2REKA

Crystal structure of tetr-family transcriptional regulator
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
181
structure length
172
Chain Sequence
b'ADARRNYDRIIEAAAAEVARHGADASLEEIARRAGVGSATLHRHFPSRWGLLQAVFQERVAQLCDEARSLAAEHPPATALTRWLTSLAVFGAVTRGAARSLAALDSRCEQLLTEAGADLLARAQEDGTVRDDVTALELLSLANAVSLAAEHTPDAAHHATRLMGIALGGLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR-family transcriptional regulator
molecule tags Transcription
source organism Streptomyces coelicolor a3(2)
publication title Crystal structure of tetR-family transcriptional regulator.
rcsb
total genus 70
structure length 172
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2rekA00
3BTLA 5FHPA 3VOKA 5CW8A 2I10A 3Q0UA 4NN1A 4NELA 3LJLA 4ACIA 2G3BA 2QWTA 2XDNA 1RPWA 2WV1A 4AF5A 5HSZA 2OI8A 3BTIA 2ZCXA 3TP0A 4JNNA 3NRGA 2F07A 2NX4A 2O7TA 5K7HA 2G7LA 3KKCA 2JJ7A 3SFIA 3V78A 3AQTA 3BNIA 2RAEA 3ANGA 3BHQA 1QVUA 2RASA 3B81A 3LOCA 5D18A 3G1LA 3O8GA 2GBYA 3BTCA 2HXIA 2WUIA 3BR6A 3NI7A 3BQZA 3BJBA 2HYTA 3IH4A 5H9TA 1U9OA 1JT6A 3E7QA 2OF7A 2UXOA 4D7MA 2FBQA 4AC0A 3IUVA 4I76A 3BR3A 3RD3A 3B6AA 2DTZA 2ZOZA 5C4YA 2O7OA 4YZEA 2YVHA 4MO7A 4KWAA 1SGMA 5IOYA 4GCKA 3C07A 3QKXA 1ZKGA 2X9DA 1RKWA 1UI6A 2PZ9A 4M3GA 3G7RA 4D5FA 2QCOA 5F27A 3Q0VA 3G56A 5HAWA 5FMPA 3ZQLA 4HKUA 2NP5A 1A6IA 1Z77A 3CCYA 1JUMA 5IPAA 1JT0A 3FIWA 1JTYA 3FK7A 4I6ZA 2OERA 2Q24A 3BTJA 2OPTA 2XGCA 4AC6A 2IEKA 1JUSA 2DG7A 4M3EA 2XGEA 3F1BA 5K7FA 5EZGA 3BR5A 4D7NA 3O60A 3HE0A 3FRQA 3BRUA 5FKMA 3BCGA 2XPVA 5J3LA 3RH2A 4JL3A 1JUPA 3HTHA 4PXIA 3ZQFA 3QQAA 3B6CA 3DCFA 3QBMA 5FKOA 2NP3A 2ID6A 3EGQA 2RHAA 3BR1A 3IH2A 2G0EA 2PBXA 5FKNA 5DAJA 2VPRA 4X1EA 2QTQA 3HTJA 3VUQA 4DW6A 3LSPA 3HGYA 3ZQGA 2ZCNA 4GFLA 2UXHA 2Y2ZA 3BR2A 1T33A 2HYJA 3C2BA 3HGGA 2Y31A 3KZ9A 4V2FA 2W53A 3O8HA 2UXIA 3KNWA 3TP3A 3VVZA 5FKLA 5CXGA 1BJZA 3QPLA 3G1OA 5J1RA 2DG8A 2XGDA 3VVYA 2IBDA 2XRLA 4B3AA 2UXPA 3IH3A 3HIMA 5EFYA 2QKOA 3VP5A 2ZCMA 5K58A 5K7ZA 5F0FA 2FQ4A 3GZIA 5J1UA 3NPIA 3LSJA 4MK6A 4M3BA 2WGBA 2HQ5A 5F0CA 3BQYA 2XB5A 4ABZA 2EH3A 5AQCA 4GCLA 1QPIA 2G7SA 3MNLA 3CRJA 4UDSA 3ZQIA 2REKA 2X6OA 4B1RA 3EUPA 2YVEA 3P9TA 3Q0WA 5D1RA 5GPAA 2FJ1A 2GFNA 5GP9A 4MXMA 3S5RA 3WHCA 3MVPA 2IAIA 3BT9A 4CGRA 3LHQA 4W97A 2Y30A 2JK3A 1ORKA 