4M3SA 5JQ4A 3FIXA 2J8RA 3KR5A 1FNOA 3FX6A 4ZY2A 2PJAA 2AFMA 3JVNA 3CT9A 2EBJA 3KR4A 4P4JA 5J1QA 3R96A 3ISZA 2PE3A 4GXHA 4CAXA 3EXNA 4NGQA 1Z4EA 1BOBA 2OU2A
chains in the Genus database with same CATH topology
3S6FA 2A4NA 1S7LA 3DDDA 2G3TA 1S3ZA 2NMTA 4R57A 2RC4A 4II9A 2YNCA 2Z3LA 4YRHA 1YVKA 4LX9A 3TOBA 4CGLA 3EC4A 4U9ZA 1PU9A 4RS2A 4AB7A 4AVCA 4AVBA 1Y7RA 4KZTA 1S7FA 4C2YA 1YVOA 2BSWA 3DR8A 2FXFA 5IV0A 5F46A 2VZYA 4L89A 3FB3A 4UCPA 2Z10A 4UWJA 4FD6A 2IL4A 3R9FA 4QBJA 1I1DA 5E96A 4MFPA 5C88A 1MJBA 2P0WA 2R98A 4C7HA 4OAEA 2CNMA 2GE3A 1QSMA 4XNHB 4KVOE 1U6MA 3UY5A 2I79A 4NSQA 3R9EA 3VWEA 4FD7A 4OADA 5AG5A 4JXRA 2OB0A 1VKCA 3TCVA 1S7NA 3S6GA 4HNYB 2GANA 1IYKA 3IWEA 4XPDC 2FCKA 4Q36A 2FS5A 2ZXVA 3W6SA 3T90A 1XE4A 2KCWA 4MFZA 2PR8A 1MK4A 3GY9A 2Z3MA 4CGOA 2Z3NA 3E0KA 4PK2A 4MFQA 2Z3OA 3SHPA 1Y9KA 3TO6A 4C68A 2G0BA 5HH1A 2ZW5A 2D4PA 3GKRA 1KUYA 2PDOA 4Y49C 3QAHA 4R87A 3QB8A 2JDDA 2Z3KA 2Z11A 2PRBA 4CAFA 1NSLA 1L0CA 2Q7BA 1M4DA 4CAEA 4A30A 1YREA 3FBUA 4ZBGA 4E0AA 4CYQA 4K30A 2FT0A 3DR6A 4B14A 1K4JA 2CNTA 5J8FA 5C82A 2VXKA 1YX0A 3PP9A 2ATRA 5CNPA 1NE9A 2FIAA 1LRZA 2EVNA 3G8WA 2REFA 4UFVA 1YLEA 1I21A 1QSOA 1YGHA 4CAWA 4KOVA 2BEIA 3IU2A 3F5BA 4J3GA 3FYNA 1Z9UA 4A95A 3I3GA 1KZFA 1M1DA 4UCMA 1NMTA 1ZO0A 4R9MA 1PUAA 3IU1A 4MHDA 2GIVA 2P6EA 1Q2CA 2J8NA 3NE7A 3EO4A 1QSNA 4NCZA 2OZGA 1XIXA 2B3UA 2HQYA 4C2ZA 4KVME 4JJXA 2Z0ZA 5F49A 4KOSA 4B5OA 5G21A 3BJ7A 4KOYA 2WUUA 1VHSA 2B4DB 2JEVA 2B4DA 2Z3PA 4MFJA 4C2XA 2FIWA 4U5YA 1KUVA 3EFAA 2YNCC 2Q4YA 4QUSA 3A9LA 4Q38A 3C26A 5AGEA 3W91A 5J8CA 1YK3A 4H6UA 5EC4A 2WPWA 4UFXA 4I49A 4F6AA 4X5KA 3RYOA 1QSTA 5G22A 3S6HA 4CGNA 2QMLA 4JXQA 2CY2A 2ARHA 4HNWB 5JPHA 2DXQA 4M85A 2R1IA 1S7KA 3MGDA 4FD4A 4R3KA 2Y0MA 2VQYA 2B3VA 3H4QA 2QIRA 4LUAA 4NEXA 4XNHC 4XPLA 2PR1A 2Q0YA 1Y9WA 4UBRA 5IX3A 3W6XA 3PZJA 4F0XA 4XPDB 2WSAA 4AG7A 4PSWA 4CRYB 4AVAA 2AJ6A 4KLWA 3TO9A 4HNXB 2QECA 2REEA 4CYNA 5DWNA 4F0YA 3GYAA 4QB9A 2DPSA 5AG4A 1KUXA 1IB1E 4RI1A 5F48A 2FL4A 3FNCA 2VEZA 1B87A 4PSXA 4CYPA 2B4BA 2FSRA 4NF1A 2G3AA 3DSBA 1Q2YA 4BBHA 4B12A 3TOAA 4KORA 4B5PB 4B5PA 4MI4A 3F0AA 3P2HA 4FD5A 3IWGA 3TE4A 5AG7A 5I0CA 1BO4A 4A2ZA 3JUWA 3R95A 2B58A 3F8KA 5KTCA 5GCNA 1XMTA 1CM0A 2O28A 4KS9A 3SXOA 2D4OA 4UFWA 4EVYA 5F47A 2OZHA 3D8PA 3R9GA 5A28A 3B8GA 4R3LA 2CNSA 4UA3A 1YR0A 4HKFA 2Q04A 2ZW6A 5G20A 4MJ8A 3EY5A 3SXNA 1S60A 2BL1A 4MFLA 4BMHA 3I9SA 3D2MA 4AG9A 4B10A 2HV2A 1M44A 2ZW7A 1S5KA 4KLVA 2P6FA 3FXTA 5ISVA 1RXTA 4QVTA 4KSFA 2PC1A 2PQ8A 4YFJA 5FVJA 4A31A 1XEBA 1MJ9A 3FRMA 4QC6A 1QSRA 1SQHA 4A32A 2VZZA 1M4GA 2P6GA 2F5IA 4KOUA 4MY3A 1J4JA 4KUAA 3CXQA 1P4NA 4B11A 3BLNA 4ONUA 3PGPA 4KVXA 5H84A 4JWPA 1IYLA 4MBUA 3CXPA 3TO7A 1GHEA 2YGWA 2HUZA 2ZW4A 4U9YA 4KUBA 4H6ZA 2YNDA 4L8AA 2DPTA 2JDCA 2OZUA 4KOTA 4PV6A 1FY7A 4KSAA 4JD6A 3ZZIA 2R8VA 3LODA 2Q44A 2ZPAA 5KTDA 2AE6A 