2REFA

Crystal structure of the loading gnatl domain of cura from lyngbya majuscula soaked with malonyl-coa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
203
structure length
203
Chain Sequence
CFENNYYNLRHPKIEDLRDLIALETLCWSENLQVDNEEIYRRIFKIPQGQFILELEDKIVGAIYSQRIDNPQLLDNKTCTQVPLLHTESGVVVQLLAVNILPELQNQGLGDRLLEFMLQYCAQISGVEKVVAVTLCRNYPDYSPMPMAEYIHQKNESGLLVDPLLRFHQIHGAKIEKLLPGYRPKDWENQTCGVLVSYDIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CurA
publication title GNAT-like strategy for polyketide chain initiation.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase, lyase
total genus 56
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.3.1.38: [Acyl-carrier-protein] S-acetyltransferase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2refA01
3FNCA 3GYAA 2B58A 1S60A 3DR6A 4FD7A 4NEXA 2B4DA 2Z0ZA 1KUXA 2ZW4A 3WR7A 1CJWA 2ZW5A 3R9EA 3FXTA 2FE7A 2Y0MA 4U9ZA 2FL4A 2ATRA 4AVAA 1Y7RA 1QSRA 1Z4RA 5DWNA 1L0CA 3MGDA 3QB8A 4R87A 5GCNA 4XPDC 4E0AA 1S7KA 2EUIA 2Q0YA 4L89A 2OZHA 2IL4A 2CNTA 3FBUA 3E0KA 2R1IA 1S7LA 4KVOE 4PK3A 2P6EA 4QBJA 1MK4A 2DXQA 1P4NA 3LD2A 3LODA 3S6KA 3SXOA 2B5GB 4KOWA 1BOBA 2G0BA 5HMNA 1CM0A 4PK2A 2VZYA 1V0CA 3D2PA 5HH1A 2WPWA 2PC1A 4CAWA 1Q2CA 4R3LA 3RYOA 2PDOA 4QVTA 4XNHB 4AB7A 1WK4A 4MY0A 3V8IA 3KKWA 3TO6A 1P0HA 3EFAA 4JLYA 2AE6A 1NE9A 3S6GA 4KLVA 1XE4A 5IB0A 2BEIA 1TIQA 2BL1A 2ZPAA 3EXNA 3G8WA 1NMTA 3FYNA 4MI4A 2VEZA 2RC4A 3TCVA 5H84A 1QSTA 4YFJA 3P2HA 4X5KA 1Z9UA 4KUBA 1MJ9A 3BJ8A 1WWZA 4HKFA 2FT0A 3W6SA 5CNPA 4ONUA 2K5TA 2OH1A 2B3VA 4LX9A 1I21A 2D4OA 2J8NA 2CNMA 3TT2A 3D3SA 2X7BA 1VHSA 2FS5A 4KLWA 3DR8A 2VXKA 4H6ZA 3C26A 2REFA 4PSWA 5JQ4A 5E96A 1M1DA 1PU9A 2OZUA 4HNWB 4NF1A 2R7HA 1YREA 2FIAA 5F48A 3DSBA 2HUZA 4XPKA 1QSNA 4XPLA 1Y9KA 2Q4VA 4JD6A 4U9YA 4R9MA 1LRZA 2ZW6A 2GANA 1IIDA 3TE4A 2PRBA 4UWIA 3R95A 4CRZB 2R8VA 5IV0A 3I3GA 4L8AA 2Q04A 3T9YA 3ZJ0A 4JXRA 4XPDB 1MJBA 5ISVA 1IICA 2BUEA 5C88A 2QIRA 2PSWA 5I0CA 2P6GA 1YX0A 2C27A 2ZXVA 1SQHA 1B6BA 5H86A 1ON0A 1K4JA 1VKCA 1R57A 1YR0A 3CXQA 5F46A 3R1KA 2PQ8A 4AVBA 2PR8A 2ZW7A 2O28A 4DNCA 2GE3A 4CAXA 4OAEA 4MBUA 3R96A 3N7ZA 3D2MA 1M4DA 3TTHA 3S6HA 4B5PA 4KOXA 3CXSA 4II9A 1FY7A 1XMTA 2B3UA 2Q44A 1NSLA 4FD5A 3GKRA 3BLNA 3FRMA 1YVKA 3TO7A 3EC4A 5KTAA 3PZJA 4R57A 4JWPA 4KOSA 1M44A 3VWDA 4MY3A 4E2AA 4KOTA 1IB1E 3TO9A 3ZZIA 3R9GA 5DWMA 3P2FA 2I79A 2QECA 1RXTA 3W91A 4M85A 4FD6A 2I00A 4F0YA 4CAVA 3PP9A 4KOUA 4YGOA 3I9SA 1XEBA 4QC6A 4MJ8A 4J3GA 3NE7A 3JVNA 4IF5A 4B5OA 2P0WA 4PSXA 2F5IA 5KTCA 1YGHA 4QB9A 3TOBA 3S6FA 2JDCA 4NSQA 4U5YA 2OB0A 1Z4EA 4BMHA 5FVJA 1QSMA 3VWEA 1IYKA 4R3KA 1I1DA 3SHPA 3PGPA 3F8KA 2G3TA 1KZFA 3FIXA 5J8FA 4B5PB 5F47A 2NMTA 4F6AA 4KORA 1Y9WA 4AVCA 1N71A 3EO4A 4HNYB 1XF8A 4I49A 4KVME 2VI7A 4K30A 1U6MA 5KTDA 4E8OA 4KUAA 4RI1A 4RS2A 4OLLA 1IYLA 3IGRA 4CS0B 3TFYA 2ARHA 4CRYB 1Q2DA 3T90A 3G3SA 3FB3A 2B4BA 2JEVA 3QAHA 2A4NA 1M4IA 4LUAA 1S7NA 5F49A 1KUVA 2QMLA 2D4PA 4IUSA 1M4GA 2OU2A 1J4JA 1YK3A 4QUSA 4NXYA 4EVYA 1YLEA 2HV2A 3GY9A 4AG7A 2BSWA 1OZPA 2H5MA 2JLMA 1Q2YA 4Y49B 2REEA 3F0AA 2HQYA 5C82A 4M3SA 4KOVA 2FXFA 3UY5A 3CXPA 3DDDA 3K9UA 3EY5A 1I12A 4FD4A 4HNXB 2EVNA 4ORFA 4Y49C 2Z10A 4NCZA 4H89A 1MJAA 4UBRA 3D8PA 3JUWA 2OZGA 3TOAA 2VQYA 2WPXA 1S3ZA 1B87A 4ZBGA 1PUAA 4UA3A 4JXQA 2R98A 2PR1A 2FCKA 2J8MA 3DNSA 3B8GA 1YVOA 1QSOA 4XNHC 3OWCA 3W6XA 3BJ7A 3H4QA 3SXNA 3IWGA 2AJ6A 2VZZA 1S5KA 2GIVA 4UWJA 4H6UA 2B4DB 2J8RA 5EC4A 4MHDA 1GHEA 2G3AA 2KCWA 2Q4YA 4KZTA 2CY2A 2VBQA 4PV6A 1BO4A 2CNSA 2FSRA 5JPHA 2B5GA 1RO5A 4GS4A 2Q7BA 4KOYA 4OADA 4AG9A 1XIXA 5IX3A 2FIWA 2P6FA 2JDDA 5J8CA 3R9FA 1UFHA 4KVXA 5EBVA 3F5BA 1KUYA 4YRHA 2Z11A 4JJXA 1S7FA
chains in the Genus database with same CATH superfamily