2ID3A 3VPRA 1T56A 3NNRA 3G1MA 5F04A 1VI0A 3BR0A 2HXOA 3FK6A 2NS8A 3JSJA 4M3FA 2QOPA 5EYRA 2QIBA 5IOZA 3NXCA 3VVXA 4JKZA 3HTAA 3VW0A 2GENA 5F1JA 5HBUA 4G12A 1QVTA 3LSRA 2XPWA 3COLA 3QPSA 5D19A 3T6NA 4D5CA 5J1YA 3LWJA 3Q3SA 3VW1A 1ZK8A 3DEWA 2HKUA 3SDGA 5F08A 2TRTA 2FX0A 3CJDA 2ZOYA 4W1UA 2G7GA 4ICHA 4JYKA 4AUXA 2ZB9A 5CXIA 3PASA 5IP6A 3AQSA 3CWRA 3CDLA 1JTXA 3ANPA 3VIBA 3DPJA 4XK4A 5FGLA 2GUHA 3ON2A 3PPBA 5GPCA 2V57A 4L62A 3ON4A 4GFKA 3GEUA 3V6GA 1RKTA 4GCTA 3VW2A 5F0HA 2NS7A 5EZHA 1UI5A 3VOXA 2UXUA 2TCTA 3PM1A 1Z0XA 3ZQHA 3KKDA 2D6YA 5FKKA 2FD5A 1U9NA 3WHBA 4M3DA 4V2GA 2VKVA 4ME9A 2VKEA 3F0CA 2IU5A 2XPUA 3HTIA
chains in the Genus database with same CATH superfamily
2B3WA 3BTLA 5FHPA 3VOKA 5CW8A 2I10A 3Q0UA 4NN1A 4NELA 3LJLA 4ACIA 2G3BA 2QWTA 2XDNA 1RPWA 2WV1A 4AF5A 5HSZA 2OI8A 3BTIA 2ZCXA 3TP0A 4JNNA 3NRGA 2F07A 2NX4A 2O7TA 5K7HA 2G7LA 3KKCA 2JJ7A 3SFIA 3V78A 3AQTA 3BNIA 2RAEA 3DU6A 3ANGA 3BHQA 1QVUA 2RASA 3B81A 2PFVA 3LOCA 5D18A 3G1LA 3O8GA 2R7TA 2GBYA 3BTCA 2HXIA 2WUIA 3BR6A 3NI7A 4C2MA 3BQZA 3BJBA 2HYTA 3IH4A 5H9TA 1U9OA 1JT6A 3E7QA 2OF7A 2UXOA 4D7MA 2FBQA 4AC0A 3IUVA 4I76A 3BR3A 3RD3A 3B6AA 2DTZA 2ZOZA 5C4YA 2O7OA 4YZEA 2YVHA 4MO7A 4KWAA 4OD5A 4U9LA 1SGMA 5IOYA 4GCKA 3C07A 3QKXA 1ZKGA 3KYLA 3SWHA 2X9DA 1RKWA 1UI6A 2PZ9A 4M3GA 3G7RA 4D5FA 2QCOA 5F27A 3Q0VA 4WIBA 3G56A 5HAWA 5FMPA 3ZQLA 4HKUA 2R7RA 2NP5A 1A6IA 1Z77A 3CCYA 1JUMA 5IPAA 1JT0A 3FIWA 1JTYA 3FK7A 4I6ZA 2OERA 2R7OA 2Q24A 3BTJA 2OPTA 2XGCA 4AC6A 2IEKA 1JUSA 2DG7A 4M3EA 2XGEA 3F1BA 2R7SA 5K7FA 5EZGA 3BR5A 4D7NA 3O60A 3HE0A 3FRQA 3BRUA 2A2FX 5FKMA 3BCGA 4IRVA 2XPVA 5J3LA 3RH2A 4JL3A 1JUPA 3HTHA 4PXIA 3ZQFA 3QQAA 3B6CA 3DCFA 3QBMA 5FKOA 2NP3A 2ID6A 3EGQA 2RHAA 3BR1A 3IH2A 2G0EA 2PBXA 5FKNA 5DAJA 2VPRA 4X1EA 2QTQA 3HTJA 3VUQA 4DW6A 3LSPA 3HGYA 3ZQGA 2ZCNA 4GFLA 2UXHA 2Y2ZA 3BR2A 1T33A 2HYJA 3C2BA 3HGGA 2Y31A 3KZ9A 4V2FA 2W53A 3VTIA 3O8HA 2UXIA 3KNWA 3TP3A 3VVZA 5FKLA 5CXGA 1BJZA 3QPLA 3G1OA 5J1RA 2DG8A 2XGDA 3VVYA 2IBDA 2XRLA 4B3AA 2ZY9A 2UXPA 3IH3A 3HIMA 2FJI1 5EFYA 2QKOA 3VP5A 2ZCMA 5K58A 5K7ZA 5F0FA 2FQ4A 3GZIA 5J1UA 3NPIA 3LSJA 4MK6A 4M3BA 2WGBA 2HQ5A 5F0CA 3BQYA 2XB5A 4ABZA 2EH3A 5AQCA 4GCLA 1QPIA 2G7SA 3MNLA 3CRJA 4UDSA 3ZQIA 2REKA 2X6OA 4B1RA 3EUPA 2YVEA 