2REKA

Crystal structure of tetr-family transcriptional regulator
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
181
structure length
172
Chain Sequence
ADARRNYDRIIEAAAAEVARHGADASLEEIARRAGVGSATLHRHFPSRWGLLQAVFQERVAQLCDEARSLAAEHPPATALTRWLTSLAVFGAVTRGAARSLAALDSRCEQLLTEAGADLLARAQEDGTVRDDVTALELLSLANAVSLAAEHTPDAAHHATRLMGIALGGLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tetR-family transcriptional regulator.
rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
molecule keywords Putative tetR-family transcriptional regulator
total genus 70
structure length 172
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2rekA00
4M3GA 3Q0VA 3RD3A 4UDSA 4I6ZA 2GUHA 3BTIA 2XDNA 2HQ5A 3HGYA 3C2BA 5EZGA 3BJBA 1UI5A 5CXGA 5HSZA 3G7RA 1QVTA 2OF7A 2UXIA 3C07A 3IH3A 3E7QA 2VKEA 3CJDA 4JNNA 3MNLA 1VI0A 5J1UA 1Z77A 4PXIA 5J1YA 4AUXA 5F1JA 5K7HA 3KZ9A 3HTIA 4JL3A 2GFNA 2X6OA 3VUQA 4V2FA 3VOXA 3AQSA 4B3AA 2FQ4A 2G7GA 4GCKA 5EYRA 1ORKA 3O60A 5GPCA 4M3BA 3O8HA 5FKKA 1JTXA 2QCOA 4L62A 3VIBA 3NXCA 3ON2A 3QKXA 3TP3A 2VPRA 3BR5A 3SFIA 4GFLA 2WGBA 4MK6A 4YZEA 2ID6A 5HAWA 3DPJA 1JUPA 5J3LA 2X9DA 2PZ9A 2WV1A 2RASA 2IAIA 3LHQA 3LWJA 2JJ7A 3LSRA 3Q0WA 3BR3A 2HXIA 2UXPA 2NP5A 1BJZA 1SGMA 3RH2A 3KKCA 3ZQFA 4MXMA 1UI6A 3T6NA 2V57A 3F0CA 3DEWA 5K7FA 3NNRA 3NPIA 2IBDA 4AC6A 3HGGA 5D19A 3ANGA 2DG8A 5K58A 5GP9A 3VVXA 2NX4A 3VW1A 4X1EA 4AC0A 5H9TA 3KNWA 2OPTA 1JTYA 2XGCA 2G7SA 2TCTA 2ZOZA 2TRTA 3BQYA 4ICHA 3CCYA 2RHAA 3NRGA 2XB5A 1QPIA 4W1UA 3NI7A 1JUMA 3TP0A 3BTLA 2EH3A 1ZKGA 5FKLA 2UXOA 3ZQIA 2XGEA 3IH4A 2UXHA 3B81A 4KWAA 5GPAA 5F0CA 5FMPA 5IOYA 2ZCXA 3JSJA 5F0FA 2FJ1A 2XRLA 3ZQGA 3G1LA 3LSPA 2O7TA 2G3BA 5FKOA 3EGQA 5FGLA 3VOKA 3FK6A 2HYJA 2G7LA 3VW0A 2UXUA 4GCTA 5AQCA 2FD5A 2NP3A 5F0HA 3CRJA 3BCGA 3ZQLA 3LSJA 2NS7A 3QBMA 3BRUA 2FBQA 3Q0UA 3G1OA 1JT6A 3GEUA 3LJLA 2QOPA 2XPUA 2QIBA 2HKUA 5F27A 2FX0A 2D6YA 4NN1A 2F07A 3BTCA 3BR6A 3VVYA 3MVPA 5HBUA 4AF5A 2HXOA 3BR2A 3PPBA 5EZHA 4G12A 3F1BA 1Z0XA 2W53A 3BTJA 4JKZA 5K7ZA 2GENA 3B6AA 3WHBA 