3IWEA 3N5FA 4MFJA 1PCAA 3FNCA 1DTDA 3GYAA 4ZY1A 1BPNA 2B58A 2GREA 4OP4A 4C2ZA 4CYQA 1S60A 3DR6A 3KR5A 4OC0A 4WJBA 4FD7A 3LMSA 4NEXA 1X12A 3FMCA 4O23A 2B4DA 2Z0ZA 4R6TA 4UF4A 1KUXA 2ZW4A 3WR7A 2PVWA 1EE3P 3SJGA 3SJXA 5D8NA 1CJWA 4A94A 2ANPA 2PJ1A 2ZW5A 4MFLA 3ISZA 2GU2A 3R9EA 3FXTA 2PE3A 2FE7A 4NFRA 5LYFA 1TF9A 3FEEA 3VARA 2Y0MA 3CDXA 2FL4A 4U9ZA 4K3NA 2ATRA 2ZEHA 4AVAA 2ZEDA 4X8IA 2OR4A 4YU9A 3CPAA 2ODFA 1Y7RA 4NJQA 2GLFA 4M6IA 5IX3A 1QSRA 4EFDA 1Z4RA 2DF5A 5LRGA 5DWNA 4F8ZA 1L0CA 3JTKA 1Z2LA 3MGDA 3QB8A 4R87A 5GCNA 4MFZA 4MCSA 4XPDC 4E0AA 1S7KA 2EUIA 1AUGA 1YLOA 2Q0YA 2Z3KA 4L89A 3D68A 2OZHA 4RUHA 2IL4A 2PRQA 4ZYQA 4M6HA 2CNTA 2Q4ZA 3PB4X 3V7ZA 3FBUA 3E0KA 2R1IA 1S7LA 4KVOE 4PK3A 5K8NA 1YMEA 2P6EA 5BWAB 4A37A 4C68A 4RN7A 4WWVA 5LRKA 4QBJA 1MK4A 4A33A 2DXQA 1P4NA 2ZEFA 3LD2A 5AG6A 3LODA 3S6KA 2Q43A 4A2ZA 3IU2A 2B5GB 3SXOA 1Y7EA 4KOWA 1BOBA 2EK9A 2G0BA 5HMNA 4MHNA 1CM0A 4PK2A 2VZYA 4A39A 1V0CA 1KWMA 3PRTA 5AG7A 2ZEEA 3D2PA 5HH1A 2WPWA 2PC1A 4C7HA 4CAWA 3QAYA 3GUXA 1Q2CA 4P10A 4R3LA 3RYOA 1Z5RA 2PDOA 4JZ0A 5THWA 4QVTA 4XNHB 4AB7A 1WK4A 4MY0A 2AFWA 4TNUA 3V8IA 3KKWA 4FUUA 2F8HA 1P0HA 3TO6A 3D7FA 4B12A 1Z8WA 3EFAA 4JLYA 2AE6A 1LFWA 2JBKA 1NE9A 1R3NA 3S6GA 2YNCC 4KLVA 2V8VA 1XE4A 1YQEA 3H8GA 1LANA 1IOFA 2BEIA 3HUVA 1TIQA 2BL1A 2ZPAA 1R43A 5IB0A 3EXNA 1IU8A 3D66A 4IHMA 3KZWA 3G8WA 1NMTA 3FYNA 4MI4A 3KGQA 1VHOA 2C6PA 2PJ3A 2VEZA 4GXHA 2RC4A 1YSJA 4B13A 2PIZA 4PXEA 3TCVA 5H84A 4NGTA 4R8FA 1QSTA 4YFJA 3P2HA 1QQ9A 4X5KA 7CPAA 1Z9UA 3DGVA 4KUBA 3GB0A 5AGEA 1MJ9A 1XOVA 2CF4A 2PJ6A 3BJ8A 3D4UA 1WWZA 4H2KA 4A95A 4HKFA 2EWBA 2FT0A 3RO0A 2IJZA 3W6SA 1LCPA 5CNPA 4ONUA 5D29A 3DLJA 2K5TA 2OH1A 1CG2A 4KSAA 2B3VA 4LX9A 2V8HA 1ZG9A 1I21A 2D4OA 2J8NA 3PFOA 2CNMA 3TT2A 3D3SA 3TX8A 3JRUA 2X7BA 2BO9A 5AG5A 3RNZA 1VHSA 4OC2A 4UEFA 2FS5A 2YNCA 3DR8A 2VXKA 4H6ZA 4KLWA 3C26A 3IJ3A 4P45A 4UEZA 5HVFA 2REFA 1Z8TA 4PSWA 5J1QA 5JQ4A 3KQXA 5E96A 2V8DA 1A2ZA 1M1DA 1PU9A 2OZUA 2Z3PA 4HNWB 4NF1A 4LQ6A 2R7HA 4OC3A 1CP6A 2YNDA 1YREA 2FIAA 5F48A 3DSBA 4KSIA 5K8MA 4G1PA 2HUZA 4XPKA 1QSNA 4XPLA 4R7MA 3D7GA 3IIBA 1Y9KA 2Q4VA 4IK2A 1ARLA 4JD6A 3KHZA 4U9YA 4R9MA 2IMOA 1LRZA 2ZW6A 2GANA 3I1UA 1IIDA 3TE4A 2PRBA 1LAPA 1TKHA 4UWIA 5CPAA 3R95A 4CRZB 2R8VA 2XEJA 5IV0A 3D7DA 3K9TA 3PBEA 1LAMA 3I3GA 4L8AA 4EWTA 2Q04A 5JH9A 2GLJA 2V8GA 3B3CA 4P4JA 3T9YA 4LQGA 2IQ6A 3ZJ0A 4JXRA 4JYWA 2PJ5A 5IB9A 3D7HA 2JBJA 4Q38A 4XPDB 3RBUA 3ISXA 3SI2A 3SJFA 2VL1A 1MJBA 5ISVA 1IICA 2BUEA 4CGMA 1CBXA 5C88A 2QIRA 2PSWA 3LACA 5I0CA 2P6GA 1YX0A 2C27A 2ZXVA 8CPAA 2YGWA 3BXMA 1SQHA 1B6BA 1Y0RA 2Z3NA 1ON0A 5H86A 1CPSA 2ZOGA 4CGNA 4PQAA 1K4JA 2PJ0A 1VKCA 1TKJA 2G9DA 2HB6A 4CYPA 4CGPA 1FT7A 5HXDA 5I4MA 1R57A 1YR0A 1LOKA 4MHYA 5JGFA 4ZX9A 4MHZA 3CXQA 4P4DA 5F46A 2BOAA 2WYRA 5CBMA 3R1KA 4F9VA 1Z8XA 2RB7A 1GYTA 2PQ8A 2PJBA 4ZI6A 1XFOA 1XMBA 2PJ8A 4NGNA 4AVBA 1M4LA 2PR8A 3PB7X 2ZW7A 5G20A 3TC8A 3VATA 3S9NA 2O28A 4CYNA 4MFPA 4PXBA 4DNCA 2GE3A 4ZGYB 4CAXA 4OAEA 4MBUA 3IEHA 1ZO0A 3R96A 4FWUA 3N7ZA 3D2MA 1M4DA 3BI1A 4NGRA 3TTHA 3S6HA 4B5PA 4KOXA 3CXSA 4II9A 1FY7A 1XMTA 2POKA 2YNEA 2ZEGA 4UCPA 3NFZA 2B3UA 1VHEA 2Q44A 4HPSA 1NSLA 1ZLHA 3FF3A 4P4IA 4FD5A 3BLNA 3GKRA 3FRMA 4CAEA 1YVKA 4MXUA 3PBBA 3TO7A 4ZY0A 3EC4A 2DEAA 1TXRA 5KTAA 1XBUA 1HDUA 3PB9X 1YW4A 3PZJA 4R57A 4JWPA 4KOSA 2PIYA 1M44A 3VWDA 4MY3A 4E2AA 4KOTA 4P6YA 1NSAA 1IB1E 3TO9A 4UFWA 3T8WA 3MN8A 5G21A 3BHXA 3RAMA 4C7IA 1H8LA 2AFMA 3ZZIA 3R9GA 5DWMA 3RZAA 4BINA 5A28A 3P2FA 2I79A 2QECA 2OOTA 1RXTA 2ZOFA 4ZX8A 3W91A 4P4EA 3FH4A 2NSMA 4M85A 4MMOA 2AFXA 4FD6A 1BLLE 2CXAA 2I00A 3SJEA 1ZLIA 2Z3LA 2ZEMA 4F0YA 1ZG8A 4CAVA 3K2KA 3PP9A 4KOUA 3PFEA 4YGOA 1HEEA 3I9SA 4B11A 1ARMA 5G1ZA 4NGPA 4UFXA 4A31A 1YW6A 1VGYA 3WABA 1XEBA 2DPSA 1XJOA 1BPMA 1CX8A 4QC6A 2EK8A 4MJ8A 4J3GA 5EMIA 3NE7A 2HC9A 4UEEA 3JVNA 4IF5A 2Q7SA 3MRUA 4OC1A 1TKFA 3A9LA 4NGMA 4B5OA 5HVHA 4P4BA 2P0WA 4PSXA 2F5IA 5KTCA 1YGHA 3LWUA 4QB9A 3TOBA 3S6FA 2F7VA 2JDCA 2AFSA 4NSQA 1QMUA 4U5YA 5F09A 2OB0A 4MHPA 1Z4EA 1JQGA 3B35A 4BMHA 5FVJA 4FAIA 1QSMA 2CIJA 2PJCA 2PJ7A 3KI9A 3VWEA 3D67A 2Q51A 3CPXA 1IYKA 4CGLA 4R3KA 4AXVA 1I1DA 3SHPA 3WC6A 2V77A 3PGPA 4R76A 4A30A 2WUUA 2ZELA 2QJ8A 4BBHA 4GM5A 3F8KA 3B3SA 1DE4C 2G3TA 5LYLA 1KZFA 3FIXA 4F0XA 3B3VA 1F2PA 5A27A 5J8FA 2EBJA 2O4HA 5ELYA 4B5PB 5AG4A 5F47A 2NMTA 4F6AA 4KORA 2QYVA 1Y9WA 4AVCA 1N71A 3EO4A 4UIAA 4C2YA 2FVGA 4HNYB 3V38A 1XF8A 4DYOA 4I49A 1VIXA 5K8OA 4KVME 1AMPA 1CP7A 2PJ9A 2VI7A 4K30A 