3P9TA 3Q0WA 5D1RA 5GPAA 2FJ1A 2GFNA 5GP9A 2R7WA 4MXMA 3WHCA 3S5RA 2B1EA 3MVPA 2IAIA 3BT9A 4CGRA 3LHQA 4W97A 2Y30A 2JK3A 1ORKA 2R7VA 2ID3A 3VPRA 1T56A 4DVYP 3NNRA 3G1MA 5F04A 1VI0A 3BR0A 3NS4A 2HXOA 3FK6A 2NS8A 3JSJA 4M3FA 2QOPA 5EYRA 2QIBA 5IOZA 3NXCA 2R7UA 3VVXA 2R7QA 4JKZA 3HTAA 3VW0A 2GENA 5F1JA 5HBUA 4G12A 1QVTA 3LSRA 2XPWA 3COLA 3FHNA 3QPSA 3K8PC 5D19A 3T6NA 4D5CA 5J1YA 3LWJA 3Q3SA 3VW1A 1ZK8A 3DEWA 2HKUA 3SDGA 5F08A 2TRTA 2FX0A 3CJDA 2ZOYA 4W1UA 2G7GA 4ICHA 4JYKA 4AUXA 2ZB9A 5CXIA 3PASA 5IP6A 3AQSA 3CWRA 2YVXA 3CDLA 1JTXA 3ANPA 3VIBA 3DPJA 4XK4A 5FGLA 2GUHA 3ON2A 3PPBA 5GPCA 2V57A 4L62A 4U9NA 4OD4A 3ON4A 4GFKA 3GEUA 3V6GA 1RKTA 4GCTA 3VW2A 5F0HA 2NS7A 5EZHA 1UI5A 3VOXA 2UXUA 2TCTA 3PM1A 1Z0XA 3ZQHA 2R7XA 3KKDA 2D6YA 5FKKA 2FD5A 5CQGA 1U9NA 3WHBA 4M3DA 4V2GA 2VKVA 3DU5A 4ME9A 2VKEA 3F0CA 2IU5A 2XPUA 3HTIA
chains in the Genus database with same CATH topology
3BTLA 5FHPA 3VOKA 5CW8A 2I10A 3Q0UA 4NN1A 4NELA 3LJLA 4ACIA 2G3BA 2QWTA 2XDNA 1RPWA 2WV1A 4AF5A 5HSZA 2OI8A 3BTIA 2ZCXA 3TP0A 4JNNA 3NRGA 2F07A 2NX4A 2O7TA 5K7HA 2G7LA 3KKCA 2JJ7A 3SFIA 3V78A 3AQTA 3BNIA 2RAEA 3ANGA 3BHQA 1QVUA 2RASA 3B81A 3LOCA 5D18A 3G1LA 3O8GA 2GBYA 3BTCA 2HXIA 2WUIA 3BR6A 3NI7A 3BQZA 3BJBA 2HYTA 3IH4A 5H9TA 1U9OA 1JT6A 3E7QA 2OF7A 2UXOA 4D7MA 2FBQA 4AC0A 3IUVA 4I76A 3BR3A 3RD3A 3B6AA 2DTZA 2ZOZA 5C4YA 2O7OA 4YZEA 2YVHA 4MO7A 4KWAA 1SGMA 5IOYA 4GCKA 3C07A 3QKXA 1ZKGA 2X9DA 1RKWA 1UI6A 2PZ9A 4M3GA 3G7RA 4D5FA 2QCOA 5F27A 3Q0VA 3G56A 5HAWA 5FMPA 3ZQLA 4HKUA 2NP5A 1A6IA 1Z77A 3CCYA 1JUMA 5IPAA 1JT0A 3FIWA 1JTYA 3FK7A 4I6ZA 2OERA 2Q24A 3BTJA 2OPTA 2XGCA 4AC6A 2IEKA 1JUSA 2DG7A 4M3EA 2XGEA 3F1BA 5K7FA 5EZGA 3BR5A 4D7NA 3O60A 3HE0A 3FRQA 3BRUA 5FKMA 3BCGA 2XPVA 5J3LA 3RH2A 4JL3A 1JUPA 3HTHA 4PXIA 3ZQFA 3QQAA 3B6CA 3DCFA 3QBMA 5FKOA 2NP3A 2ID6A 3EGQA 2RHAA 3BR1A 3IH2A 2G0EA 2PBXA 5FKNA 5DAJA 2VPRA 4X1EA 2QTQA 3HTJA 3VUQA 4DW6A 3LSPA 3HGYA 3ZQGA 2ZCNA 4GFLA 2UXHA 2Y2ZA 3BR2A 1T33A 2HYJA 3C2BA 3HGGA 2Y31A 3KZ9A 4V2FA 2W53A 3O8HA 2UXIA 3KNWA 3TP3A 3VVZA 5FKLA 5CXGA 1BJZA 3QPLA 3G1OA 5J1RA 2DG8A 2XGDA 3VVYA 2IBDA 2XRLA 4B3AA 2UXPA 3IH3A 3HIMA 5EFYA 2QKOA 3VP5A 2ZCMA 5K58A 5K7ZA 5F0FA 2FQ4A 3GZIA 5J1UA 3NPIA 3LSJA 4MK6A 4M3BA 2WGBA 2HQ5A 5F0CA 3BQYA 2XB5A 4ABZA 