1M4IA 3BJ8A 3D3SA 3R1KA 4XPKA 4CGMA 4CAVA 2H5MA 3TTHA 4A33A 4ORFA 2OH1A 4E8OA 1WWZA 3DNSA 4CS0B 5BWAB 2Q4VA 3P2FA 5AG6A 4ZGYB 2I00A 4CGPA 1CJWA 4YGOA 5H86A 4JLYA 5IB0A 1N71A 3LD2A 3TT2A 3N7ZA 4H89A 4PK3A 4MFKA 3G3SA 4GS4A 2R7HA 4Y49B 4CYOA 4C7IA 2YNEA 2J8MA 4DNCA 3KKWA 3IGRA 1Z4RA 1P0HA 3TFYA 3OWCA 3S6KA 1I12A 3V8IA 3VWDA 4UCNA 2FE7A 2X7BA 2K5TA 2BUEA 5HMNA 4IUSA 1IIDA 2VI7A 4UWIA 4KOWA 1UFHA 1RO5A 1B6BA 2WPXA 1WK4A 2C27A 3ZJ0A 4KOXA 4NXYA 1MJAA 1V0CA 1TIQA 3T9YA 4B13A 1IICA 4CRZB 2VBQA 4MY0A 5DWMA 5EBVA 4E2AA 3WR7A 2JLMA 5G1ZA 2EUIA 1OZPA 3H5ZA 2CXAA 2B5GB 1XF8A 2B5GA 5A27A 4OLLA 5KTAA 1R57A 1ON0A 3JTKA 1Q2DA 2PSWA 3D2PA 3K9UA 4IF5A 3CXSA 4M3SA 5JQ4A 3FIXA 2J8RA 3JVNA 3R96A 4CAXA 3EXNA 1Z4EA 1BOBA 2OU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6F A;  2A4N A;  1S7L A;  3DDD A;  2G3T A;  1S3Z A;  2NMT A;  4R57 A;  2RC4 A;  4II9 A;  4YRH A;  1YVK A;  4LX9 A;  3TOB A;  3EC4 A;  4U9Z A;  1PU9 A;  4RS2 A;  4AB7 A;  4AVC A;  4AVB A;  1Y7R A;  4KZT A;  1S7F A;  1YVO A;  2BSW A;  3DR8 A;  2FXF A;  5IV0 A;  5F46 A;  2VZY A;  4L89 A;  3FB3 A;  2Z10 A;  4UWJ A;  4FD6 A;  2IL4 A;  3R9F A;  4QBJ A;  1I1D A;  5E96 A;  5C88 A;  1MJB A;  2P0W A;  2R98 A;  4OAE A;  2CNM A;  2GE3 A;  1QSM A;  4XNH B;  4KVO E;  1U6M A;  3UY5 A;  2I79 A;  4NSQ A;  3R9E A;  3VWE A;  4FD7 A;  4OAD A;  4JXR A;  2OB0 A;  1VKC A;  3TCV A;  1S7N A;  3S6G A;  4HNY B;  2GAN A;  1IYK A;  4XPD C;  2FCK A;  2FS5 A;  2ZXV A;  3W6S A;  3T90 A;  1XE4 A;  2KCW A;  2PR8 A;  1MK4 A;  3GY9 A;  3E0K A;  4PK2 A;  3SHP A;  1Y9K A;  3TO6 A;  2G0B A;  5HH1 A;  2ZW5 A;  2D4P A;  3GKR A;  1KUY A;  2PDO A;  4Y49 C;  3QAH A;  4R87 A;  3QB8 A;  2JDD A;  2Z11 A;  2PRB A;  1NSL A;  1L0C A;  2Q7B A;  1M4D A;  1YRE A;  3FBU A;  4ZBG A;  4E0A A;  4K30 A;  2FT0 A;  3DR6 A;  1K4J A;  2CNT A;  5J8F A;  5C82 A;  2VXK A;  1YX0 A;  3PP9 A;  2ATR A;  5CNP A;  1NE9 A;  2FIA A;  1LRZ A;  2EVN A;  3G8W A;  2REF A;  1YLE A;  1I21 A;  1QSO A;  1YGH A;  4CAW A;  4KOV A;  2BEI A;  3F5B A;  4J3G A;  3FYN A;  1Z9U A;  3I3G A;  1KZF A;  1M1D A;  1NMT A;  4R9M A;  1PUA A;  4MHD A;  2GIV A;  2P6E A;  1Q2C A;  2J8N A;  3NE7 A;  3EO4 A;  1QSN A;  4NCZ A;  2OZG A;  1XIX A;  2B3U A;  2HQY A;  4KVM E;  4JJX A;  2Z0Z A;  5F49 A;  4KOS A;  4B5O A;  3BJ7 A;  4KOY A;  1VHS A;  2B4D B;  2JEV A;  2B4D A;  2FIW A;  4U5Y A;  1KUV A;  3EFA A;  2Q4Y A;  4QUS A;  3C26 A;  3W91 A;  5J8C A;  1YK3 A;  4H6U A;  5EC4 A;  2WPW A;  4I49 A;  4F6A A;  4X5K A;  3RYO A;  1QST A;  3S6H A;  2QML A;  4JXQ A;  2CY2 A;  2ARH A;  4HNW B;  5JPH A;  2DXQ A;  4M85 A;  2R1I A;  1S7K A;  3MGD A;  4FD4 A;  4R3K A;  2Y0M A;  2VQY A;  2B3V A;  3H4Q A;  2QIR A;  4LUA A;  4NEX A;  4XNH C;  4XPL A;  2PR1 A;  2Q0Y A;  1Y9W A;  4UBR A;  5IX3 A;  3W6X A;  3PZJ A;  4XPD B;  4AG7 