3NE8A 4A32A 1U6MA 3NH4A 4E8OA 5KTDA 4OC5A 4KUAA 4PPZA 4NGSA 4RI1A 1X10A 4NJRA 3WT4A 4RS2A 3B2YA 1ELLP 2NYQA 3FVLA 4OLLA 4Q36A 1IYLA 3IGRA 4CS0B 4X2TA 3TFYA 2ARHA 4CRYB 1Q2DA 3FX6A 3PEIA 3VH9A 3T90A 1CPXA 3G3SA 3FB3A 2B4BA 2JEVA 3QAHA 4CPAA 3KQZA 4UCNA 2A4NA 1M4IA 2PJ2A 3QNVA 2ZEOA 1XRYA 4LUAA 1S7NA 3IWWA 5F49A 1KUVA 2QMLA 2D4PA 3L2NA 4IUSA 1M4GA 4YWYA 2OU2A 1J4JA 1YK3A 3KR4A 4QUSA 1ELMP 4NXYA 4EVYA 1YLEA 2HV2A 2PCUA 2C6GA 3BI0A 3KHXA 4MFKA 4ZY2A 1HDQA 3GY9A 2XEGA 3B3TA 3SI0A 4MRIA 4AG7A 2BSWA 1OZPA 2H5MA 1Q7LA 2JLMA 4OKOA 4PXCA 2C6CA 1IY7A 1Q2YA 2PJ4A 4Y49B 2ABZA 2O53A 4C2XA 2REEA 3WC7A 3F0AA 2RFHA 5LYDA 2HQYA 5G22A 5C82A 4M3SA 4KOVA 2FXFA 1FNOA 1BAVA 3CXPA 3DDDA 3K9UA 1UWYA 4MCPA 4PXDA 3EY5A 3UY5A 4KSFA 1I12A 4CYOA 1RTQA 4FD4A 4HNXB 2CTBA 2EVNA 2EO8A 4ORFA 2XEFA 4Y49C 2Z10A 3SI1A 1ZG7A 3FJUA 4DJLA 4NCZA 4FBEA 4X3RA 4CAFA 4H89A 4EMEA 1Y0YA 1JWQA 4MCRA 3WC5A 4OIWA 2J9AA 4BD9A 1IGBA 4M6GA 1MJAA 1AYEA 4UBRA 3D8PA 3JUWA 2GFQA 4CGOA 2OZGA 3S9LA 3IU1A 5DS0A 4ONWA 3PB8X 3TOAA 2VQYA 3FEDA 5JM6A 1OBRA 3HLPA 4B6ZA 2WPXA 3PB6X 3CT9A 1S3ZA 1B87A 3NH5A 4ZBGA 1PUAA 4UA3A 4JXQA 4B10A 2R98A 2AFZA 4F9UA 2PR1A 3GIUA 3GLJA 2FCKA 5K8PA 2J8MA 3DNSA 3B8GA 1YVOA 1QSOA 4XNHC 2WSAA 1TF8A 3OWCA 3W6XA 3NH8A 3BJ7A 3IFEA 3H4QA 3SXNA 3IWGA 2AJ6A 3KL9A 2VZZA 1S5KA 2QVPA 2GIVA 3NA6A 2CTCA 4UWJA 4H6UA 2WZNA 3IO1A 2B4DB 5HVGA 2J8RA 5EC4A 4W9YA 4MHDA 1GHEA 3FECA 2G3AA 2KCWA 3H8EA 4A38A 2Q4YA 4KZTA 4Q7AA 4UFVA 2CY2A 2VBQA 4PV6A 1BO4A 4OIDA 4TWEA 4OC4A 2CNSA 4NGQA 2FSRA 2ZEPA 5JPHA 2B5GA 1IOIA 3KASA 4IAVA 1RO5A 1F57A 3H8FA 4GS4A 2Q7BA 3S9MA 4KOYA 3B3WA 4OADA 1XIXA 3B7IA 2XEIA 4MFQA 4AG9A 4DUKA 2FIWA 2P6FA 2JDDA 4UIBA 3CZXA 2JEWA 5LRJA 4P44A 2C1CA 4MCQA 5J8CA 2Z3MA 2DPTA 2ZENA 3R9FA 2PVVA 3IC1A 1UFHA 1PYTB 4KVXA 4UCMA 5EBVA 1F2OA 2PJAA 3F5BA 1KUYA 3H5ZA 4YRHA 4Z65A 2Z3OA 6CPAA 4B14A 2BCOA 2I3CA 1Z8LA 2AFOA 4OMEA 2Z11A 2AFUA 4JJXA 1S7FA 5LYIA 4P4FA 4KS9A
chains in the Genus database with same CATH topology
3IWEA 4MFJA 3FNCA 3GYAA 2B58A 4C2ZA 4CYQA 1S60A 3DR6A 4FD7A 4NEXA 2B4DA 2Z0ZA 1KUXA 2ZW4A 3WR7A 1CJWA 2ZW5A 4MFLA 3R9EA 3FXTA 2FE7A 2Y0MA 4U9ZA 2FL4A 2ATRA 4AVAA 1Y7RA 1QSRA 1Z4RA 5DWNA 1L0CA 3JTKA 3MGDA 3QB8A 4R87A 5GCNA 4MFZA 4XPDC 4E0AA 1S7KA 2EUIA 2Q0YA 2Z3KA 4L89A 2OZHA 2IL4A 2CNTA 3FBUA 3E0KA 2R1IA 1S7LA 4KVOE 4PK3A 2P6EA 5BWAB 4C68A 4QBJA 1MK4A 4A33A 2DXQA 1P4NA 3LD2A 5AG6A 3LODA 3S6KA 4A2ZA 3IU2A 2B5GB 3SXOA 4KOWA 1BOBA 2G0BA 5HMNA 1CM0A 4PK2A 2VZYA 1V0CA 5AG7A 3D2PA 5HH1A 2WPWA 2PC1A 4C7HA 4CAWA 1Q2CA 4R3LA 3RYOA 2PDOA 4QVTA 4XNHB 4AB7A 1WK4A 4MY0A 3V8IA 3KKWA 3TO6A 1P0HA 4B12A 3EFAA 4JLYA 2AE6A 1NE9A 3S6GA 2YNCC 4KLVA 1XE4A 5IB0A 2BEIA 1TIQA 2BL1A 2ZPAA 3EXNA 3G8WA 1NMTA 3FYNA 4MI4A 2VEZA 2RC4A 4B13A 3TCVA 5H84A 1QSTA 4YFJA 3P2HA 4X5KA 1Z9UA 4KUBA 5AGEA 1MJ9A 3BJ8A 4A95A 1WWZA 4HKFA 2FT0A 3W6SA 5CNPA 4ONUA 4KSAA 2K5TA 2OH1A 2B3VA 4LX9A 1I21A 2D4OA 2J8NA 2CNMA 3TT2A 3D3SA 2X7BA 5AG5A 1VHSA 2FS5A 2YNCA 3DR8A 2VXKA 4H6ZA 4KLWA 3C26A 2REFA 4PSWA 5JQ4A 5E96A 1M1DA 1PU9A 2OZUA 2Z3PA 4HNWB 4NF1A 2R7HA 2YNDA 1YREA 2FIAA 5F48A 3DSBA 2HUZA 4XPKA 1QSNA 4XPLA 1Y9KA 2Q4VA 4JD6A 4U9YA 4R9MA 1LRZA 2ZW6A 2GANA 1IIDA 3TE4A 2PRBA 4UWIA 3R95A 4CRZB 2R8VA 5IV0A 3I3GA 4L8AA 2Q04A 3T9YA 3ZJ0A 4JXRA 4Q38A 4XPDB 1MJBA 5ISVA 1IICA 2BUEA 4CGMA 5C88A 2QIRA 2PSWA 5I0CA 2P6GA 1YX0A 2C27A 2ZXVA 2YGWA 1SQHA 1B6BA 2Z3NA 5H86A 1ON0A 4CGNA 1K4JA 1VKCA 4CYPA 4CGPA 1R57A 1YR0A 3CXQA 5F46A 3R1KA 2PQ8A 4AVBA 2PR8A 2ZW7A 5G20A 2O28A 4CYNA 4MFPA 4DNCA 2GE3A 4ZGYB 4CAXA 4OAEA 4MBUA 1ZO0A 3R96A 3N7ZA 3D2MA 1M4DA 3TTHA 3S6HA 4B5PA 4KOXA 3CXSA 4II9A 1FY7A 1XMTA 2YNEA 4UCPA 2B3UA 2Q44A 1NSLA 4FD5A 3GKRA 3BLNA 3FRMA 4CAEA 1YVKA 3TO7A 3EC4A 5KTAA 3PZJA 4R57A 4JWPA 4KOSA 1M44A 3VWDA 4MY3A 4E2AA 4KOTA 1IB1E 3TO9A 4UFWA 5G21A 4C7IA 3ZZIA 3R9GA 5DWMA 5A28A 3P2FA 2I79A 2QECA 1RXTA 3W91A 4M85A 4FD6A 2CXAA 2I00A 2Z3LA 4F0YA 4CAVA 3PP9A 4KOUA 4YGOA 3I9SA 4B11A 5G1ZA 4A31A 4UFXA 1XEBA 2DPSA 4QC6A 4MJ8A 4J3GA 3NE7A 3JVNA 4IF5A 3A9LA 4B5OA 2P0WA 4PSXA 2F5IA 5KTCA 1YGHA 4QB9A 3TOBA 3S6FA 2JDCA 