2EH3A 5AQCA 4GCLA 1QPIA 2G7SA 3MNLA 3CRJA 4UDSA 3ZQIA 2REKA 2X6OA 4B1RA 3EUPA 2YVEA 3P9TA 3Q0WA 5D1RA 5GPAA 2FJ1A 2GFNA 5GP9A 4MXMA 3S5RA 3WHCA 3MVPA 2IAIA 3BT9A 4CGRA 3LHQA 4W97A 2Y30A 2JK3A 1ORKA 2ID3A 3VPRA 1T56A 3NNRA 3G1MA 5F04A 1VI0A 3BR0A 2HXOA 3FK6A 2NS8A 3JSJA 4M3FA 2QOPA 5EYRA 2QIBA 5IOZA 3NXCA 3VVXA 4JKZA 3HTAA 3VW0A 2GENA 5F1JA 5HBUA 4G12A 1QVTA 3LSRA 2XPWA 3COLA 3QPSA 5D19A 3T6NA 4D5CA 5J1YA 3LWJA 3Q3SA 3VW1A 1ZK8A 3DEWA 2HKUA 3SDGA 5F08A 2TRTA 2FX0A 3CJDA 2ZOYA 4W1UA 2G7GA 4ICHA 4JYKA 4AUXA 2ZB9A 5CXIA 3PASA 5IP6A 3AQSA 3CWRA 3CDLA 1JTXA 3ANPA 3VIBA 3DPJA 4XK4A 5FGLA 2GUHA 3ON2A 3PPBA 5GPCA 2V57A 4L62A 3ON4A 4GFKA 3GEUA 3V6GA 1RKTA 4GCTA 3VW2A 5F0HA 2NS7A 5EZHA 1UI5A 3VOXA 2UXUA 2TCTA 3PM1A 1Z0XA 3ZQHA 3KKDA 2D6YA 5FKKA 2FD5A 1U9NA 3WHBA 4M3DA 4V2GA 2VKVA 4ME9A 2VKEA 3F0CA 2IU5A 2XPUA 3HTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTL A;  5FHP A;  3VOK A;  5CW8 A;  2I10 A;  3Q0U A;  4NN1 A;  4NEL A;  3LJL A;  4ACI A;  2G3B A;  2QWT A;  2XDN A;  1RPW A;  2WV1 A;  4AF5 A;  5HSZ A;  2OI8 A;  3BTI A;  2ZCX A;  3TP0 A;  4JNN A;  3NRG A;  2F07 A;  2NX4 A;  2O7T A;  5K7H A;  2G7L A;  3KKC A;  2JJ7 A;  3SFI A;  3V78 A;  3AQT A;  3BNI A;  2RAE A;  3ANG A;  3BHQ A;  1QVU A;  2RAS A;  3B81 A;  3LOC A;  5D18 A;  3G1L A;  3O8G A;  2GBY A;  3BTC A;  2HXI A;  2WUI A;  3BR6 A;  3NI7 A;  3BQZ A;  3BJB A;  2HYT A;  3IH4 A;  5H9T A;  1U9O A;  1JT6 A;  3E7Q A;  2OF7 A;  2UXO A;  4D7M A;  2FBQ A;  4AC0 A;  3IUV A;  4I76 A;  3BR3 A;  3RD3 A;  3B6A A;  2DTZ A;  2ZOZ A;  5C4Y A;  2O7O A;  4YZE A;  2YVH A;  4MO7 A;  4KWA A;  1SGM A;  5IOY A;  4GCK A;  3C07 A;  3QKX A;  1ZKG A;  2X9D A;  1RKW A;  1UI6 A;  2PZ9 A;  4M3G A;  3G7R A;  4D5F A;  2QCO A;  5F27 A;  3Q0V A;  3G56 A;  5HAW A;  5FMP A;  3ZQL A;  4HKU A;  2NP5 A;  1A6I A;  1Z77 A;  3CCY A;  1JUM A;  5IPA A;  1JT0 A;  3FIW A;  1JTY A;  3FK7 A;  4I6Z A;  2OER A;  2Q24 A;  3BTJ A;  2OPT A;  2XGC A;  4AC6 A;  2IEK A;  1JUS A;  2DG7 A;  4M3E A;  2XGE A;  3F1B A;  5K7F A;  5EZG A;  3BR5 A;  4D7N A;  3O60 A;  3HE0 A;  3FRQ A;  3BRU A;  5FKM A;  3BCG A;  2XPV A;  5J3L A;  3RH2 A;  4JL3 A;  1JUP A;  3HTH A;  4PXI A;  3ZQF A;  3QQA A;  3B6C A;  3DCF A;  3QBM A;  5FKO A;  2NP3 