2REKA

Crystal structure of tetr-family transcriptional regulator
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
181
structure length
172
Chain Sequence
ADARRNYDRIIEAAAAEVARHGADASLEEIARRAGVGSATLHRHFPSRWGLLQAVFQERVAQLCDEARSLAAEHPPATALTRWLTSLAVFGAVTRGAARSLAALDSRCEQLLTEAGADLLARAQEDGTVRDDVTALELLSLANAVSLAAEHTPDAAHHATRLMGIALGGLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR-family transcriptional regulator
publication title Crystal structure of tetR-family transcriptional regulator.
rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
total genus 70
structure length 172
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2rekA00
3BTIA 5HSZA 3BJBA 3WHCA 1T56A 2OF7A 1JT0A 3CDLA 3V6GA 2G0EA 1BJZA 5K7FA 3ZQHA 2QOPA 2ZCNA 3QBMA 2IEKA 2GBYA 3CWRA 1SGMA 4GCLA 5J3LA 2HYTA 4AF5A 3F1BA 3NRGA 3KKCA 4M3GA 3IH2A 1T33A 5IP6A 3G1OA 3MVPA 5J1UA 3G1MA 3BCGA 3KKDA 3BHQA 2DTZA 2NX4A 5F0HA 3P9TA 4W97A 2JK3A 2YVEA 3E7QA 3VW2A 4NN1A 2Y30A 4GFKA 3HTJA 2JJ7A 4B3AA 3FIWA 2O7OA 3AQTA 5CW8A 2REKA 3DPJA 5GPCA 4ABZA 1ZK8A 2G7GA 2HXIA 1VI0A 2IAIA 3VIBA 3VP5A 3B6CA 3HGYA 3BQYA 4JNNA 3DEWA 3C2BA 3COLA 3BTJA 1A6IA 2Y2ZA 5FHPA 4YZEA 3Q0WA 1U9OA 2XGEA 5F1JA 3BTLA 4KWAA 5EFYA 1QPIA 3Q0UA 2UXIA 5DAJA 5F0FA 3GEUA 2WGBA 5K7HA 3BR2A 5EZHA 5FMPA 2O7TA 2XPWA 2FJ1A 3BR6A 3WHBA 5EZGA 5IOZA 3VVZA 2I10A 3V78A 2ZOZA 2HYJA 3RH2A 4JYKA 3IH3A 2ID3A 4M3DA 3ANPA 2GFNA 5K7ZA 3NPIA 1JTYA 5HBUA 3NI7A 2DG8A 3IUVA 5GP9A 3LHQA 3HTHA 4AUXA 2XGCA 4MO7A 3ON2A 3T6NA 3S5RA 3RD3A 2G3BA 2GENA 2NS7A 5H9TA 5C4YA 5FKKA 3HE0A 2OERA 2VKVA 2QIBA 2NP5A 3HGGA 3ZQIA 3B81A 3NNRA 5CXGA 2ID6A 3LJLA 4V2FA 4DW6A 2X6OA 3CCYA 4D7MA 4M3BA 2YVHA 4L62A 4V2GA 2XPUA 2Q24A 2D6YA 1QVTA 3PM1A 3ZQFA 4ME9A 5F0CA 1RKTA 2UXUA 1QVUA 2ZB9A 2Y31A 5HAWA 2FX0A 5GPAA 5F27A 3EGQA 2VKEA 3G56A 3Q0VA 5F08A 2FBQA 4NELA 4D7NA 3HTIA 4AC0A 5J1YA 3BTCA 2V57A 4JKZA 1JTXA 2TRTA 4GFLA 2EH3A 3BT9A 3ZQGA 4M3FA 3ANGA 5FGLA 2RASA 5FKMA 3VUQA 4CGRA 1RPWA 1UI6A 4I6ZA 3EUPA 3LWJA 4W1UA 2NS8A 5FKLA 4GCKA 3AQSA 3TP0A 3LSJA 2VPRA 3HIMA 2F07A 2UXOA 2PZ9A 3IH4A 3LSPA 5D18A 3BR1A 3QQAA 2OI8A 3FK6A 4MK6A 3BRUA 3FK7A 3BR0A 2QWTA 3B6AA 4MXMA 3G7RA 3BR3A 1Z0XA 3VVYA 2WV1A 3KZ9A 4I76A 5K58A 2GUHA 3GZIA 2FQ4A 2FD5A 3PPBA 3DCFA 3VVXA 