A;  4PSW A;  4CRY B;  4AVA A;  2AJ6 A;  4KLW A;  3TO9 A;  4HNX B;  2QEC A;  2REE A;  4F0Y A;  5DWN A;  3GYA A;  4QB9 A;  1KUX A;  1IB1 E;  4RI1 A;  5F48 A;  2FL4 A;  3FNC A;  2VEZ A;  1B87 A;  4PSX A;  2B4B A;  2FSR A;  4NF1 A;  2G3A A;  3DSB A;  1Q2Y A;  3TOA A;  4KOR A;  4B5P B;  4B5P A;  4MI4 A;  3F0A A;  3P2H A;  4FD5 A;  3IWG A;  3TE4 A;  5I0C A;  1BO4 A;  3JUW A;  3R95 A;  2B58 A;  3F8K A;  5KTC A;  5GCN A;  1XMT A;  1CM0 A;  2O28 A;  3SXO A;  2D4O A;  4EVY A;  5F47 A;  2OZH A;  3D8P A;  3R9G A;  3B8G A;  4R3L A;  2CNS A;  4UA3 A;  1YR0 A;  4HKF A;  2Q04 A;  2ZW6 A;  4MJ8 A;  3EY5 A;  3SXN A;  1S60 A;  2BL1 A;  4BMH A;  3I9S A;  3D2M A;  4AG9 A;  2HV2 A;  1M44 A;  2ZW7 A;  1S5K A;  4KLV A;  2P6F A;  3FXT A;  5ISV A;  1RXT A;  4QVT A;  2PC1 A;  2PQ8 A;  4YFJ A;  5FVJ A;  1XEB A;  1MJ9 A;  3FRM A;  4QC6 A;  1QSR A;  1SQH A;  2VZZ A;  1M4G A;  2P6G A;  2F5I A;  4KOU A;  4MY3 A;  1J4J A;  4KUA A;  3CXQ A;  1P4N A;  3BLN A;  4ONU A;  3PGP A;  4KVX A;  5H84 A;  4JWP A;  1IYL A;  4MBU A;  3CXP A;  3TO7 A;  1GHE A;  2HUZ A;  2ZW4 A;  4U9Y A;  4KUB A;  4H6Z A;  4L8A A;  2JDC A;  2OZU A;  4KOT A;  4PV6 A;  1FY7 A;  4JD6 A;  3ZZI A;  2R8V A;  3LOD A;  2Q44 A;  2ZPA A;  5KTD A;  2AE6 A;  1M4I A;  3BJ8 A;  3D3S A;  3R1K A;  4XPK A;  4CAV A;  2H5M A;  3TTH A;  4ORF A;  2OH1 A;  4E8O A;  1WWZ A;  3DNS A;  4CS0 B;  2Q4V A;  3P2F A;  2I00 A;  1CJW A;  4YGO A;  5H86 A;  4JLY A;  5IB0 A;  1N71 A;  3LD2 A;  3TT2 A;  3N7Z A;  4H89 A;  4PK3 A;  4Y49 B;  3G3S A;  4GS4 A;  2R7H A;  2J8M A;  4DNC A;  3KKW A;  3IGR A;  1Z4R A;  1P0H A;  3TFY A;  3OWC A;  3S6K A;  1I12 A;  3V8I A;  3VWD A;  2FE7 A;  2X7B A;  2K5T A;  2BUE A;  5HMN A;  4IUS A;  1IID A;  2VI7 A;  4UWI A;  4KOW A;  1UFH A;  1RO5 A;  1B6B A;  2WPX A;  1WK4 A;  2C27 A;  3ZJ0 A;  4KOX A;  4NXY A;  1MJA A;  1V0C A;  1TIQ A;  3T9Y A;  1IIC A;  4CRZ B;  2VBQ A;  4MY0 A;  5DWM A;  5EBV A;  4E2A A;  3WR7 A;  2JLM A;  2EUI A;  1OZP A;  2B5G B;  1XF8 A;  2B5G A;  4OLL A;  5KTA A;  1R57 A;  1ON0 A;  1Q2D A;  2PSW A;  3D2P A;  3K9U A;  4IF5 A;  3CXS A;  4M3S A;  5JQ4 A;  3FIX A;  2J8R A;  3JVN A;  3R96 A;  4CAX A;  3EXN A;  1Z4E A;  1BOB A;  2OU2 A; 
#chains in the Genus database with same CATH topology
 3S6F A;  2PJC A;  3ISX A;  3H8G A;  2A4N A;  3D68 A;  1S7L A;  2PIZ A;  3DDD A;  2G3T A;  1ELM P;  1S3Z A;  4RUH A;  3IO1 A;  2NMT A;  4R57 A;  2RC4 A;  4II9 A;  2PJ2 A;  3KQZ A;  3V7Z A;  2YNC A;  2Z3L A;  1VIX A;  1YVK A;  3FVL A;  4LX9 A;  4YRH A;  4IK2 A;  4BIN A;  3D7D A;  3TOB A;  5D29 A;  2PJ3 A;  4CGL A;  1IU8 A;  3EC4 A;  4U9Z A;  4PPZ A;  2XEG A;  1PU9 A;  2IQ6 A;  4NGS A;  4RS2 A;  4AB7 A;  4AVC A;  4MRI A;  4AVB A;  4ZX8 A;  1Z2L A;  1Y7R A;  4KZT A;  2NYQ A;  1ZG8 A;  1XOV A;  1S7F A;  3NH5 A;  3PB7 X;  4JZ0 