A;  2ID6 A;  3EGQ A;  2RHA A;  3BR1 A;  3IH2 A;  2G0E A;  2PBX A;  5FKN A;  5DAJ A;  2VPR A;  4X1E A;  2QTQ A;  3HTJ A;  3VUQ A;  4DW6 A;  3LSP A;  3HGY A;  3ZQG A;  2ZCN A;  4GFL A;  2UXH A;  2Y2Z A;  3BR2 A;  1T33 A;  2HYJ A;  3C2B A;  3HGG A;  2Y31 A;  3KZ9 A;  4V2F A;  2W53 A;  3O8H A;  2UXI A;  3KNW A;  3TP3 A;  3VVZ A;  5FKL A;  5CXG A;  1BJZ A;  3QPL A;  3G1O A;  5J1R A;  2DG8 A;  2XGD A;  3VVY A;  2IBD A;  2XRL A;  4B3A A;  2UXP A;  3IH3 A;  3HIM A;  5EFY A;  2QKO A;  3VP5 A;  2ZCM A;  5K58 A;  5K7Z A;  5F0F A;  2FQ4 A;  3GZI A;  5J1U A;  3NPI A;  3LSJ A;  4MK6 A;  4M3B A;  2WGB A;  2HQ5 A;  5F0C A;  3BQY A;  2XB5 A;  4ABZ A;  2EH3 A;  5AQC A;  4GCL A;  1QPI A;  2G7S A;  3MNL A;  3CRJ A;  4UDS A;  3ZQI A;  2REK A;  2X6O A;  4B1R A;  3EUP A;  2YVE A;  3P9T A;  3Q0W A;  5D1R A;  5GPA A;  2FJ1 A;  2GFN A;  5GP9 A;  4MXM A;  3S5R A;  3WHC A;  3MVP A;  2IAI A;  3BT9 A;  4CGR A;  3LHQ A;  4W97 A;  2Y30 A;  2JK3 A;  1ORK A;  2ID3 A;  3VPR A;  1T56 A;  3NNR A;  3G1M A;  5F04 A;  1VI0 A;  3BR0 A;  2HXO A;  3FK6 A;  2NS8 A;  3JSJ A;  4M3F A;  2QOP A;  5EYR A;  2QIB A;  5IOZ A;  3NXC A;  3VVX A;  4JKZ A;  3HTA A;  3VW0 A;  2GEN A;  5F1J A;  5HBU A;  4G12 A;  1QVT A;  3LSR A;  2XPW A;  3COL A;  3QPS A;  5D19 A;  3T6N A;  4D5C A;  5J1Y A;  3LWJ A;  3Q3S A;  3VW1 A;  1ZK8 A;  3DEW A;  2HKU A;  3SDG A;  5F08 A;  2TRT A;  2FX0 A;  3CJD A;  2ZOY A;  4W1U A;  2G7G A;  4ICH A;  4JYK A;  4AUX A;  2ZB9 A;  5CXI A;  3PAS A;  5IP6 A;  3AQS A;  3CWR A;  3CDL A;  1JTX A;  3ANP A;  3VIB A;  3DPJ A;  4XK4 A;  5FGL A;  2GUH A;  3ON2 A;  3PPB A;  5GPC A;  2V57 A;  4L62 A;  3ON4 A;  4GFK A;  3GEU A;  3V6G A;  1RKT A;  4GCT A;  3VW2 A;  5F0H A;  2NS7 A;  5EZH A;  1UI5 A;  3VOX A;  2UXU A;  2TCT A;  3PM1 A;  1Z0X A;  3ZQH A;  3KKD A;  2D6Y A;  5FKK A;  2FD5 A;  1U9N A;  3WHB A;  4M3D A;  4V2G A;  2VKV A;  4ME9 A;  2VKE A;  3F0C A;  2IU5 A;  2XPU A;  3HTI A; 
#chains in the Genus database with same CATH topology