4NSQA 4U5YA 2OB0A 1Z4EA 4BMHA 5FVJA 1QSMA 3VWEA 1IYKA 4CGLA 4R3KA 1I1DA 3SHPA 3PGPA 4A30A 2WUUA 4BBHA 3F8KA 2G3TA 1KZFA 3FIXA 4F0XA 5A27A 5J8FA 4B5PB 5AG4A 5F47A 2NMTA 4F6AA 4KORA 1Y9WA 4AVCA 1N71A 3EO4A 4C2YA 4HNYB 1XF8A 4I49A 4KVME 2VI7A 4K30A 4A32A 1U6MA 5KTDA 4E8OA 4KUAA 4RI1A 4RS2A 4Q36A 4OLLA 1IYLA 3IGRA 4CS0B 3TFYA 2ARHA 4CRYB 1Q2DA 3T90A 3G3SA 3FB3A 2B4BA 2JEVA 3QAHA 4UCNA 2A4NA 1M4IA 4LUAA 1S7NA 5F49A 1KUVA 2QMLA 2D4PA 4IUSA 1M4GA 2OU2A 1J4JA 1YK3A 4QUSA 4NXYA 4EVYA 1YLEA 2HV2A 4MFKA 3GY9A 4AG7A 2BSWA 1OZPA 2H5MA 2JLMA 1Q2YA 4Y49B 4C2XA 2REEA 3F0AA 2HQYA 5G22A 5C82A 4M3SA 4KOVA 2FXFA 3UY5A 3CXPA 3DDDA 3K9UA 3EY5A 4KSFA 1I12A 4CYOA 4FD4A 4HNXB 2EVNA 4ORFA 4Y49C 2Z10A 4NCZA 4CAFA 4H89A 1MJAA 4UBRA 3D8PA 3JUWA 4CGOA 2OZGA 3IU1A 3TOAA 2VQYA 2WPXA 1S3ZA 1B87A 4ZBGA 1PUAA 4UA3A 4JXQA 4B10A 2R98A 2PR1A 2FCKA 2J8MA 3DNSA 3B8GA 1YVOA 1QSOA 4XNHC 2WSAA 3OWCA 3W6XA 3BJ7A 3H4QA 3SXNA 3IWGA 2AJ6A 2VZZA 1S5KA 2GIVA 4UWJA 4H6UA 2B4DB 2J8RA 5EC4A 4MHDA 1GHEA 2G3AA 2KCWA 2Q4YA 4KZTA 4UFVA 2CY2A 2VBQA 4PV6A 1BO4A 2CNSA 2FSRA 5JPHA 2B5GA 1RO5A 4GS4A 2Q7BA 4KOYA 4OADA 4AG9A 1XIXA 5IX3A 4MFQA 2FIWA 2P6FA 2JDDA 5J8CA 2Z3MA 2DPTA 3R9FA 1UFHA 4KVXA 4UCMA 5EBVA 3F5BA 1KUYA 3H5ZA 4YRHA 2Z3OA 4B14A 2Z11A 4JJXA 1S7FA 4KS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FNC A;  3GYA A;  2B58 A;  1S60 A;  3DR6 A;  4FD7 A;  4NEX A;  2B4D A;  2Z0Z A;  1KUX A;  2ZW4 A;  3WR7 A;  1CJW A;  2ZW5 A;  3R9E A;  3FXT A;  2FE7 A;  2Y0M A;  4U9Z A;  2FL4 A;  2ATR A;  4AVA A;  1Y7R A;  1QSR A;  1Z4R A;  5DWN A;  1L0C A;  3MGD A;  3QB8 A;  4R87 A;  5GCN A;  4XPD C;  4E0A A;  1S7K A;  2EUI A;  2Q0Y A;  4L89 A;  2OZH A;  2IL4 A;  2CNT A;  3FBU A;  3E0K A;  2R1I A;  1S7L A;  4KVO E;  4PK3 A;  2P6E A;  4QBJ A;  1MK4 A;  2DXQ A;  1P4N A;  3LD2 A;  3LOD A;  3S6K A;  3SXO A;  2B5G B;  4KOW A;  1BOB A;  2G0B A;  5HMN A;  1CM0 A;  4PK2 A;  2VZY A;  1V0C A;  3D2P A;  5HH1 A;  2WPW A;  2PC1 A;  4CAW A;  1Q2C A;  4R3L A;  3RYO A;  2PDO A;  4QVT A;  4XNH B;  4AB7 A;  1WK4 A;  4MY0 A;  3V8I A;  3KKW A;  3TO6 A;  1P0H A;  3EFA A;  4JLY A;  2AE6 A;  1NE9 A;  3S6G A;  4KLV A;  1XE4 A;  5IB0 A;  2BEI A;  1TIQ A;  2BL1 A;  2ZPA A;  3EXN A;  3G8W A;  1NMT A;  3FYN A;  4MI4 A;  2VEZ A;  2RC4 A;  3TCV A;  5H84 A;  1QST A;  4YFJ A;  3P2H A;  4X5K A;  1Z9U A;  4KUB A;  1MJ9 A;  3BJ8 A;  1WWZ A;  4HKF A;  2FT0 A;  3W6S A;  5CNP A;  4ONU A;  2K5T A;  2OH1 A;  2B3V A;  4LX9 A;  1I21 A;  2D4O A;  2J8N A;  2CNM A;  3TT2 A;  3D3S A;  2X7B A;  1VHS A;  2FS5 A;  4KLW A;  3DR8 A;  2VXK A;  4H6Z A;  3C26 A;  2REF A;  4PSW A;  5JQ4 A;  5E96 A;  1M1D A;  1PU9 A;  2OZU A;  4HNW B;  4NF1 A;  2R7H A;  1YRE A;  2FIA A;  5F48 A;  3DSB A;  2HUZ A;  4XPK A;  1QSN A;  4XPL A;  1Y9K A;  2Q4V A;  4JD6 A;  4U9Y A;  4R9M A;  1LRZ A;  2ZW6 A;  2GAN A;  1IID A;  3TE4 A;  2PRB A;  4UWI A;  3R95 A;  4CRZ B;  2R8V A;  5IV0 A;  3I3G A;  4L8A A;  2Q04 A;  3T9Y A;  3ZJ0 A;  4JXR A;  4XPD B;  1MJB A;  5ISV A;  1IIC A;  2BUE A;  5C88 A;  2QIR A;  2PSW A;  5I0C A;  2P6G A;  1YX0 A;  2C27 A;  2ZXV A;  1SQH A;  1B6B A;  5H86 A;  1ON0 A;  1K4J A;  1VKC A;  1R57 A;  1YR0 A;  3CXQ A;  5F46 A;  3R1K A;  2PQ8 A;  4AVB A;  2PR8 A;  2ZW7 A;  2O28 A;  4DNC A;  2GE3 A;  4CAX A;  4OAE A;  4MBU A;  3R96 A;  3N7Z A;  3D2M A;  1M4D A;  3TTH A;  3S6H A;  4B5P A;  4KOX A;  3CXS A;  4II9 A;  1FY7 A;  1XMT A;  2B3U A;  2Q44 A;  1NSL A;  4FD5 A;  3GKR A;  3BLN A;  3FRM A;  1YVK A;  3TO7 A;  3EC4 A;  5KTA A;  3PZJ A;  4R57 A;  4JWP A;  4KOS A;  1M44 A;  3VWD A;  4MY3 A;  4E2A A;  4KOT A;  1IB1 E;  3TO9 A;  3ZZI A;  3R9G A;  5DWM A;  3P2F A;  2I79 A;  2QEC A;  1RXT A;  3W91 A;  4M85 A;  4FD6 A;  2I00 A;  4F0Y A;  4CAV A;  3PP9 A;  4KOU A;  4YGO A;  3I9S A;  1XEB A;  4QC6 A;  4MJ8 A;  4J3G A;  3NE7 A;  3JVN A;  4IF5 A;  4B5O A;  2P0W A;  4PSX A;  2F5I A;  5KTC A;  1YGH A;  4QB9 A;  3TOB A;  3S6F A;  2JDC A;  4NSQ A;  4U5Y A;  2OB0 A;  1Z4E A;  4BMH A;  5FVJ A;  1QSM A;  3VWE A;  1IYK A;  4R3K A;  1I1D A;  3SHP A;  3PGP A;  