A;  3SI1 A;  5I4M A;  3HLP A;  4C2Y A;  1YVO A;  3SJE A;  1IOF A;  2BSW A;  4NGT A;  1KWM A;  3D4U A;  3DR8 A;  3SJG A;  2FXF A;  5IV0 A;  5F46 A;  3H8E A;  2VZY A;  2ZEO A;  4L89 A;  3FB3 A;  1LAP A;  5EMI A;  4UCP A;  5JGF A;  2CF4 A;  2Z10 A;  4UWJ A;  3B3W A;  4FD6 A;  2IL4 A;  3R9F A;  4QBJ A;  1I1D A;  3NH4 A;  3K2K A;  5E96 A;  4EME A;  4MFP A;  5C88 A;  1TKF A;  1MJB A;  3WAB A;  1Z8X A;  2V8H A;  2P0W A;  2R98 A;  4C7H A;  4LQ6 A;  4OME A;  4OAE A;  2CNM A;  2GE3 A;  1QSM A;  1YQE A;  4IHM A;  4XNH B;  4DJL A;  1PYT B;  4KVO E;  2PJ4 A;  1U6M A;  4OP4 A;  3UY5 A;  3SJF A;  4P44 A;  2I79 A;  4NSQ A;  4OC2 A;  4PQA A;  3R9E A;  3PRT A;  3VWE A;  3K9T A;  4FD7 A;  4OAD A;  4JXR A;  2OB0 A;  5AG5 A;  5HXD A;  1VKC A;  4P6Y A;  1XBU A;  2V8D A;  3QNV A;  4W9Y A;  3I1U A;  4X3R A;  3TCV A;  3B2Y A;  1S7N A;  3PFO A;  3S6G A;  2AFU A;  1UWY A;  4HNY B;  2GAN A;  1IYK A;  3IWE A;  2PJ6 A;  2DEA A;  5LYL A;  3D7G A;  4XPD C;  2FCK A;  3PB4 X;  4Q36 A;  1VHE A;  4R76 A;  1JQG A;  2FS5 A;  2ZEN A;  2ZXV A;  3W6S A;  3T90 A;  1XE4 A;  2KCW A;  4MFZ A;  3SJX A;  2PJ7 A;  2PR8 A;  1MK4 A;  4FAI A;  3GY9 A;  1ZLI A;  2Z3M A;  3KI9 A;  2Z3N A;  4CGO A;  3E0K A;  2PIY A;  4PK2 A;  5CBM A;  4MFQ A;  2RFH A;  2Z3O A;  3SHP A;  2Q51 A;  1Y9K A;  3TO6 A;  4C68 A;  1H8L A;  3B35 A;  2G0B A;  5HH1 A;  4ONW A;  2ZW5 A;  2D4P A;  2QYV A;  2JBK A;  3GKR A;  1KUY A;  2PDO A;  3FMC A;  4Y49 C;  3D7F A;  3QAH A;  2QVP A;  5HVH A;  2EO8 A;  4R87 A;  1CPX A;  3QB8 A;  2XEJ A;  2VL1 A;  1HEE A;  2JDD A;  2Z3K A;  2Z11 A;  2PRB A;  4CAF A;  1NSL A;  1OBR A;  2AFO A;  4CPA A;  1L0C A;  2ZEF A;  1Y0R A;  2Q7B A;  1M4D A;  4CAE A;  3FED A;  4A30 A;  1YRE A;  4Q7A A;  3FBU A;  4ZBG A;  4E0A A;  4MXU A;  4CYQ A;  4K30 A;  2FT0 A;  4F8Z A;  2PJB A;  3DR6 A;  2IMO A;  4B14 A;  1K4J A;  2CNT A;  4NGM A;  5J8F A;  5C82 A;  1F2O A;  2VXK A;  2O4H A;  1YX0 A;  2Q43 A;  3PP9 A;  2ATR A;  2F8H A;  1NE9 A;  2PJ8 A;  2FIA A;  1LRZ A;  2EVN A;  5CNP A;  5DS0 A;  3V38 A;  3G8W A;  1TKJ A;  4EFD A;  2REF A;  4UFV A;  1YLE A;  1I21 A;  1LCP A;  1QSO A;  3GIU A;  3FEE A;  1YGH A;  4CAW A;  4KOV A;  2BEI A;  3IU2 A;  2ZOG A;  1BPM A;  4OID A;  4MCR A;  3IFE A;  4A38 A;  3F5B A;  3BI1 A;  2PJ0 A;  4J3G A;  3FYN A;  3TX8 A;  1Z9U A;  2C6C A;  4A95 A;  3I3G A;  1CP6 A;  2ZOF A;  4P10 A;  1KZF A;  1M1D A;  4MHN A;  1NSA A;  4UCM A;  4UF4 A;  1NMT A;  1ZO0 A;  4R9M A;  1QMU A;  4WJB A;  1PUA A;  3IU1 A;  4MHD A;  2GIV A;  4DUK A;  4FBE A;  2P6E A;  1Q2C A;  2C1C A;  2J8N A;  3NE7 A;  2GU2 A;  6CPA A;  3EO4 A;  4MCP A;  1QSN A;  3KL9 A;  4NCZ A;  2OZG A;  1XIX A;  2AFZ A;  2AFX A;  2ZEH A;  2B3U A;  2HQY A;  4C2Z A;  3LWU A;  4KVM E;  4JJX A;  3BI0 A;  2Z0Z A;  5F49 A;  4KOS A;  1XRY A;  1IY7 A;  4NFR A;  5G21 A;  4B5O A;  3B3V A;  3BJ7 A;  1VHO A;  4KOY A;  2AFW A;  2PRQ A;  2WUU A;  1VHS A;  2Q4Z A;  2AFS A;  2B4D B;  2JEV A;  2B4D A;  2Z3P A;  4MFJ A;  5THW A;  4C2X A;  5LRK A;  2FIW A;  4U5Y A;  4K3N A;  8CPA A;  1KUV A;  2PCU A;  3EFA A;  1BPN A;  2YNC C;  2Q4Y A;  4QUS A;  3A9L A;  3NH8 A;  4Q38 A;  3SI2 A;  4IAV A;  3C26 A;  1XMB A;  4X2T A;  3S9L A;  2IJZ A;  2ZEL A;  3IJ3 A;  5AGE A;  5K8P A;  1DTD A;  1ZG9 A;  3W91 A;  1YW6 A;  5J8C A;  1YK3 A;  4H6U A;  5EC4 A;  2WPW A;  3RBU A;  4UFX A;  4I49 A;  4F6A A;  4JYW A;  2CTB A;  2FVG A;  2BO9 A;  4MHP A;  1TF9 A;  4FWU A;  1CPS A;  4X5K A;  3RYO A;  1QST A;  4KSI A;  4G1P A;  5G22 A;  3S6H A;  3KHZ A;  2QML A;  4OIW A;  4CGN A;  4JXQ A;  2JEW A;  3NFZ A;  3B3C A;  5LRG A;  1FT7 A;  4OC3 A;  3FJU A;  5JH9 A;  2CY2 A;  4WWV A;  2C6P A;  2ARH A;  4HNW B;  5JPH A;  2DXQ A;  3GUX A;  4M85 A;  1HDU A;  2R1I A;  1TF8 A;  2PVV A;  3JRU A;  1S7K A;  1TXR A;  3MGD A;  3D7H A;  3WC5 A;  4FD4 A;  4R3K A;  2Y0M A;  2VQY A;  2B3V A;  3H4Q A;  2QIR A;  4LUA A;  4NEX A;  4XNH C;  1XJO A;  4XPL A;  2PR1 A;  3WT4 A;  4P4E A;  3PB9 X;  4X8I A;  3SI0 A;  3TC8 A;  2Q0Y A;  2EK9 A;  1Y9W A;  4UBR A;  5IX3 A;  4LQG A;  2GLF A;  3W6X A;  3PZJ A;  4F0X A;  4OC1 A;  2ANP A;  4XPD B;  4M6G A;  2ODF A;  2WSA A;  4AG7 A;  4PSW A;  1YSJ A;  3L2N A;  3QAY A;  3N5F A;  4CRY B;  4AVA A;  2QJ8 A;  2AJ6 A;  2BOA A;  2GFQ A;  4KLW A;  3TO9 A;  4M6I A;  4B13 A;  4HNX B;  2QEC A;  2REE A;  3BXM A;  4CYN A;  5DWN A;  4F0Y A;  3GYA A;  4QB9 A;  2DPS A;  2XEI A;  4MMO A;  5AG4 A;  4P4B A;  3VAR A;  1IOI A;  1IB1 E;  1KUX A;  1LOK A;  2FL4 A;  1X12 A;  4RI1 A;  4TNU A;  1IGB A;  5F48 A;  3FNC A;  3RAM A;  2VEZ A;  5K8O A;  3MN8 A;  1B87 A;  4PSX A;  5LRJ A;  4CYP A;  2PJ1 A;  2B4B A;  2CIJ A;  4BD9 A;  4ZY1 A;  2FSR A;  4NF1 A;  2G3A A;  3DSB A;  1Q2Y A;  4BBH A;  2OR4 A;  1ZG7 A;  2F7V A;  4KOR A;  3TOA A;  3PBE A;  4B12 A;  3CPX A;  4B5P B;  3CZX A;  4MI4 A;  4B5P A;  1JWQ A;  1BLL E;  4M6H A;  2PJ5 A;  2PVW A;  3F0A A;  3P2H A;  4FD5 A;  3IEH A;  3IWG A;  3PB6 X;  4A94 A;  3DLJ A;  4PXE A;  3TE4 A;  5AG7 A;  5I0C A;  1BO4 A;  1GYT A;  4A2Z A;  1R3N A;  3JUW A;  1YW4 A;  3R95 A;  4DYO A;  2B58 A;  4OC5 A;  5K8M A;  3F8K A;  5KTC A;  5GCN A;  1XMT A;  4MHZ A;  1CM0 A;  4NJQ A;  2O28 A;  4KS9 A;  3SXO A;  3B3T A;  4F9U A;  2D4O A;  4UFW A;  4P4F A;  4EVY A;  3S9N A;  4UIA A;  5F47 A;  2OZH A;  2ZEM A;  3D8P A;  4PXB A;  3R9G A;  5A28 A;  2ZEE A;  4UEZ A;  3B8G A;  2V77 A;  4R3L A;  1AMP A;  4F9V A;  2CNS A;  3T8W A;  4UA3 A;  1YR0 A;  4HKF A;  2Q04 A;  2ZW6 A;  5G20 A;  3BHX A;  2ZEP A;  2C6G A;  3KQX A;  4MJ8 A;  4R7M A;  3EY5 A;  3SXN A;  1S60 A;  2BL1 A;  3LMS A;  1ZLH A;  1Z5R A;  4MFL A;  4BMH A;  2HC9 A;  4R8F A;  3I9S A;  3D2M