 2B3W A;  3BTL A;  5FHP A;  3VOK A;  5CW8 A;  2I10 A;  3Q0U A;  4NN1 A;  4NEL A;  3LJL A;  4ACI A;  2G3B A;  2QWT A;  2XDN A;  1RPW A;  2WV1 A;  4AF5 A;  5HSZ A;  2OI8 A;  3BTI A;  2ZCX A;  3TP0 A;  4JNN A;  3NRG A;  2F07 A;  2NX4 A;  2O7T A;  5K7H A;  2G7L A;  3KKC A;  2JJ7 A;  3SFI A;  3V78 A;  3AQT A;  3BNI A;  2RAE A;  3DU6 A;  3ANG A;  3BHQ A;  1QVU A;  2RAS A;  3B81 A;  2PFV A;  3LOC A;  5D18 A;  3G1L A;  3O8G A;  2R7T A;  2GBY A;  3BTC A;  2HXI A;  2WUI A;  3BR6 A;  3NI7 A;  4C2M A;  3BQZ A;  3BJB A;  2HYT A;  3IH4 A;  5H9T A;  1U9O A;  1JT6 A;  3E7Q A;  2OF7 A;  2UXO A;  4D7M A;  2FBQ A;  4AC0 A;  3IUV A;  4I76 A;  3BR3 A;  3RD3 A;  3B6A A;  2DTZ A;  2ZOZ A;  5C4Y A;  2O7O A;  4YZE A;  2YVH A;  4MO7 A;  4KWA A;  4OD5 A;  4U9L A;  1SGM A;  5IOY A;  4GCK A;  3C07 A;  3QKX A;  1ZKG A;  3KYL A;  3SWH A;  2X9D A;  1RKW A;  1UI6 A;  2PZ9 A;  4M3G A;  3G7R A;  4D5F A;  2QCO A;  5F27 A;  3Q0V A;  4WIB A;  3G56 A;  5HAW A;  5FMP A;  3ZQL A;  4HKU A;  2R7R A;  2NP5 A;  1A6I A;  1Z77 A;  3CCY A;  1JUM A;  5IPA A;  1JT0 A;  3FIW A;  1JTY A;  3FK7 A;  4I6Z A;  2OER A;  2R7O A;  2Q24 A;  3BTJ A;  2OPT A;  2XGC A;  4AC6 A;  2IEK A;  1JUS A;  2DG7 A;  4M3E A;  2XGE A;  3F1B A;  2R7S A;  5K7F A;  5EZG A;  3BR5 A;  4D7N A;  3O60 A;  3HE0 A;  3FRQ A;  3BRU A;  2A2F X;  5FKM A;  3BCG A;  4IRV A;  2XPV A;  5J3L A;  3RH2 A;  4JL3 A;  1JUP A;  3HTH A;  4PXI A;  3ZQF A;  3QQA A;  3B6C A;  3DCF A;  3QBM A;  5FKO A;  2NP3 A;  2ID6 A;  3EGQ A;  2RHA A;  3BR1 A;  3IH2 A;  2G0E A;  2PBX A;  5FKN A;  5DAJ A;  2VPR A;  4X1E A;  2QTQ A;  3HTJ A;  3VUQ A;  4DW6 A;  3LSP A;  3HGY A;  3ZQG A;  2ZCN A;  4GFL A;  2UXH A;  2Y2Z A;  3BR2 A;  1T33 A;  2HYJ A;  3C2B A;  3HGG A;  2Y31 A;  3KZ9 A;  4V2F A;  2W53 A;  3VTI A;  3O8H A;  2UXI A;  3KNW A;  3TP3 A;  3VVZ A;  5FKL A;  5CXG A;  1BJZ A;  3QPL A;  3G1O A;  5J1R A;  2DG8 A;  2XGD A;  3VVY A;  2IBD A;  2XRL A;  4B3A A;  2ZY9 A;  2UXP A;  3IH3 A;  3HIM A;  2FJI 1;  5EFY A;  2QKO A;  3VP5 A;  2ZCM A;  5K58 A;  5K7Z A;  5F0F A;  2FQ4 A;  3GZI A;  5J1U A;  3NPI A;  3LSJ A;  4MK6 A;  4M3B A;  2WGB A;  2HQ5 A;  5F0C A;  3BQY A;  2XB5 A;  4ABZ A;  2EH3 A;  5AQC A;  4GCL A;  1QPI A;  2G7S A;  3MNL A;  3CRJ A;  4UDS A;  3ZQI A;  2REK A;  2X6O A;  4B1R A;  3EUP A;  2YVE A;  3P9T A;  3Q0W A;  5D1R A;  5GPA A;  2FJ1 A;  2GFN A;  5GP9 A;  2R7W A;  4MXM A;  3WHC A;  3S5R A;  2B1E A;  3MVP A;  2IAI A;  3BT9 A;  4CGR A;  3LHQ A;  4W97 A;  2Y30 A;  2JK3 