3F8K A;  2G3T A;  1KZF A;  3FIX A;  5J8F A;  4B5P B;  5F47 A;  2NMT A;  4F6A A;  4KOR A;  1Y9W A;  4AVC A;  1N71 A;  3EO4 A;  4HNY B;  1XF8 A;  4I49 A;  4KVM E;  2VI7 A;  4K30 A;  1U6M A;  5KTD A;  4E8O A;  4KUA A;  4RI1 A;  4RS2 A;  4OLL A;  1IYL A;  3IGR A;  4CS0 B;  3TFY A;  2ARH A;  4CRY B;  1Q2D A;  3T90 A;  3G3S A;  3FB3 A;  2B4B A;  2JEV A;  3QAH A;  2A4N A;  1M4I A;  4LUA A;  1S7N A;  5F49 A;  1KUV A;  2QML A;  2D4P A;  4IUS A;  1M4G A;  2OU2 A;  1J4J A;  1YK3 A;  4QUS A;  4NXY A;  4EVY A;  1YLE A;  2HV2 A;  3GY9 A;  4AG7 A;  2BSW A;  1OZP A;  2H5M A;  2JLM A;  1Q2Y A;  4Y49 B;  2REE A;  3F0A A;  2HQY A;  5C82 A;  4M3S A;  4KOV A;  2FXF A;  3UY5 A;  3CXP A;  3DDD A;  3K9U A;  3EY5 A;  1I12 A;  4FD4 A;  4HNX B;  2EVN A;  4ORF A;  4Y49 C;  2Z10 A;  4NCZ A;  4H89 A;  1MJA A;  4UBR A;  3D8P A;  3JUW A;  2OZG A;  3TOA A;  2VQY A;  2WPX A;  1S3Z A;  1B87 A;  4ZBG A;  1PUA A;  4UA3 A;  4JXQ A;  2R98 A;  2PR1 A;  2FCK A;  2J8M A;  3DNS A;  3B8G A;  1YVO A;  1QSO A;  4XNH C;  3OWC A;  3W6X A;  3BJ7 A;  3H4Q A;  3SXN A;  3IWG A;  2AJ6 A;  2VZZ A;  1S5K A;  2GIV A;  4UWJ A;  4H6U A;  2B4D B;  2J8R A;  5EC4 A;  4MHD A;  1GHE A;  2G3A A;  2KCW A;  2Q4Y A;  4KZT A;  2CY2 A;  2VBQ A;  4PV6 A;  1BO4 A;  2CNS A;  2FSR A;  5JPH A;  2B5G A;  1RO5 A;  4GS4 A;  2Q7B A;  4KOY A;  4OAD A;  4AG9 A;  1XIX A;  5IX3 A;  2FIW A;  2P6F A;  2JDD A;  5J8C A;  3R9F A;  1UFH A;  4KVX A;  5EBV A;  3F5B A;  1KUY A;  4YRH A;  2Z11 A;  4JJX A;  1S7F A; 
#chains in the Genus database with same CATH topology
 3IWE A;  3N5F A;  4MFJ A;  1PCA A;  3FNC A;  1DTD A;  3GYA A;  4ZY1 A;  1BPN A;  2B58 A;  2GRE A;  4OP4 A;  4C2Z A;  4CYQ A;  1S60 A;  3DR6 A;  3KR5 A;  4OC0 A;  4WJB A;  4FD7 A;  3LMS A;  4NEX A;  1X12 A;  3FMC A;  4O23 A;  2B4D A;  2Z0Z A;  4R6T A;  4UF4 A;  1KUX A;  2ZW4 A;  3WR7 A;  2PVW A;  1EE3 P;  3SJG A;  3SJX A;  5D8N A;  1CJW A;  4A94 A;  2ANP A;  2PJ1 A;  2ZW5 A;  4MFL A;  3ISZ A;  2GU2 A;  3R9E A;  3FXT A;  2PE3 A;  2FE7 A;  4NFR A;  5LYF A;  1TF9 A;  3FEE A;  3VAR A;  2Y0M A;  3CDX A;  2FL4 A;  4U9Z A;  4K3N A;  2ATR A;  2ZEH A;  4AVA A;  2ZED A;  4X8I A;  2OR4 A;  4YU9 A;  3CPA A;  2ODF A;  1Y7R A;  4NJQ A;  2GLF A;  4M6I A;  5IX3 A;  1QSR A;  4EFD A;  1Z4R A;  2DF5 A;  5LRG A;  5DWN A;  4F8Z A;  1L0C A;  3JTK A;  1Z2L A;  3MGD A;  3QB8 A;  4R87 A;  5GCN A;  4MFZ A;  4MCS A;  4XPD C;  4E0A A;  1S7K A;  2EUI A;  1AUG A;  1YLO A;  2Q0Y A;  2Z3K A;  4L89 A;  3D68 A;  2OZH A;  4RUH A;  2IL4 A;  2PRQ A;  4ZYQ A;  4M6H A;  2CNT A;  2Q4Z A;  3PB4 X;  3V7Z A;  3FBU A;  3E0K A;  2R1I A;  1S7L A;  4KVO E;  4PK3 A;  5K8N A;  1YME A;  2P6E A;  5BWA B;  4A37 A;  4C68 A;  4RN7 A;  4WWV A;  5LRK A;  4QBJ A;  1MK4 A;  4A33 A;  2DXQ A;  1P4N A;  2ZEF A;  3LD2 A;  5AG6 A;  3LOD A;  3S6K A;  2Q43 A;  4A2Z A;  3IU2 A;  2B5G B;  3SXO A;  1Y7E A;  4KOW A;  1BOB A;  2EK9 A;  2G0B A;  5HMN A;  4MHN A;  1CM0 A;  4PK2 A;  2VZY A;  4A39 A;  1V0C A;  1KWM A;  3PRT A;  5AG7 A;  2ZEE A;  3D2P A;  5HH1 A;  2WPW A;  2PC1 A;  4C7H A;  4CAW A;  3QAY A;  3GUX A;  1Q2C A;  4P10 A;  4R3L A;  3RYO A;  1Z5R A;  2PDO A;  4JZ0 A;  5THW A;  4QVT A;  4XNH B;  4AB7 A;  1WK4 A;  4MY0 A;  2AFW A;  4TNU A;  3V8I A;  3KKW A;  4FUU A;  2F8H A;  1P0H A;  3TO6 A;  3D7F A;  4B12 A;  1Z8W A;  3EFA A;  4JLY A;  2AE6 A;  1LFW A;  2JBK A;  1NE9 A;  1R3N A;  3S6G A;  2YNC C;  4KLV A;  2V8V A;  1XE4 A;  1YQE A;  3H8G A;  1LAN A;  1IOF A;  2BEI A;  3HUV A;  1TIQ A;  2BL1 A;  2ZPA A;  1R43 A;  5IB0 A;  3EXN A;  1IU8 A;  3D66 A;  4IHM A;  3KZW A;  3G8W A;  1NMT A;  3FYN A;  4MI4 A;  3KGQ A;  1VHO A;  2C6P A;  2PJ3 A;  2VEZ A;  4GXH A;  2RC4 A;  1YSJ A;  4B13 A;  2PIZ A;  4PXE A;  3TCV A;  5H84 A;  4NGT A;  4R8F A;  1QST A;  4YFJ A;  3P2H A;  1QQ9 A;  4X5K A;  7CPA A;  1Z9U A;  3DGV A;  4KUB A;  3GB0 A;  5AGE A;  1MJ9 A;  1XOV A;  2CF4 A;  2PJ6 A;  3BJ8 A;  3D4U A;  1WWZ A;  4H2K A;  4A95 A;  4HKF A;  2EWB A;  2FT0 A;  3RO0 A;  2IJZ A;  3W6S A;  1LCP A;  5CNP A;  4ONU A;  5D29 A;  3DLJ A;  2K5T A;  2OH1 A;  1CG2 A;  4KSA A;  2B3V A;  4LX9 A;  2V8H A;  1ZG9 A;  1I21 A;  2D4O A;  2J8N A;  3PFO A;  2CNM A;  3TT2 A;  3D3S A;  3TX8 A;  3JRU A;  2X7B A;  2BO9 A;  5AG5 A;  3RNZ A;  1VHS A;  4OC2 A;  4UEF A;  2FS5 A;  2YNC A;  3DR8 A;  2VXK A;  4H6Z A;  4KLW A;  3C26 A;  3IJ3 A;  4P45 A;  4UEZ A;  5HVF A;  2REF A;  1Z8T A;  4PSW A;  5J1Q A;  5JQ4 A;  3KQX A;  5E96 A;  2V8D A;  1A2Z A;  1M1D A;  1PU9 A;  2OZU A;  2Z3P A;  4HNW B;  4NF1 A;  4LQ6 A;  2R7H A;  4OC3 A;  1CP6 A;  2YND A;  1YRE A;  2FIA A;  5F48 A;  3DSB A;  4KSI A;  5K8M A;  4G1P A;  2HUZ A;  4XPK A;  1QSN A;  4XPL A;  4R7M A;  3D7G A;  3IIB A;  1Y9K A;  2Q4V A;  4IK2 A;  1ARL A;  4JD6 A;  3KHZ A;  4U9Y A;  4R9M A;  2IMO A;  1LRZ A;  2ZW6 A;  2GAN A;  3I1U A;  1IID A;  3TE4 A;  2PRB A;  1LAP A;  1TKH A;  4UWI A;  5CPA A;  3R95 A;  4CRZ B;  2R8V A;  2XEJ A;  5IV0 A;  3D7D A;  3K9T A;  3PBE A;  1LAM A;  3I3G A;  4L8A A;  4EWT A;  2Q04 A;  5JH9 A;  2GLJ A;  2V8G A;  3B3C A;  4P4J A;  3T9Y A;  4LQG A;  2IQ6 A;  3ZJ0 A;  4JXR A;  4JYW A;  2PJ5 A;  5IB9 A;  3D7H A;  2JBJ A;  4Q38 A;  4XPD B;  3RBU A;  3ISX A;  3SI2 A;  3SJF A;  2VL1 A;  1MJB A;  5ISV A;  1IIC A;  2BUE A;  4CGM A;  1CBX A;  5C88 A;  2QIR A;  2PSW A;  3LAC A;  5I0C A;  2P6G A;  1YX0 A;  2C27 A;  2ZXV A;  8CPA A;  2YGW A;  3BXM A;  1SQH A;  1B6B A;  1Y0R A;  2Z3N A;  1ON0 A;  5H86 A;  1CPS A;  2ZOG A;  4CGN A;  4PQA A;  1K4J A;  2PJ0 A;  1VKC A;  1TKJ A;  2G9D A;  2HB6 A;  4CYP A;  4CGP A;  1FT7 A;  5HXD A;  5I4M A;  1R57 A;  1YR0 A;  1LOK A;  4MHY A;  5JGF A;  4ZX9 A;  4MHZ A;  3CXQ A;  4P4D A;  5F46 A;  2BOA A;  2WYR A;  5CBM A;  3R1K A;  4F9V A;  1Z8X A;  2RB7 A;  1GYT A;  2PQ8 A;  2PJB A;  4ZI6 A;  1XFO A;  1XMB A;  2PJ8 A;  4NGN A;  4AVB A;  1M4L A;  2PR8 A;  3PB7 X;  2ZW7 A;  5G20 A;  3TC8 A;  3VAT A;  3S9N A;  2O28 A;  4CYN A;  4MFP A;  4PXB A;  4DNC A;  2GE3 A;  4ZGY B;  4CAX A;  4OAE A;  4MBU A;  3IEH A;  1ZO0 A;  3R96 A;  4FWU A;  3N7Z A;  3D2M A;  1M4D A;  3BI1 A;  4NGR A;  3TTH A;  3S6H A;  4B5P A;  4KOX A;  3CXS A;  4II9 A;  1FY7 A;  1XMT A;  2POK A;  2YNE A;  2ZEG A;  4UCP A;  3NFZ A;  2B3U A;  1VHE A;  2Q44 A;  4HPS A;  1NSL A;  1ZLH A;  3FF3 A;  4P4I A;  4FD5 A;  3BLN A;  3GKR A;  3FRM A;  4CAE A;  1YVK A;  4MXU A;  3PBB A;  3TO7 A;  4ZY0 A;  3EC4 A;  2DEA A;  1TXR A;  5KTA A;  1XBU A;  1HDU A;  3PB9 X;  1YW4 A;  3PZJ A;  4R57 A;  4JWP A;  4KOS A;  2PIY A;  1M44 A;  3VWD A;  4MY3 A;  4E2A A;  4KOT A;  4P6Y A;  1NSA A;  1IB1 E;  3TO9 A;  4UFW A;  3T8W A;  3MN8 A;  5G21 A;  3BHX A;  3RAM A;  4C7I A;  1H8L A;  2AFM A;  3ZZI A;  3R9G A;  5DWM A;  3RZA A;  4BIN A;  5A28 A;  3P2F A;  2I79 A;  2QEC A;  2OOT A;  1RXT A;  2ZOF A;  4ZX8 A;  3W91 A;  4P4E A;  3FH4 A;  2NSM A;  4M85 A;  4MMO A;  2AFX A;  4FD6 A;  1BLL E;  2CXA A;  2I00 A;  3SJE A;  1ZLI A;  2Z3L A;  2ZEM A;  4F0Y A;  1ZG8 A;  4CAV A;  3K2K A;  3PP9 A;  4KOU A;  3PFE A;  4YGO A;  1HEE A;  3I9S A;  4B11 A;  1ARM A;  5G1Z A;  4NGP A;  4UFX A;  4A31 A;  1YW6 A;  1VGY A;  3WAB A;  1XEB A;  2DPS A;  1XJO A;  1BPM A;  1CX8 A;  4QC6 A;  2EK8 A;  4MJ8 A;  4J3G A;  5EMI A;  3NE7 A;  2HC9 A;  4UEE A;  3JVN A;  4IF5 A;  2Q7S A;  3MRU A;  4OC1 A;  1TKF A;  3A9L A;  4NGM A;  4B5O A;  5HVH A;  4P4B A;  2P0W A;  4PSX A;  2F5I A;  5KTC A;  1YGH A;  3LWU A;  4QB9 A;  3TOB A;  3S6F A;  2F7V A;  2JDC A;  2AFS A;  4NSQ A;  1QMU A;  4U5Y A;  5F09 A;  2OB0 A;  4MHP A;  1Z4E A;  1JQG A;  3B35 A;  4BMH A;  5FVJ A;  4FAI A;  1QSM A;  2CIJ A;  2PJC A;  2PJ7 A;  3KI9 A;  3VWE A;  3D67 A;  2Q51 A;  3CPX A;  1IYK A;  4CGL A;  4R3K A;  4AXV A;  1I1D A;  3SHP A;  3WC6 A;  2V77 A;  3PGP A;  4R76 A;  4A30 A;  2WUU A;  2ZEL A;  2QJ8 A;  4BBH A;  4GM5 A;  3F8K A;  3B3S A;  1DE4 C;  2G3T A;  5LYL A;  1KZF A;  3FIX A;  4F0X A;  3B3V A;  1F2P A;  5A27 A;  5J8F A;  2EBJ A;  2O4H A;  5ELY A;  4B5P B;  5AG4 A;  5F47 A;  2NMT A;  4F6A A;  4KOR A;  2QYV A;  1Y9W A;  4AVC A;  1N71 A;  3EO4 A;  4UIA A;  4C2Y A;  2FVG A;  4HNY B;  3V38 A;  1XF8 A;  4DYO A;  