2QTQA 4XK4A 4PXIA 2WUIA 5IOYA 3BQZA 5AQCA 2RHAA 5D19A 2IU5A 3VW1A 2PBXA 4UDSA 5IPAA 4M3EA 4JL3A 4GCTA 5EYRA 5J1RA 3VPRA 4X1EA 1JUSA 3QPLA 2ZOYA 1RKWA 3VOKA 2XPVA 4B1RA 2QKOA 2W53A 3VOXA 3CJDA 3MNLA 3FRQA 2IBDA 5FKNA 4D5FA 5D1RA 5F04A 3O60A 3O8GA 2ZCXA 2UXPA 2OPTA 1UI5A 1U9NA 2XDNA 3C07A 3VW0A 3Q3SA 3HTAA 2UXHA 4G12A 3SFIA 2ZCMA 3BNIA 1ORKA 3ZQLA 2XGDA 4ACIA 4ICHA 2DG7A 2HXOA 2XB5A 3QKXA 5CXIA 2TCTA 1ZKGA 2G7SA 1Z77A 3PASA 2HQ5A 2QCOA 2HKUA 5FKOA 4D5CA 4AC6A 2G7LA 3LSRA 3KNWA 3NXCA 3ON4A 3LOCA 3O8HA 3JSJA 2NP3A 3G1LA 3F0CA 1JUMA 1JUPA 4HKUA 2X9DA 3SDGA 1JT6A 3QPSA 2XRLA 3BR5A 3TP3A 2RAEA 3CRJA
chains in the Genus database with same CATH superfamily
3BTIA 5HSZA 3BJBA 3WHCA 1T56A 2OF7A 1JT0A 3CDLA 3V6GA 2G0EA 2PFVA 1BJZA 5K7FA 3ZQHA 2QOPA 2ZCNA 3QBMA 2IEKA 2GBYA 3NS4A 3CWRA 1SGMA 4GCLA 5J3LA 2HYTA 4AF5A 3F1BA 3NRGA 3KKCA 4M3GA 2FJI1 2R7TA 3IH2A 1T33A 5IP6A 3G1OA 3MVPA 5J1UA 3G1MA 3BCGA 3KKDA 3BHQA 2DTZA 2NX4A 5F0HA 4IRVA 3P9TA 4W97A 2JK3A 2YVEA 3E7QA 3VW2A 4NN1A 2Y30A 4GFKA 3HTJA 2JJ7A 4B3AA 3FIWA 2O7OA 3AQTA 5CW8A 2REKA 3DPJA 5GPCA 4ABZA 1ZK8A 2G7GA 2HXIA 1VI0A 2IAIA 3VIBA 3VP5A 3B6CA 3HGYA 3BQYA 4JNNA 3DEWA 3C2BA 3COLA 3BTJA 1A6IA 2Y2ZA 5FHPA 4YZEA 3Q0WA 1U9OA 3DU5A 2XGEA 5F1JA 3BTLA 4KWAA 5EFYA 1QPIA 3Q0UA 2UXIA 5DAJA 5F0FA 3GEUA 2WGBA 5K7HA 3BR2A 5EZHA 4U9LA 5FMPA 2O7TA 2R7WA 2XPWA 2FJ1A 3BR6A 3WHBA 5EZGA 5IOZA 3VVZA 2I10A 3V78A 2ZOZA 2HYJA 4OD4A 3RH2A 4JYKA 3IH3A 2ID3A 4M3DA 3ANPA 2GFNA 5K7ZA 3NPIA 3K8PC 1JTYA 5HBUA 3NI7A 2DG8A 3IUVA 5GP9A 3LHQA 3HTHA 4AUXA 2XGCA 4MO7A 3ON2A 3T6NA 3S5RA 3RD3A 2G3BA 2GENA 2NS7A 5H9TA 5C4YA 5FKKA 3HE0A 2OERA 2VKVA 2QIBA 2NP5A 3HGGA 3ZQIA 3B81A 3NNRA 5CXGA 2ID6A 3LJLA 4V2FA 3FHNA 4DW6A 2X6OA 3CCYA 4U9NA 4D7MA 4M3BA 2YVHA 4L62A 4V2GA 2XPUA 2Q24A 2D6YA 1QVTA 3PM1A 3ZQFA 4ME9A 5F0CA 2R7XA 1RKTA 2UXUA 1QVUA 2ZY9A 2ZB9A 2Y31A 5HAWA 2FX0A 5GPAA 5F27A 3EGQA 2VKEA 3G56A 3Q0VA 5F08A 3SWHA 2FBQA 4NELA 4D7NA 3HTIA 4AC0A 5J1YA 3BTCA 2V57A 4JKZA 1JTXA 2TRTA 4GFLA 2EH3A 4WIBA 3BT9A 3ZQGA 4M3FA 3ANGA 5FGLA 2RASA 5FKMA 2B3WA 3VUQA 4CGRA 1RPWA 1UI6A 4I6ZA 3EUPA 2R7UA 3LWJA 4W1UA 2NS8A 5FKLA 4GCKA 3AQSA 3TP0A 3LSJA 2VPRA 3HIMA 2F07A 2UXOA 2PZ9A 3IH4A 3LSPA 5D18A 3BR1A 3QQAA 2OI8A 3FK6A 4MK6A 3BRUA 3FK7A 2R7RA 