A;  1ORK A;  2R7V A;  2ID3 A;  3VPR A;  1T56 A;  4DVY P;  3NNR A;  3G1M A;  5F04 A;  1VI0 A;  3BR0 A;  3NS4 A;  2HXO A;  3FK6 A;  2NS8 A;  3JSJ A;  4M3F A;  2QOP A;  5EYR A;  2QIB A;  5IOZ A;  3NXC A;  2R7U A;  3VVX A;  2R7Q A;  4JKZ A;  3HTA A;  3VW0 A;  2GEN A;  5F1J A;  5HBU A;  4G12 A;  1QVT A;  3LSR A;  2XPW A;  3COL A;  3FHN A;  3QPS A;  3K8P C;  5D19 A;  3T6N A;  4D5C A;  5J1Y A;  3LWJ A;  3Q3S A;  3VW1 A;  1ZK8 A;  3DEW A;  2HKU A;  3SDG A;  5F08 A;  2TRT A;  2FX0 A;  3CJD A;  2ZOY A;  4W1U A;  2G7G A;  4ICH A;  4JYK A;  4AUX A;  2ZB9 A;  5CXI A;  3PAS A;  5IP6 A;  3AQS A;  3CWR A;  2YVX A;  3CDL A;  1JTX A;  3ANP A;  3VIB A;  3DPJ A;  4XK4 A;  5FGL A;  2GUH A;  3ON2 A;  3PPB A;  5GPC A;  2V57 A;  4L62 A;  4U9N A;  4OD4 A;  3ON4 A;  4GFK A;  3GEU A;  3V6G A;  1RKT A;  4GCT A;  3VW2 A;  5F0H A;  2NS7 A;  5EZH A;  1UI5 A;  3VOX A;  2UXU A;  2TCT A;  3PM1 A;  1Z0X A;  3ZQH A;  2R7X A;  3KKD A;  2D6Y A;  5FKK A;  2FD5 A;  5CQG A;  1U9N A;  3WHB A;  4M3D A;  4V2G A;  2VKV A;  3DU5 A;  4ME9 A;  2VKE A;  3F0C A;  2IU5 A;  2XPU A;  3HTI A; 
#chains in the Genus database with same CATH homology
 3BTL A;  5FHP A;  3VOK A;  5CW8 A;  2I10 A;  3Q0U A;  4NN1 A;  4NEL A;  3LJL A;  4ACI A;  2G3B A;  2QWT A;  2XDN A;  1RPW A;  2WV1 A;  4AF5 A;  5HSZ A;  2OI8 A;  3BTI A;  2ZCX A;  3TP0 A;  4JNN A;  3NRG A;  2F07 A;  2NX4 A;  2O7T A;  5K7H A;  2G7L A;  3KKC A;  2JJ7 A;  3SFI A;  3V78 A;  3AQT A;  3BNI A;  2RAE A;  3ANG A;  3BHQ A;  1QVU A;  2RAS A;  3B81 A;  3LOC A;  5D18 A;  3G1L A;  3O8G A;  2GBY A;  3BTC A;  2HXI A;  2WUI A;  3BR6 A;  3NI7 A;  3BQZ A;  3BJB A;  2HYT A;  3IH4 A;  5H9T A;  1U9O A;  1JT6 A;  3E7Q A;  2OF7 A;  2UXO A;  4D7M A;  2FBQ A;  4AC0 A;  3IUV A;  4I76 A;  3BR3 A;  3RD3 A;  3B6A A;  2DTZ A;  2ZOZ A;  5C4Y A;  2O7O A;  4YZE A;  2YVH A;  4MO7 A;  4KWA A;  1SGM A;  5IOY A;  4GCK A;  3C07 A;  3QKX A;  1ZKG A;  2X9D A;  1RKW A;  1UI6 A;  2PZ9 A;  4M3G A;  3G7R A;  4D5F A;  2QCO A;  5F27 A;  3Q0V A;  3G56 A;  5HAW A;  5FMP A;  3ZQL A;  4HKU A;  2NP5 A;  1A6I A;  1Z77 A;  3CCY A;  1JUM A;  5IPA A;  1JT0 A;  3FIW A;  1JTY A;  3FK7 A;  4I6Z A;  2OER A;  2Q24 A;  3BTJ A;  2OPT A;  2XGC A;  4AC6 A;  2IEK A;  1JUS A;  2DG7 