A;  4AG9 A;  4B10 A;  1Y7E A;  1ARM A;  1PCA A;  2HV2 A;  2XEF A;  5JM6 A;  1M44 A;  2ZW7 A;  1S5K A;  3FH4 A;  4HPS A;  1XFO A;  2P6F A;  3FXT A;  4KLV A;  4OC4 A;  5ISV A;  1RXT A;  4QVT A;  4KSF A;  2PC1 A;  2PQ8 A;  4YFJ A;  5FVJ A;  1AUG A;  5ELY A;  4A31 A;  2RB7 A;  1XEB A;  3IC1 A;  1Z8T A;  4P4I A;  1MJ9 A;  3D67 A;  3FRM A;  4O23 A;  3PEI A;  4QC6 A;  1QSR A;  1SQH A;  1CX8 A;  4A32 A;  3PFE A;  2VZZ A;  4FUU A;  2DF5 A;  1M4G A;  2P6G A;  2F5I A;  4KOU A;  2WYR A;  2POK A;  4MY3 A;  4NJR A;  1J4J A;  3MRU A;  3CXQ A;  4KUA A;  4ZY0 A;  1P4N A;  4B11 A;  3KZW A;  3BLN A;  4ONU A;  4UEF A;  3PGP A;  4P45 A;  4KVX A;  3B3S A;  3PB8 X;  3RNZ A;  5H84 A;  4JWP A;  1IYL A;  4EWT A;  3CDX A;  5D8N A;  4MBU A;  4A37 A;  3CXP A;  4UEE A;  2J9A A;  1BAV A;  4A39 A;  3TO7 A;  1GHE A;  2YGW A;  2HUZ A;  3B7I A;  2ZW4 A;  1M4L A;  3KAS A;  4P4D A;  4KUB A;  4U9Y A;  4H6Z A;  2YND A;  4L8A A;  2GLJ A;  2DPT A;  4AXV A;  2JDC A;  2OZU A;  3NE8 A;  4KOT A;  4MCQ A;  5HVG A;  4PV6 A;  1FY7 A;  4KSA A;  1R43 A;  4RN7 A;  4ZI6 A;  1Y0Y A;  2V8G A;  4JD6 A;  3ZZI A;  2R8V A;  1A2Z A;  3LOD A;  2Q44 A;  2ZPA A;  3LAC A;  5KTD A;  4OKO A;  2AE6 A;  1M4I A;  3BJ8 A;  3D3S A;  3R1K A;  4XPK A;  4CGM A;  4CAV A;  4OC0 A;  5IB9 A;  5HVF A;  2H5M A;  3TTH A;  4A33 A;  4ORF A;  4NGN A;  2ABZ A;  1HDQ A;  1LFW A;  2OH1 A;  2NSM A;  4E8O A;  1ELL P;  1WWZ A;  3DNS A;  5K8N A;  2G9D A;  4CS0 B;  5BWA B;  2Q4V A;  3P2F A;  5AG6 A;  4ZGY B;  3WC7 A;  3GB0 A;  2I00 A;  4CGP A;  4H2K A;  1CJW A;  4YGO A;  1AYE A;  4JLY A;  5H86 A;  1LAM A;  4YU9 A;  5IB0 A;  1N71 A;  1ARL A;  3LD2 A;  3TT2 A;  3N7Z A;  1TKH A;  4PXC A;  1DE4 C;  2I3C A;  4H89 A;  4PK3 A;  4MFK A;  3G3S A;  4GS4 A;  2R7H A;  4Y49 B;  3S9M A;  4C7I A;  4CYO A;  1Z8L A;  2YNE A;  2J8M A;  4DNC A;  3KKW A;  3IGR A;  1Z4R A;  1P0H A;  3H8F A;  2BCO A;  1YLO A;  2ZEG A;  4NGP A;  2Q7S A;  3TFY A;  3OWC A;  1YME A;  3S6K A;  1I12 A;  3CPA A;  1F2P A;  1X10 A;  3WC6 A;  4NGR A;  3V8I A;  3VWD A;  1CBX A;  4UCN A;  1RTQ A;  2O53 A;  2FE7 A;  2X7B A;  4MCS A;  5CPA A;  3RZA A;  2K5T A;  3VAT A;  2ZED A;  5F09 A;  2BUE A;  5HMN A;  7CPA A;  4IUS A;  1IID A;  3FF3 A;  2VI7 A;  4UWI A;  1EE3 P;  1UFH A;  2WZN A;  1CG2 A;  3DGV A;  4GM5 A;  4KOW A;  3VH9 A;  5LYF A;  1RO5 A;  1B6B A;  1CP7 A;  1LAN A;  2WPX A;  1VGY A;  1WK4 A;  2C27 A;  2EK8 A;  3ZJ0 A;  1Z8W A;  3PBB A;  3RO0 A;  3KGQ A;  2V8V A;  4KOX A;  3IIB A;  3NA6 A;  4NXY A;  4B6Z A;  2EWB A;  5LYD A;  2GRE A;  4ZYQ A;  1MJA A;  1F57 A;  1TIQ A;  1V0C A;  1QQ9 A;  1IIC A;  2CTC A;  2PJ9 A;  4R6T A;  4ZX9 A;  3T9Y A;  4MHY A;  4CRZ B;  2VBQ A;  4MY0 A;  5DWM A;  5EBV A;  4E2A A;  3WR7 A;  2JBJ A;  2JLM A;  5G1Z A;  2EUI A;  1OZP A;  1Q7L A;  4TWE A;  4UIB A;  5LYI