3BR0A 2QWTA 2R7VA 3B6AA 4MXMA 3G7RA 3BR3A 1Z0XA 3VVYA 2WV1A 3KZ9A 4I76A 5K58A 2GUHA 3GZIA 2FQ4A 2R7SA 2FD5A 3PPBA 3DCFA 3VVXA 2QTQA 4XK4A 4PXIA 2WUIA 5IOYA 3BQZA 5AQCA 5CQGA 2RHAA 5D19A 2IU5A 3VW1A 2PBXA 4UDSA 5IPAA 4M3EA 4JL3A 4GCTA 5EYRA 5J1RA 2R7QA 3VPRA 3KYLA 4X1EA 1JUSA 3QPLA 2ZOYA 1RKWA 3VOKA 2YVXA 2R7OA 2XPVA 4B1RA 2QKOA 2W53A 3VOXA 3CJDA 3MNLA 3FRQA 2IBDA 5FKNA 4D5FA 5D1RA 2A2FX 5F04A 3O60A 4DVYP 3O8GA 2ZCXA 2UXPA 2OPTA 1UI5A 1U9NA 2XDNA 3C07A 3VW0A 3DU6A 3Q3SA 3HTAA 2UXHA 4G12A 3SFIA 2ZCMA 3BNIA 4C2MA 1ORKA 3ZQLA 4OD5A 2XGDA 4ACIA 4ICHA 2DG7A 2HXOA 2XB5A 3QKXA 5CXIA 2TCTA 3VTIA 1ZKGA 2G7SA 1Z77A 3PASA 2HQ5A 2QCOA 2HKUA 5FKOA 4D5CA 4AC6A 2G7LA 3LSRA 3KNWA 3NXCA 3ON4A 3LOCA 3O8HA 3JSJA 2NP3A 3G1LA 3F0CA 1JUMA 1JUPA 4HKUA 2X9DA 3SDGA 1JT6A 3QPSA 2XRLA 3BR5A 3TP3A 2RAEA 2B1EA 3CRJA
chains in the Genus database with same CATH topology
3BTIA 5HSZA 3BJBA 3WHCA 1T56A 2OF7A 1JT0A 3CDLA 3V6GA 2G0EA 1BJZA 5K7FA 3ZQHA 2QOPA 2ZCNA 3QBMA 2IEKA 2GBYA 3CWRA 1SGMA 4GCLA 5J3LA 2HYTA 4AF5A 3F1BA 3NRGA 3KKCA 4M3GA 3IH2A 1T33A 5IP6A 3G1OA 3MVPA 5J1UA 3G1MA 3BCGA 3KKDA 3BHQA 2DTZA 2NX4A 5F0HA 3P9TA 4W97A 2JK3A 2YVEA 3E7QA 3VW2A 4NN1A 2Y30A 4GFKA 3HTJA 2JJ7A 4B3AA 3FIWA 2O7OA 3AQTA 5CW8A 2REKA 3DPJA 5GPCA 4ABZA 1ZK8A 2G7GA 2HXIA 1VI0A 2IAIA 3VIBA 3VP5A 3B6CA 3HGYA 3BQYA 4JNNA 3DEWA 3C2BA 3COLA 3BTJA 1A6IA 2Y2ZA 5FHPA 4YZEA 3Q0WA 1U9OA 2XGEA 5F1JA 3BTLA 4KWAA 5EFYA 1QPIA 3Q0UA 2UXIA 5DAJA 5F0FA 3GEUA 2WGBA 5K7HA 3BR2A 5EZHA 5FMPA 2O7TA 2XPWA 2FJ1A 3BR6A 3WHBA 5EZGA 5IOZA 3VVZA 2I10A 3V78A 2ZOZA 2HYJA 3RH2A 4JYKA 3IH3A 2ID3A 4M3DA 3ANPA 2GFNA 5K7ZA 3NPIA 1JTYA 5HBUA 3NI7A 2DG8A 3IUVA 5GP9A 3LHQA 3HTHA 4AUXA 2XGCA 4MO7A 3ON2A 3T6NA 3S5RA 3RD3A 2G3BA 2GENA 2NS7A 5H9TA 5C4YA 5FKKA 3HE0A 2OERA 2VKVA 2QIBA 2NP5A 3HGGA 3ZQIA 3B81A 3NNRA 5CXGA 2ID6A 3LJLA 4V2FA 4DW6A 2X6OA 3CCYA 4D7MA 4M3BA 2YVHA 4L62A 4V2GA 2XPUA 2Q24A 2D6YA 1QVTA 3PM1A 3ZQFA 4ME9A 5F0CA 1RKTA 2UXUA 1QVUA 2ZB9A 2Y31A 5HAWA 2FX0A 5GPAA 5F27A 3EGQA 2VKEA 3G56A 3Q0VA 5F08A 2FBQA 4NELA 4D7NA 3HTIA 4AC0A 5J1YA 3BTCA 2V57A 4JKZA 1JTXA 2TRTA 4GFLA 2EH3A 3BT9A 3ZQGA 4M3FA 3ANGA 5FGLA 2RASA 5FKMA 3VUQA 4CGRA 1RPWA 1UI6A 4I6ZA 3EUPA 3LWJA 4W1UA 2NS8A 5FKLA 4GCKA 3AQSA 3TP0A 3LSJA 