4I49 A;  1VIX A;  5K8O A;  4KVM E;  1AMP A;  1CP7 A;  2PJ9 A;  2VI7 A;  4K30 A;  3NE8 A;  4A32 A;  1U6M A;  3NH4 A;  4E8O A;  5KTD A;  4OC5 A;  4KUA A;  4PPZ A;  4NGS A;  4RI1 A;  1X10 A;  4NJR A;  3WT4 A;  4RS2 A;  3B2Y A;  1ELL P;  2NYQ A;  3FVL A;  4OLL A;  4Q36 A;  1IYL A;  3IGR A;  4CS0 B;  4X2T A;  3TFY A;  2ARH A;  4CRY B;  1Q2D A;  3FX6 A;  3PEI A;  3VH9 A;  3T90 A;  1CPX A;  3G3S A;  3FB3 A;  2B4B A;  2JEV A;  3QAH A;  4CPA A;  3KQZ A;  4UCN A;  2A4N A;  1M4I A;  2PJ2 A;  3QNV A;  2ZEO A;  1XRY A;  4LUA A;  1S7N A;  3IWW A;  5F49 A;  1KUV A;  2QML A;  2D4P A;  3L2N A;  4IUS A;  1M4G A;  4YWY A;  2OU2 A;  1J4J A;  1YK3 A;  3KR4 A;  4QUS A;  1ELM P;  4NXY A;  4EVY A;  1YLE A;  2HV2 A;  2PCU A;  2C6G A;  3BI0 A;  3KHX A;  4MFK A;  4ZY2 A;  1HDQ A;  3GY9 A;  2XEG A;  3B3T A;  3SI0 A;  4MRI A;  4AG7 A;  2BSW A;  1OZP A;  2H5M A;  1Q7L A;  2JLM A;  4OKO A;  4PXC A;  2C6C A;  1IY7 A;  1Q2Y A;  2PJ4 A;  4Y49 B;  2ABZ A;  2O53 A;  4C2X A;  2REE A;  3WC7 A;  3F0A A;  2RFH A;  5LYD A;  2HQY A;  5G22 A;  5C82 A;  4M3S A;  4KOV A;  2FXF A;  1FNO A;  1BAV A;  3CXP A;  3DDD A;  3K9U A;  1UWY A;  4MCP A;  4PXD A;  3EY5 A;  3UY5 A;  4KSF A;  1I12 A;  4CYO A;  1RTQ A;  4FD4 A;  4HNX B;  2CTB A;  2EVN A;  2EO8 A;  4ORF A;  2XEF A;  4Y49 C;  2Z10 A;  3SI1 A;  1ZG7 A;  3FJU A;  4DJL A;  4NCZ A;  4FBE A;  4X3R A;  4CAF A;  4H89 A;  4EME A;  1Y0Y A;  1JWQ A;  4MCR A;  3WC5 A;  4OIW A;  2J9A A;  4BD9 A;  1IGB A;  4M6G A;  1MJA A;  1AYE A;  4UBR A;  3D8P A;  3JUW A;  2GFQ A;  4CGO A;  2OZG A;  3S9L A;  3IU1 A;  5DS0 A;  4ONW A;  3PB8 X;  3TOA A;  2VQY A;  3FED A;  5JM6 A;  1OBR A;  3HLP A;  4B6Z A;  2WPX A;  3PB6 X;  3CT9 A;  1S3Z A;  1B87 A;  3NH5 A;  4ZBG A;  1PUA A;  4UA3 A;  4JXQ A;  4B10 A;  2R98 A;  2AFZ A;  4F9U A;  2PR1 A;  3GIU A;  3GLJ A;  2FCK A;  5K8P A;  2J8M A;  3DNS A;  3B8G A;  1YVO A;  1QSO A;  4XNH C;  2WSA A;  1TF8 A;  3OWC A;  3W6X A;  3NH8 A;  3BJ7 A;  3IFE A;  3H4Q A;  3SXN A;  3IWG A;  2AJ6 A;  3KL9 A;  2VZZ A;  1S5K A;  2QVP A;  2GIV A;  3NA6 A;  2CTC A;  4UWJ A;  4H6U A;  2WZN A;  3IO1 A;  2B4D B;  5HVG A;  2J8R A;  5EC4 A;  4W9Y A;  4MHD A;  1GHE A;  3FEC A;  2G3A A;  2KCW A;  3H8E A;  4A38 A;  2Q4Y A;  4KZT A;  4Q7A A;  4UFV A;  2CY2 A;  2VBQ A;  4PV6 A;  1BO4 A;  4OID A;  4TWE A;  4OC4 A;  2CNS A;  4NGQ A;  2FSR A;  2ZEP A;  5JPH A;  2B5G A;  1IOI A;  3KAS A;  4IAV A;  1RO5 A;  1F57 A;  3H8F A;  4GS4 A;  2Q7B A;  3S9M A;  4KOY A;  3B3W A;  4OAD A;  1XIX A;  3B7I A;  2XEI A;  4MFQ A;  4AG9 A;  4DUK A;  2FIW A;  2P6F A;  2JDD A;  4UIB A;  3CZX A;  2JEW A;  5LRJ A;  4P44 A;  2C1C A;  4MCQ A;  5J8C A;  2Z3M A;  2DPT A;  2ZEN A;  3R9F A;  2PVV A;  3IC1 A;  1UFH A;  1PYT B;  4KVX A;  4UCM A;  5EBV A;  1F2O A;  2PJA A;  3F5B A;  1KUY A;  3H5Z A;  4YRH A;  4Z65 A;  2Z3O A;  6CPA A;  4B14 A;  2BCO A;  2I3C A;  1Z8L A;  2AFO A;  4OME A;  2Z11 A;  2AFU A;  4JJX A;  1S7F A;  5LYI A;  4P4F A;  4KS9 A; 
#chains in the Genus database with same CATH homology
 3IWE A;  4MFJ A;  3FNC A;  3GYA A;  2B58 A;  4C2Z A;  4CYQ A;  1S60 A;  3DR6 A;  4FD7 A;  4NEX A;  2B4D A;  2Z0Z A;  1KUX A;  2ZW4 A;  3WR7 A;  1CJW A;  2ZW5 A;  4MFL A;  3R9E A;  3FXT A;  2FE7 A;  2Y0M A;  4U9Z A;  2FL4 A;  2ATR A;  4AVA A;  1Y7R A;  1QSR A;  1Z4R A;  5DWN A;  1L0C A;  3JTK A;  3MGD A;  3QB8 A;  4R87 A;  5GCN A;  4MFZ A;  4XPD C;  4E0A A;  1S7K A;  2EUI A;  2Q0Y A;  2Z3K A;  4L89 A;  2OZH A;  2IL4 A;  2CNT A;  3FBU A;  3E0K A;  2R1I A;  1S7L A;  4KVO E;  4PK3 A;  2P6E A;  5BWA B;  4C68 A;  4QBJ A;  1MK4 A;  4A33 A;  2DXQ A;  1P4N A;  3LD2 A;  5AG6 A;  3LOD A;  3S6K A;  4A2Z A;  3IU2 A;  2B5G B;  3SXO A;  4KOW A;  1BOB A;  2G0B A;  5HMN A;  1CM0 A;  4PK2 A;  2VZY A;  1V0C A;  5AG7 A;  3D2P A;  5HH1 A;  2WPW A;  2PC1 A;  4C7H A;  4CAW A;  1Q2C A;  4R3L A;  3RYO A;  2PDO A;  4QVT A;  4XNH B;  4AB7 A;  1WK4 A;  4MY0 A;  3V8I A;  3KKW A;  3TO6 A;  1P0H A;  4B12 A;  3EFA A;  4JLY A;  2AE6 A;  1NE9 A;  3S6G A;  2YNC C;  4KLV A;  1XE4 A;  5IB0 A;  