A;  4PXD A;  3H5Z A;  2CXA A;  2B5G B;  1XF8 A;  2B5G A;  3HUV A;  5A27 A;  4OLL A;  5KTA A;  2HB6 A;  1R57 A;  3FEC A;  2OOT A;  4Z65 A;  1ON0 A;  3JTK A;  4YWY A;  1Q2D A;  2PSW A;  3D2P A;  3IWW A;  3GLJ A;  3CXS A;  3K9U A;  3D66 A;  3KHX A;  4IF5 A;  4M3S A;  5JQ4 A;  3FIX A;  2J8R A;  3KR5 A;  1FNO A;  3FX6 A;  4ZY2 A;  2PJA A;  2AFM A;  3JVN A;  3CT9 A;  2EBJ A;  3KR4 A;  4P4J A;  5J1Q A;  3R96 A;  3ISZ A;  2PE3 A;  4GXH A;  4CAX A;  3EXN A;  4NGQ A;  1Z4E A;  1BOB A;  2OU2 A; 
#chains in the Genus database with same CATH homology
 3S6F A;  2A4N A;  1S7L A;  3DDD A;  2G3T A;  1S3Z A;  2NMT A;  4R57 A;  2RC4 A;  4II9 A;  2YNC A;  2Z3L A;  4YRH A;  1YVK A;  4LX9 A;  3TOB A;  4CGL A;  3EC4 A;  4U9Z A;  1PU9 A;  4RS2 A;  4AB7 A;  4AVC A;  4AVB A;  1Y7R A;  4KZT A;  1S7F A;  4C2Y A;  1YVO A;  2BSW A;  3DR8 A;  2FXF A;  5IV0 A;  5F46 A;  2VZY A;  4L89 A;  3FB3 A;  4UCP A;  2Z10 A;  4UWJ A;  4FD6 A;  2IL4 A;  3R9F A;  4QBJ A;  1I1D A;  5E96 A;  4MFP A;  5C88 A;  1MJB A;  2P0W A;  2R98 A;  4C7H A;  4OAE A;  2CNM A;  2GE3 A;  1QSM A;  4XNH B;  4KVO E;  1U6M A;  3UY5 A;  2I79 A;  4NSQ A;  3R9E A;  3VWE A;  4FD7 A;  4OAD A;  5AG5 A;  4JXR A;  2OB0 A;  1VKC A;  3TCV A;  1S7N A;  3S6G A;  4HNY B;  2GAN A;  1IYK A;  3IWE A;  4XPD C;  2FCK A;  4Q36 A;  2FS5 A;  2ZXV A;  3W6S A;  3T90 A;  1XE4 A;  2KCW A;  4MFZ A;  2PR8 A;  1MK4 A;  3GY9 A;  2Z3M A;  4CGO A;  2Z3N A;  3E0K A;  4PK2 A;  4MFQ A;  2Z3O A;  3SHP A;  1Y9K A;  3TO6 A;  4C68 A;  2G0B A;  5HH1 A;  2ZW5 A;  2D4P A;  3GKR A;  1KUY A;  2PDO A;  4Y49 C;  3QAH A;  4R87 A;  3QB8 A;  2JDD A;  2Z3K A;  2Z11 A;  2PRB A;  4CAF A;  1NSL A;  1L0C A;  2Q7B A;  1M4D A;  4CAE A;  4A30 A;  1YRE A;  3FBU A;  4ZBG A;  4E0A A;  4CYQ A;  4K30 A;  2FT0 A;  3DR6 A;  4B14 A;  1K4J A;  2CNT A;  5J8F A;  5C82 A;  2VXK A;  1YX0 A;  3PP9 A;  2ATR A;  5CNP A;  1NE9 A;  2FIA A;  1LRZ A;  2EVN A;  3G8W A;  2REF A;  4UFV A;  1YLE A;  1I21 A;  1QSO A;  1YGH A;  4CAW A;  4KOV A;  2BEI A;  3IU2 A;  3F5B A;  4J3G A;  3FYN A;  1Z9U A;  4A95 A;  3I3G A;  1KZF A;  1M1D A;  4UCM A;  1NMT A;  1ZO0 A;  4R9M A;  1PUA A;  3IU1 A;  4MHD A;  2GIV A;  2P6E A;  1Q2C A;  2J8N A;  3NE7 A;  3EO4 A;  1QSN A;  4NCZ A;  2OZG A;  1XIX A;  2B3U A;  2HQY A;  4C2Z A;  4KVM E;  4JJX A;  2Z0Z A;  5F49 A;  4KOS A;  4B5O A;  5G21 A;  3BJ7 A;  4KOY A;  2WUU A;  1VHS A;  2B4D B;  2JEV A;  2B4D A;  2Z3P A;  4MFJ A;  4C2X A;  2FIW A;  4U5Y A;  1KUV A;  3EFA A;  2YNC C;  2Q4Y A;  4QUS A;  3A9L A;  4Q38 A;  3C26 A;  5AGE A;  3W91 A;  5J8C A;  1YK3 A;  4H6U A;  5EC4 A;  2WPW A;  4UFX A;  4I49 A;  4F6A A;  4X5K A;  3RYO A;  1QST A;  5G22 A;  3S6H A;  4CGN A;  2QML A;  4JXQ A;  2CY2 A;  2ARH A;  4HNW B;  5JPH A;  2DXQ A;  4M85 A;  2R1I A;  1S7K A;  3MGD A;  4FD4 A;  4R3K