2VPRA 3HIMA 2F07A 2UXOA 2PZ9A 3IH4A 3LSPA 5D18A 3BR1A 3QQAA 2OI8A 3FK6A 4MK6A 3BRUA 3FK7A 3BR0A 2QWTA 3B6AA 4MXMA 3G7RA 3BR3A 1Z0XA 3VVYA 2WV1A 3KZ9A 4I76A 5K58A 2GUHA 3GZIA 2FQ4A 2FD5A 3PPBA 3DCFA 3VVXA 2QTQA 4XK4A 4PXIA 2WUIA 5IOYA 3BQZA 5AQCA 2RHAA 5D19A 2IU5A 3VW1A 2PBXA 4UDSA 5IPAA 4M3EA 4JL3A 4GCTA 5EYRA 5J1RA 3VPRA 4X1EA 1JUSA 3QPLA 2ZOYA 1RKWA 3VOKA 2XPVA 4B1RA 2QKOA 2W53A 3VOXA 3CJDA 3MNLA 3FRQA 2IBDA 5FKNA 4D5FA 5D1RA 5F04A 3O60A 3O8GA 2ZCXA 2UXPA 2OPTA 1UI5A 1U9NA 2XDNA 3C07A 3VW0A 3Q3SA 3HTAA 2UXHA 4G12A 3SFIA 2ZCMA 3BNIA 1ORKA 3ZQLA 2XGDA 4ACIA 4ICHA 2DG7A 2HXOA 2XB5A 3QKXA 5CXIA 2TCTA 1ZKGA 2G7SA 1Z77A 3PASA 2HQ5A 2QCOA 2HKUA 5FKOA 4D5CA 4AC6A 2G7LA 3LSRA 3KNWA 3NXCA 3ON4A 3LOCA 3O8HA 3JSJA 2NP3A 3G1LA 3F0CA 1JUMA 1JUPA 4HKUA 2X9DA 3SDGA 1JT6A 3QPSA 2XRLA 3BR5A 3TP3A 2RAEA 3CRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTI A;  5HSZ A;  3BJB A;  3WHC A;  1T56 A;  2OF7 A;  1JT0 A;  3CDL A;  3V6G A;  2G0E A;  1BJZ A;  5K7F A;  3ZQH A;  2QOP A;  2ZCN A;  3QBM A;  2IEK A;  2GBY A;  3CWR A;  1SGM A;  4GCL A;  5J3L A;  2HYT A;  4AF5 A;  3F1B A;  3NRG A;  3KKC A;  4M3G A;  3IH2 A;  1T33 A;  5IP6 A;  3G1O A;  3MVP A;  5J1U A;  3G1M A;  3BCG A;  3KKD A;  3BHQ A;  2DTZ A;  2NX4 A;  5F0H A;  3P9T A;  4W97 A;  2JK3 A;  2YVE A;  3E7Q A;  3VW2 A;  4NN1 A;  2Y30 A;  4GFK A;  3HTJ A;  2JJ7 A;  4B3A A;  3FIW A;  2O7O A;  3AQT A;  5CW8 A;  2REK A;  3DPJ A;  5GPC A;  4ABZ A;  1ZK8 A;  2G7G A;  2HXI A;  1VI0 A;  2IAI A;  3VIB A;  3VP5 A;  3B6C A;  3HGY A;  3BQY A;  4JNN A;  3DEW A;  3C2B A;  3COL A;  3BTJ A;  1A6I A;  2Y2Z A;  5FHP A;  4YZE A;  3Q0W A;  1U9O A;  2XGE A;  5F1J A;  3BTL A;  4KWA A;  5EFY A;  1QPI A;  3Q0U A;  2UXI A;  5DAJ A;  5F0F A;  3GEU A;  2WGB A;  5K7H A;  3BR2 A;  5EZH A;  5FMP A;  2O7T A;  2XPW A;  2FJ1 A;  3BR6 A;  3WHB A;  5EZG A;  5IOZ A;  3VVZ A;  2I10 A;  3V78 A;  2ZOZ A;  2HYJ A;  3RH2 A;  4JYK A;  3IH3 A;  2ID3 A;  4M3D A;  3ANP A;  2GFN A;  5K7Z A;  3NPI A;  1JTY A;  5HBU A;  3NI7 A;  2DG8 A;  3IUV A;  5GP9 A;  3LHQ A;  3HTH A;  4AUX A;  2XGC A;  4MO7 A;  3ON2 A;  3T6N A;  3S5R A;  3RD3 A;  2G3B A;  2GEN A;  2NS7 A;  5H9T A;  5C4Y A;  5FKK A;  3HE0 A;  2OER A;  2VKV A;  2QIB A;  2NP5 A;  