2BEI A;  1TIQ A;  2BL1 A;  2ZPA A;  3EXN A;  3G8W A;  1NMT A;  3FYN A;  4MI4 A;  2VEZ A;  2RC4 A;  4B13 A;  3TCV A;  5H84 A;  1QST A;  4YFJ A;  3P2H A;  4X5K A;  1Z9U A;  4KUB A;  5AGE A;  1MJ9 A;  3BJ8 A;  4A95 A;  1WWZ A;  4HKF A;  2FT0 A;  3W6S A;  5CNP A;  4ONU A;  4KSA A;  2K5T A;  2OH1 A;  2B3V A;  4LX9 A;  1I21 A;  2D4O A;  2J8N A;  2CNM A;  3TT2 A;  3D3S A;  2X7B A;  5AG5 A;  1VHS A;  2FS5 A;  2YNC A;  3DR8 A;  2VXK A;  4H6Z A;  4KLW A;  3C26 A;  2REF A;  4PSW A;  5JQ4 A;  5E96 A;  1M1D A;  1PU9 A;  2OZU A;  2Z3P A;  4HNW B;  4NF1 A;  2R7H A;  2YND A;  1YRE A;  2FIA A;  5F48 A;  3DSB A;  2HUZ A;  4XPK A;  1QSN A;  4XPL A;  1Y9K A;  2Q4V A;  4JD6 A;  4U9Y A;  4R9M A;  1LRZ A;  2ZW6 A;  2GAN A;  1IID A;  3TE4 A;  2PRB A;  4UWI A;  3R95 A;  4CRZ B;  2R8V A;  5IV0 A;  3I3G A;  4L8A A;  2Q04 A;  3T9Y A;  3ZJ0 A;  4JXR A;  4Q38 A;  4XPD B;  1MJB A;  5ISV A;  1IIC A;  2BUE A;  4CGM A;  5C88 A;  2QIR A;  2PSW A;  5I0C A;  2P6G A;  1YX0 A;  2C27 A;  2ZXV A;  2YGW A;  1SQH A;  1B6B A;  2Z3N A;  5H86 A;  1ON0 A;  4CGN A;  1K4J A;  1VKC A;  4CYP A;  4CGP A;  1R57 A;  1YR0 A;  3CXQ A;  5F46 A;  3R1K A;  2PQ8 A;  4AVB A;  2PR8 A;  2ZW7 A;  5G20 A;  2O28 A;  4CYN A;  4MFP A;  4DNC A;  2GE3 A;  4ZGY B;  4CAX A;  4OAE A;  4MBU A;  1ZO0 A;  3R96 A;  3N7Z A;  3D2M A;  1M4D A;  3TTH A;  3S6H A;  4B5P A;  4KOX A;  3CXS A;  4II9 A;  1FY7 A;  1XMT A;  2YNE A;  4UCP A;  2B3U A;  2Q44 A;  1NSL A;  4FD5 A;  3GKR A;  3BLN A;  3FRM A;  4CAE A;  1YVK A;  3TO7 A;  3EC4 A;  5KTA A;  3PZJ A;  4R57 A;  4JWP A;  4KOS A;  1M44 A;  3VWD A;  4MY3 A;  4E2A A;  4KOT A;  1IB1 E;  3TO9 A;  4UFW A;  5G21 A;  4C7I A;  3ZZI A;  3R9G A;  5DWM A;  5A28 A;  3P2F A;  2I79 A;  2QEC A;  1RXT A;  3W91 A;  4M85 A;  4FD6 A;  2CXA A;  2I00 A;  2Z3L A;  4F0Y A;  4CAV A;  3PP9 A;  4KOU A;  4YGO A;  3I9S A;  4B11 A;  5G1Z A;  4A31 A;  4UFX A;  1XEB A;  2DPS A;  4QC6 A;  4MJ8 A;  4J3G A;  3NE7 A;  3JVN A;  4IF5 A;  3A9L A;  4B5O A;  2P0W A;  4PSX A;  2F5I A;  5KTC A;  1YGH A;  4QB9 A;  3TOB A;  3S6F A;  2JDC A;  4NSQ A;  4U5Y A;  2OB0 A;  1Z4E A;  4BMH A;  5FVJ A;  1QSM A;  3VWE A;  1IYK A;  4CGL A;  4R3K A;  1I1D A;  3SHP A;  3PGP A;  4A30 A;  2WUU A;  4BBH A;  3F8K A;  2G3T A;  1KZF A;  3FIX A;  4F0X A;  5A27 A;  5J8F A;  4B5P B;  5AG4 A;  5F47 A;  2NMT A;  4F6A A;  4KOR A;  1Y9W A;  4AVC A;  1N71 A;  3EO4 A;  4C2Y A;  4HNY B;  1XF8 A;  4I49 A;  4KVM E;  2VI7 A;  4K30 A;  4A32 A;  1U6M A;  5KTD A;  4E8O A;  4KUA A;  4RI1 A;  4RS2 A;  4Q36 A;  4OLL A;  1IYL A;  3IGR A;  4CS0 B;  3TFY A;  2ARH A;  4CRY B;  1Q2D A;  3T90 A;  3G3S A;  3FB3 A;  2B4B A;  2JEV A;  3QAH A;  4UCN A;  2A4N A;  1M4I A;  4LUA A;  1S7N A;  5F49 A;  1KUV A;  2QML A;  2D4P A;  4IUS A;  1M4G A;  2OU2 A;  1J4J A;  1YK3 A;  4QUS A;  4NXY A;  4EVY A;  1YLE A;  2HV2 A;  4MFK A;  3GY9 A;  4AG7 A;  2BSW A;  1OZP A;  2H5M A;  2JLM A;  1Q2Y A;  4Y49 B;  4C2X A;  2REE A;  3F0A A;  2HQY A;  5G22 A;  5C82 A;  4M3S A;  4KOV A;  2FXF A;  3UY5 A;  3CXP A;  3DDD A;  3K9U A;  3EY5 A;  4KSF A;  1I12 A;  4CYO A;  4FD4 A;  4HNX B;  2EVN A;  4ORF A;  4Y49 C;  2Z10 A;  4NCZ A;  4CAF A;  4H89 A;  1MJA A;  4UBR A;  3D8P A;  3JUW A;  4CGO A;  2OZG A;  3IU1 A;  3TOA A;  2VQY A;  2WPX A;  1S3Z A;  1B87 A;  4ZBG A;  1PUA A;  4UA3 A;  4JXQ A;  4B10 A;  2R98 A;  2PR1 A;  2FCK A;  2J8M A;  3DNS A;  3B8G A;  1YVO A;  1QSO A;  4XNH C;  2WSA A;  3OWC A;  3W6X A;  3BJ7 A;  3H4Q A;  3SXN A;  3IWG A;  2AJ6 A;  2VZZ A;  1S5K A;  2GIV A;  4UWJ A;  4H6U A;  2B4D B;  2J8R A;  5EC4 A;  4MHD A;  1GHE A;  2G3A A;  2KCW A;  2Q4Y A;  4KZT A;  4UFV A;  2CY2 A;  2VBQ A;  4PV6 A;  1BO4 A;  2CNS A;  2FSR A;  5JPH A;  2B5G A;  1RO5 A;  4GS4 A;  2Q7B A;  4KOY A;  4OAD A;  4AG9 A;  1XIX A;  5IX3 A;  4MFQ A;  2FIW A;  2P6F A;  2JDD A;  5J8C A;  2Z3M A;  2DPT A;  3R9F A;  1UFH A;  4KVX A;  4UCM A;  5EBV A;  3F5B A;  1KUY A;  3H5Z A;  4YRH A;  2Z3O A;  4B14 A;  2Z11 A;  4JJX A;  1S7F A;  4KS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...