A;  2Y0M A;  2VQY A;  2B3V A;  3H4Q A;  2QIR A;  4LUA A;  4NEX A;  4XNH C;  4XPL A;  2PR1 A;  2Q0Y A;  1Y9W A;  4UBR A;  5IX3 A;  3W6X A;  3PZJ A;  4F0X A;  4XPD B;  2WSA A;  4AG7 A;  4PSW A;  4CRY B;  4AVA A;  2AJ6 A;  4KLW A;  3TO9 A;  4HNX B;  2QEC A;  2REE A;  4CYN A;  5DWN A;  4F0Y A;  3GYA A;  4QB9 A;  2DPS A;  5AG4 A;  1KUX A;  1IB1 E;  4RI1 A;  5F48 A;  2FL4 A;  3FNC A;  2VEZ A;  1B87 A;  4PSX A;  4CYP A;  2B4B A;  2FSR A;  4NF1 A;  2G3A A;  3DSB A;  1Q2Y A;  4BBH A;  4B12 A;  3TOA A;  4KOR A;  4B5P B;  4B5P A;  4MI4 A;  3F0A A;  3P2H A;  4FD5 A;  3IWG A;  3TE4 A;  5AG7 A;  5I0C A;  1BO4 A;  4A2Z A;  3JUW A;  3R95 A;  2B58 A;  3F8K A;  5KTC A;  5GCN A;  1XMT A;  1CM0 A;  2O28 A;  4KS9 A;  3SXO A;  2D4O A;  4UFW A;  4EVY A;  5F47 A;  2OZH A;  3D8P A;  3R9G A;  5A28 A;  3B8G A;  4R3L A;  2CNS A;  4UA3 A;  1YR0 A;  4HKF A;  2Q04 A;  2ZW6 A;  5G20 A;  4MJ8 A;  3EY5 A;  3SXN A;  1S60 A;  2BL1 A;  4MFL A;  4BMH A;  3I9S A;  3D2M A;  4AG9 A;  4B10 A;  2HV2 A;  1M44 A;  2ZW7 A;  1S5K A;  4KLV A;  2P6F A;  3FXT A;  5ISV A;  1RXT A;  4QVT A;  4KSF A;  2PC1 A;  2PQ8 A;  4YFJ A;  5FVJ A;  4A31 A;  1XEB A;  1MJ9 A;  3FRM A;  4QC6 A;  1QSR A;  1SQH A;  4A32 A;  2VZZ A;  1M4G A;  2P6G A;  2F5I A;  4KOU A;  4MY3 A;  1J4J A;  4KUA A;  3CXQ A;  1P4N A;  4B11 A;  3BLN A;  4ONU A;  3PGP A;  4KVX A;  5H84 A;  4JWP A;  1IYL A;  4MBU A;  3CXP A;  3TO7 A;  1GHE A;  2YGW A;  2HUZ A;  2ZW4 A;  4U9Y A;  4KUB A;  4H6Z A;  2YND A;  4L8A A;  2DPT A;  2JDC A;  2OZU A;  4KOT A;  4PV6 A;  1FY7 A;  4KSA A;  4JD6 A;  3ZZI A;  2R8V A;  3LOD A;  2Q44 A;  2ZPA A;  5KTD A;  2AE6 A;  1M4I A;  3BJ8 A;  3D3S A;  3R1K A;  4XPK A;  4CGM A;  4CAV A;  2H5M A;  3TTH A;  4A33 A;  4ORF A;  2OH1 A;  4E8O A;  1WWZ A;  3DNS A;  4CS0 B;  5BWA B;  2Q4V A;  3P2F A;  5AG6 A;  4ZGY B;  2I00 A;  4CGP A;  1CJW A;  4YGO A;  5H86 A;  4JLY A;  5IB0 A;  1N71 A;  3LD2 A;  3TT2 A;  3N7Z A;  4H89 A;  4PK3 A;  4MFK A;  3G3S A;  4GS4 A;  2R7H A;  4Y49 B;  4CYO A;  4C7I A;  2YNE A;  2J8M A;  4DNC A;  3KKW A;  3IGR A;  1Z4R A;  1P0H A;  3TFY A;  3OWC A;  3S6K A;  1I12 A;  3V8I A;  3VWD A;  4UCN A;  2FE7 A;  2X7B A;  2K5T A;  2BUE A;  5HMN A;  4IUS A;  1IID A;  2VI7 A;  4UWI A;  4KOW A;  1UFH A;  1RO5 A;  1B6B A;  2WPX A;  1WK4 A;  2C27 A;  3ZJ0 A;  4KOX A;  4NXY A;  1MJA A;  1V0C A;  1TIQ A;  3T9Y A;  4B13 A;  1IIC A;  4CRZ B;  2VBQ A;  4MY0 A;  5DWM A;  5EBV A;  4E2A A;  3WR7 A;  2JLM A;  5G1Z A;  2EUI A;  1OZP A;  3H5Z A;  2CXA A;  2B5G B;  1XF8 A;  2B5G A;  5A27 A;  4OLL A;  5KTA A;  1R57 A;  1ON0 A;  3JTK A;  1Q2D A;  2PSW A;  3D2P A;  3K9U A;  4IF5 A;  3CXS A;  4M3S A;  5JQ4 A;  3FIX A;  2J8R A;  3JVN A;  3R96 A;  4CAX A;  3EXN A;  1Z4E A;  1BOB A;  2OU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...