3HGG A;  3ZQI A;  3B81 A;  3NNR A;  5CXG A;  2ID6 A;  3LJL A;  4V2F A;  4DW6 A;  2X6O A;  3CCY A;  4D7M A;  4M3B A;  2YVH A;  4L62 A;  4V2G A;  2XPU A;  2Q24 A;  2D6Y A;  1QVT A;  3PM1 A;  3ZQF A;  4ME9 A;  5F0C A;  1RKT A;  2UXU A;  1QVU A;  2ZB9 A;  2Y31 A;  5HAW A;  2FX0 A;  5GPA A;  5F27 A;  3EGQ A;  2VKE A;  3G56 A;  3Q0V A;  5F08 A;  2FBQ A;  4NEL A;  4D7N A;  3HTI A;  4AC0 A;  5J1Y A;  3BTC A;  2V57 A;  4JKZ A;  1JTX A;  2TRT A;  4GFL A;  2EH3 A;  3BT9 A;  3ZQG A;  4M3F A;  3ANG A;  5FGL A;  2RAS A;  5FKM A;  3VUQ A;  4CGR A;  1RPW A;  1UI6 A;  4I6Z A;  3EUP A;  3LWJ A;  4W1U A;  2NS8 A;  5FKL A;  4GCK A;  3AQS A;  3TP0 A;  3LSJ A;  2VPR A;  3HIM A;  2F07 A;  2UXO A;  2PZ9 A;  3IH4 A;  3LSP A;  5D18 A;  3BR1 A;  3QQA A;  2OI8 A;  3FK6 A;  4MK6 A;  3BRU A;  3FK7 A;  3BR0 A;  2QWT A;  3B6A A;  4MXM A;  3G7R A;  3BR3 A;  1Z0X A;  3VVY A;  2WV1 A;  3KZ9 A;  4I76 A;  5K58 A;  2GUH A;  3GZI A;  2FQ4 A;  2FD5 A;  3PPB A;  3DCF A;  3VVX A;  2QTQ A;  4XK4 A;  4PXI A;  2WUI A;  5IOY A;  3BQZ A;  5AQC A;  2RHA A;  5D19 A;  2IU5 A;  3VW1 A;  2PBX A;  4UDS A;  5IPA A;  4M3E A;  4JL3 A;  4GCT A;  5EYR A;  5J1R A;  3VPR A;  4X1E A;  1JUS A;  3QPL A;  2ZOY A;  1RKW A;  3VOK A;  2XPV A;  4B1R A;  2QKO A;  2W53 A;  3VOX A;  3CJD A;  3MNL A;  3FRQ A;  2IBD A;  5FKN A;  4D5F A;  5D1R A;  5F04 A;  3O60 A;  3O8G A;  2ZCX A;  2UXP A;  2OPT A;  1UI5 A;  1U9N A;  2XDN A;  3C07 A;  3VW0 A;  3Q3S A;  3HTA A;  2UXH A;  4G12 A;  3SFI A;  2ZCM A;  3BNI A;  1ORK A;  3ZQL A;  2XGD A;  4ACI A;  4ICH A;  2DG7 A;  2HXO A;  2XB5 A;  3QKX A;  5CXI A;  2TCT A;  1ZKG A;  2G7S A;  1Z77 A;  3PAS A;  2HQ5 A;  2QCO A;  2HKU A;  5FKO A;  4D5C A;  4AC6 A;  2G7L A;  3LSR A;  3KNW A;  3NXC A;  3ON4 A;  3LOC A;  3O8H A;  3JSJ A;  2NP3 A;  3G1L A;  3F0C A;  1JUM A;  1JUP A;  4HKU A;  2X9D A;  3SDG A;  1JT6 A;  3QPS A;  2XRL A;  3BR5 A;  3TP3 A;  2RAE A;  3CRJ A; 
#chains in the Genus database with same CATH topology