A;  4M3E A;  2XGE A;  3F1B A;  5K7F A;  5EZG A;  3BR5 A;  4D7N A;  3O60 A;  3HE0 A;  3FRQ A;  3BRU A;  5FKM A;  3BCG A;  2XPV A;  5J3L A;  3RH2 A;  4JL3 A;  1JUP A;  3HTH A;  4PXI A;  3ZQF A;  3QQA A;  3B6C A;  3DCF A;  3QBM A;  5FKO A;  2NP3 A;  2ID6 A;  3EGQ A;  2RHA A;  3BR1 A;  3IH2 A;  2G0E A;  2PBX A;  5FKN A;  5DAJ A;  2VPR A;  4X1E A;  2QTQ A;  3HTJ A;  3VUQ A;  4DW6 A;  3LSP A;  3HGY A;  3ZQG A;  2ZCN A;  4GFL A;  2UXH A;  2Y2Z A;  3BR2 A;  1T33 A;  2HYJ A;  3C2B A;  3HGG A;  2Y31 A;  3KZ9 A;  4V2F A;  2W53 A;  3O8H A;  2UXI A;  3KNW A;  3TP3 A;  3VVZ A;  5FKL A;  5CXG A;  1BJZ A;  3QPL A;  3G1O A;  5J1R A;  2DG8 A;  2XGD A;  3VVY A;  2IBD A;  2XRL A;  4B3A A;  2UXP A;  3IH3 A;  3HIM A;  5EFY A;  2QKO A;  3VP5 A;  2ZCM A;  5K58 A;  5K7Z A;  5F0F A;  2FQ4 A;  3GZI A;  5J1U A;  3NPI A;  3LSJ A;  4MK6 A;  4M3B A;  2WGB A;  2HQ5 A;  5F0C A;  3BQY A;  2XB5 A;  4ABZ A;  2EH3 A;  5AQC A;  4GCL A;  1QPI A;  2G7S A;  3MNL A;  3CRJ A;  4UDS A;  3ZQI A;  2REK A;  2X6O A;  4B1R A;  3EUP A;  2YVE A;  3P9T A;  3Q0W A;  5D1R A;  5GPA A;  2FJ1 A;  2GFN A;  5GP9 A;  4MXM A;  3S5R A;  3WHC A;  3MVP A;  2IAI A;  3BT9 A;  4CGR A;  3LHQ A;  4W97 A;  2Y30 A;  2JK3 A;  1ORK A;  2ID3 A;  3VPR A;  1T56 A;  3NNR A;  3G1M A;  5F04 A;  1VI0 A;  3BR0 A;  2HXO A;  3FK6 A;  2NS8 A;  3JSJ A;  4M3F A;  2QOP A;  5EYR A;  2QIB A;  5IOZ A;  3NXC A;  3VVX A;  4JKZ A;  3HTA A;  3VW0 A;  2GEN A;  5F1J A;  5HBU A;  4G12 A;  1QVT A;  3LSR A;  2XPW A;  3COL A;  3QPS A;  5D19 A;  3T6N A;  4D5C A;  5J1Y A;  3LWJ A;  3Q3S A;  3VW1 A;  1ZK8 A;  3DEW A;  2HKU A;  3SDG A;  5F08 A;  2TRT A;  2FX0 A;  3CJD A;  2ZOY A;  4W1U A;  2G7G A;  4ICH A;  4JYK A;  4AUX A;  2ZB9 A;  5CXI A;  3PAS A;  5IP6 A;  3AQS A;  3CWR A;  3CDL A;  1JTX A;  3ANP A;  3VIB A;  3DPJ A;  4XK4 A;  5FGL A;  2GUH A;  3ON2 A;  3PPB A;  5GPC A;  2V57 A;  4L62 A;  3ON4 A;  4GFK A;  3GEU A;  3V6G A;  1RKT A;  4GCT A;  3VW2 A;  5F0H A;  2NS7 A;  5EZH A;  1UI5 A;  3VOX A;  2UXU A;  2TCT A;  3PM1 A;  1Z0X A;  3ZQH A;  3KKD A;  2D6Y A;  5FKK A;  2FD5 A;  1U9N A;  3WHB A;  4M3D A;  4V2G A;  2VKV A;  4ME9 A;  2VKE A;  3F0C A;  2IU5 A;  2XPU A;  3HTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...