 3BTI A;  5HSZ A;  3BJB A;  3WHC A;  1T56 A;  2OF7 A;  1JT0 A;  3CDL A;  3V6G A;  2G0E A;  2PFV A;  1BJZ A;  5K7F A;  3ZQH A;  2QOP A;  2ZCN A;  3QBM A;  2IEK A;  2GBY A;  3NS4 A;  3CWR A;  1SGM A;  4GCL A;  5J3L A;  2HYT A;  4AF5 A;  3F1B A;  3NRG A;  3KKC A;  4M3G A;  2FJI 1;  2R7T A;  3IH2 A;  1T33 A;  5IP6 A;  3G1O A;  3MVP A;  5J1U A;  3G1M A;  3BCG A;  3KKD A;  3BHQ A;  2DTZ A;  2NX4 A;  5F0H A;  4IRV A;  3P9T A;  4W97 A;  2JK3 A;  2YVE A;  3E7Q A;  3VW2 A;  4NN1 A;  2Y30 A;  4GFK A;  3HTJ A;  2JJ7 A;  4B3A A;  3FIW A;  2O7O A;  3AQT A;  5CW8 A;  2REK A;  3DPJ A;  5GPC A;  4ABZ A;  1ZK8 A;  2G7G A;  2HXI A;  1VI0 A;  2IAI A;  3VIB A;  3VP5 A;  3B6C A;  3HGY A;  3BQY A;  4JNN A;  3DEW A;  3C2B A;  3COL A;  3BTJ A;  1A6I A;  2Y2Z A;  5FHP A;  4YZE A;  3Q0W A;  1U9O A;  3DU5 A;  2XGE A;  5F1J A;  3BTL A;  4KWA A;  5EFY A;  1QPI A;  3Q0U A;  2UXI A;  5DAJ A;  5F0F A;  3GEU A;  2WGB A;  5K7H A;  3BR2 A;  5EZH A;  4U9L A;  5FMP A;  2O7T A;  2R7W A;  2XPW A;  2FJ1 A;  3BR6 A;  3WHB A;  5EZG A;  5IOZ A;  3VVZ A;  2I10 A;  3V78 A;  2ZOZ A;  2HYJ A;  4OD4 A;  3RH2 A;  4JYK A;  3IH3 A;  2ID3 A;  4M3D A;  3ANP A;  2GFN A;  5K7Z A;  3NPI A;  3K8P C;  1JTY A;  5HBU A;  3NI7 A;  2DG8 A;  3IUV A;  5GP9 A;  3LHQ A;  3HTH A;  4AUX A;  2XGC A;  4MO7 A;  3ON2 A;  3T6N A;  3S5R A;  3RD3 A;  2G3B A;  2GEN A;  2NS7 A;  5H9T A;  5C4Y A;  5FKK A;  3HE0 A;  2OER A;  2VKV A;  2QIB A;  2NP5 A;  3HGG A;  3ZQI A;  3B81 A;  3NNR A;  5CXG A;  2ID6 A;  3LJL A;  4V2F A;  3FHN A;  4DW6 A;  2X6O A;  3CCY A;  4U9N A;  4D7M A;  4M3B A;  2YVH A;  4L62 A;  4V2G A;  2XPU A;  2Q24 A;  2D6Y A;  1QVT A;  3PM1 A;  3ZQF A;  4ME9 A;  5F0C A;  2R7X A;  1RKT A;  2UXU A;  1QVU A;  2ZY9 A;  2ZB9 A;  2Y31 A;  5HAW A;  2FX0 A;  5GPA A;  5F27 A;  3EGQ A;  2VKE A;  3G56 A;  3Q0V A;  5F08 A;  3SWH A;  2FBQ A;  4NEL A;  4D7N A;  3HTI A;  4AC0 A;  5J1Y A;  3BTC A;  2V57 A;  4JKZ A;  1JTX A;  2TRT A;  4GFL A;  2EH3 A;  4WIB A;  3BT9 A;  3ZQG A;  4M3F A;  3ANG A;  5FGL A;  2RAS A;  5FKM A;  2B3W A;  3VUQ A;  4CGR A;  1RPW A;  1UI6 A;  4I6Z A;  3EUP A;  2R7U A;  3LWJ A;  4W1U A;  2NS8 A;  5FKL A;  4GCK A;  3AQS A;  3TP0 A;  3LSJ A;  2VPR A;  3HIM A;  2F07 A;  2UXO A;  2PZ9 A;  3IH4 A;  3LSP A;  5D18 A;  3BR1 A;  3QQA A;  2OI8 A;  3FK6 A;  4MK6 A;  3BRU A;  3FK7 A;  2R7R A;  3BR0 A;  2QWT A;  2R7V A;  3B6A A;  4MXM A;  3G7R A;  3BR3 A;  1Z0X A;  3VVY A;  2WV1 A;  3KZ9 A;  4I76 A;  5K58 A;  2GUH A;  3GZI A;  2FQ4 A;  2R7S A;  2FD5 A;  3PPB A;  3DCF A;  3VVX A;  2QTQ A;  4XK4 A;  4PXI A;  2WUI A;  5IOY A;  3BQZ A;  5AQC A;  5CQG A;  2RHA A;  5D19 A;  2IU5 A;  3VW1 A;  2PBX A;  4UDS A;  5IPA A;  4M3E A;  4JL3 A;  4GCT A;  5EYR A;  5J1R A;  2R7Q A;  3VPR A;  3KYL A;  4X1E A;  1JUS A;  3QPL A;  2ZOY A;  1RKW A;  3VOK A;  2YVX A;  2R7O A;  2XPV A;  4B1R A;  2QKO A;  2W53 A;  3VOX A;  3CJD A;  3MNL A;  3FRQ A;  2IBD A;  5FKN A;  4D5F A;  5D1R A;  2A2F X;  5F04 A;  3O60 A;  4DVY P;  3O8G A;  2ZCX A;  2UXP A;  2OPT A;  1UI5 A;  1U9N A;  2XDN A;  3C07 A;  3VW0 A;  3DU6 A;  3Q3S A;  3HTA A;  2UXH A;  4G12 A;  3SFI A;  2ZCM A;  3BNI A;  4C2M A;  1ORK A;  3ZQL A;  4OD5 A;  2XGD A;  4ACI A;  4ICH A;  2DG7 A;  2HXO A;  2XB5 A;  3QKX A;  5CXI A;  2TCT A;  3VTI A;  1ZKG A;  2G7S A;  1Z77 A;  3PAS A;  2HQ5 A;  2QCO A;  2HKU A;  5FKO A;  4D5C A;  4AC6 A;  2G7L A;  3LSR A;  3KNW A;  3NXC A;  3ON4 A;  3LOC A;  3O8H A;  3JSJ A;  2NP3 A;  3G1L A;  3F0C A;  1JUM A;  1JUP A;  4HKU A;  2X9D A;  3SDG A;  1JT6 A;  3QPS A;  2XRL A;  3BR5 A;  3TP3 A;  2RAE A;  2B1E A;  3CRJ A; 
#chains in the Genus database with same CATH homology
 3BTI A;  5HSZ A;  3BJB A;  3WHC A;  1T56 A;  2OF7 A;  1JT0 A;  3CDL A;  3V6G A;  2G0E A;  1BJZ A;  5K7F A;  3ZQH A;  2QOP A;  2ZCN A;  3QBM A;  2IEK A;  2GBY A;  3CWR A;  1SGM A;  4GCL A;  5J3L A;  2HYT A;  4AF5 A;  3F1B A;  3NRG A;  3KKC A;  4M3G A;  3IH2 A;  1T33 A;  5IP6 A;  3G1O A;  3MVP A;  5J1U A;  3G1M A;  3BCG A;  3KKD A;  3BHQ A;  2DTZ A;  2NX4 A;  5F0H A;  3P9T A;  4W97 A;  2JK3 A;  2YVE A;  3E7Q A;  3VW2 A;  4NN1 A;  2Y30 A;  4GFK A;  3HTJ A;  2JJ7 A;  4B3A A;  3FIW A;  2O7O A;  3AQT A;  5CW8 A;  2REK A;  3DPJ A;  5GPC A;  4ABZ A;  1ZK8 A;  2G7G A;  2HXI A;  1VI0 A;  2IAI A;  3VIB A;  3VP5 A;  3B6C A;  3HGY A;  3BQY A;  4JNN A;  3DEW A;  3C2B A;  3COL A;  3BTJ A;  1A6I A;  2Y2Z A;  5FHP A;  4YZE A;  3Q0W A;  1U9O A;  2XGE A;  5F1J A;  3BTL A;  4KWA A;  5EFY A;  1QPI A;  3Q0U A;  2UXI A;  5DAJ A;  5F0F A;  3GEU A;  2WGB A;  5K7H A;  3BR2 A;  5EZH A;  5FMP A;  2O7T A;  2XPW A;  2FJ1 A;  3BR6 A;  3WHB A;  5EZG A;  5IOZ A;  3VVZ A;  2I10 A;  3V78 A;  2ZOZ A;  2HYJ A;  3RH2 A;  4JYK A;  3IH3 A;  2ID3 A;  4M3D A;  3ANP A;  2GFN A;  5K7Z A;  3NPI A;  1JTY A;  5HBU A;  3NI7 A;  2DG8 A;  3IUV A;  5GP9 A;  3LHQ A;  3HTH A;  4AUX A;  2XGC A;  4MO7 A;  3ON2 A;  3T6N A;  3S5R A;  3RD3 A;  2G3B A;  2GEN A;  2NS7 A;  5H9T A;  5C4Y A;  5FKK A;  3HE0 A;  2OER A;  2VKV A;  2QIB A;  2NP5 A;  3HGG A;  3ZQI A;  3B81 A;  3NNR A;  5CXG A;  2ID6 A;  3LJL A;  4V2F A;  4DW6 A;  2X6O A;  3CCY A;  4D7M A;  4M3B A;  2YVH A;  4L62 A;  4V2G A;  2XPU A;  2Q24 A;  2D6Y A;  1QVT A;  3PM1 A;  3ZQF A;  4ME9 A;  5F0C A;  1RKT A;  2UXU A;  1QVU A;  2ZB9 A;  2Y31 A;  5HAW A;  2FX0 A;  5GPA A;  5F27 A;  3EGQ A;  2VKE A;  3G56 A;  3Q0V A;  5F08 A;  2FBQ A;  4NEL A;  4D7N A;  3HTI A;  4AC0 A;  5J1Y A;  3BTC A;  2V57 A;  4JKZ A;  1JTX A;  2TRT A;  4GFL A;  2EH3 A;  3BT9 A;  3ZQG A;  4M3F A;  3ANG A;  5FGL A;  2RAS A;  5FKM A;  3VUQ A;  4CGR A;  1RPW A;  1UI6 A;  4I6Z A;  3EUP A;  3LWJ A;  4W1U A;  2NS8 A;  5FKL A;  4GCK A;  3AQS A;  3TP0 A;  3LSJ A;  2VPR A;  3HIM A;  2F07 A;  2UXO A;  2PZ9 A;  3IH4 A;  3LSP A;  5D18 A;  3BR1 A;  3QQA A;  2OI8 A;  3FK6 A;  4MK6 A;  3BRU A;  3FK7 A;  3BR0 A;  2QWT A;  3B6A A;  4MXM A;  3G7R A;  3BR3 A;  1Z0X A;  3VVY A;  2WV1 A;  3KZ9 A;  4I76 A;  5K58 A;  2GUH A;  3GZI A;  2FQ4 A;  2FD5 A;  3PPB A;  3DCF A;  3VVX A;  2QTQ A;  4XK4 A;  4PXI A;  2WUI A;  5IOY A;  3BQZ A;  5AQC A;  2RHA A;  5D19 A;  2IU5 A;  3VW1 A;  2PBX A;  4UDS A;  5IPA A;  4M3E A;  4JL3 A;  4GCT A;  5EYR A;  5J1R A;  3VPR A;  4X1E A;  1JUS A;  3QPL A;  2ZOY A;  1RKW A;  3VOK A;  2XPV A;  4B1R A;  2QKO A;  2W53 A;  3VOX A;  3CJD A;  3MNL A;  3FRQ A;  2IBD A;  5FKN A;  4D5F A;  5D1R A;  5F04 A;  3O60 A;  3O8G A;  2ZCX A;  2UXP A;  2OPT A;  1UI5 A;  1U9N A;  2XDN A;  3C07 A;  3VW0 A;  3Q3S A;  3HTA A;  2UXH A;  4G12 A;  3SFI A;  2ZCM A;  3BNI A;  1ORK A;  3ZQL A;  2XGD A;  4ACI A;  4ICH A;  2DG7 A;  2HXO A;  2XB5 A;  3QKX A;  5CXI A;  2TCT A;  1ZKG A;  2G7S A;  1Z77 A;  3PAS A;  2HQ5 A;  2QCO A;  2HKU A;  5FKO A;  4D5C A;  4AC6 A;  2G7L A;  3LSR A;  3KNW A;  3NXC A;  3ON4 A;  3LOC A;  3O8H A;  3JSJ A;  2NP3 A;  3G1L A;  3F0C A;  1JUM A;  1JUP A;  4HKU A;  2X9D A;  3SDG A;  1JT6 A;  3QPS A;  2XRL A;  3BR5 A;  3TP3 A;  2RAE A;  3CRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...