4ME9A 2REKA 4W97A 3FK7A 4M3DA 2Y31A 3PM1A 3PASA 2OERA 5CW8A 2YVHA 2ID3A 3DCFA 4D5CA 1JT0A 4MO7A 2PBXA 4D5FA 5F08A 1T56A 2IU5A 3QQAA 1T33A 4M3FA 2ZCMA 4GCLA 2Q24A 3O8GA 4HKUA 3HTAA 3AQTA 3QPLA 5D1RA 3HTJA 2HYTA 2RAEA 5CXIA 3V78A 2XPWA 3BR1A 3BQZA 1RKTA 3BNIA 3KKDA 5C4YA 1QVUA 2I10A 4B1RA 5DAJA 2XPVA 3CWRA 2QTQA 4I76A 4ABZA 3BR0A 1RKWA 3SDGA 2QWTA 3P9TA 2NS8A 3COLA 3LOCA 3IH2A 3HE0A 4ACIA 4CGRA 3G56A 4D7NA 5D18A 2VKVA 3ANPA 3QPSA 4XK4A 3BHQA 2DTZA 4JYKA 3CDLA 3WHCA 1U9OA 3FIWA 1JUSA 5EFYA 2DG7A 4M3EA 5IOZA 2WUIA 2OI8A 5F04A 1ZK8A 4NELA 3VVZA 1U9NA 2ZOYA 2Y30A 2Y2ZA 2ZB9A 3VPRA 3ZQHA 5IP6A 4D7MA 2IEKA 2YVEA 3VP5A 2JK3A 3FRQA 3ON4A 3S5RA 3Q3SA 4V2GA 2O7OA 3B6CA 3V6GA 5IPAA 3HIMA 1A6IA 5FKMA 3BT9A 5J1RA 2ZCNA 3HTHA 5FKNA 2QKOA 4GFKA 3VW2A 2XGDA 2G0EA 3GZIA 3IUVA 3G1MA 4DW6A 1RPWA 5FHPA 2GBYA 3EUPA
chains in the Genus database with same CATH superfamily
4M3GA 3Q0VA 3RD3A 4UDSA 4I6ZA 2GUHA 3BTIA 3K8PC 2XDNA 2HQ5A 3HGYA 3C2BA 5EZGA 3BJBA 1UI5A 5CXGA 5HSZA 3G7RA 1QVTA 2OF7A 2UXIA 3C07A 3IH3A 3E7QA 2VKEA 3CJDA 4JNNA 2B3WA 3MNLA 1VI0A 5CQGA 5J1UA 1Z77A 4PXIA 5J1YA 2R7RA 4AUXA 5F1JA 5K7HA 3KZ9A 3HTIA 4JL3A 2GFNA 2X6OA 3VUQA 4V2FA 3VOXA 3AQSA 4B3AA 2FQ4A 2FJI1 2G7GA 4GCKA 5EYRA 1ORKA 3O60A 5GPCA 4M3BA 3O8HA 5FKKA 1JTXA 2QCOA 4L62A 3VIBA 3NXCA 3ON2A 3QKXA 2R7OA 3TP3A 2VPRA 3BR5A 3SFIA 4GFLA 2WGBA 4MK6A 4YZEA 2ID6A 5HAWA 3DPJA 1JUPA 5J3LA 2X9DA 2PZ9A 2WV1A 2RASA 2IAIA 3LHQA 3LWJA 2JJ7A 3LSRA 3Q0WA 3BR3A 2HXIA 2UXPA 2NP5A 1BJZA 1SGMA 3RH2A 3KKCA 3ZQFA 4MXMA 1UI6A 3T6NA 2V57A 3F0CA 3DEWA 5K7FA 3NNRA 4AC6A 2IBDA 3NPIA 3HGGA 5D19A 2ZY9A 3NS4A 3ANGA 2DG8A 5K58A 5GP9A 3VVXA 2NX4A 3VW1A 4X1EA 4AC0A 5H9TA 3KNWA 2OPTA 4DVYP 1JTYA 2XGCA 2G7SA 2TCTA 2ZOZA 2TRTA 3BQYA 4ICHA 3KYLA 3CCYA 2RHAA 3NRGA 2XB5A 1QPIA 4W1UA 3NI7A 1JUMA 3TP0A 3BTLA 2B1EA 2EH3A 1ZKGA 5FKLA 2UXOA 3ZQIA 2XGEA 3IH4A 2UXHA 3B81A 4KWAA 5GPAA 5F0CA 5FMPA 5IOYA 2R7XA 2ZCXA 3JSJA 5F0FA 2FJ1A 2XRLA 3ZQGA 3G1LA 3LSPA 2O7TA 2G3BA 5FKOA 3EGQA 5FGLA 3VOKA 3FK6A 2HYJA 2G7LA 3VW0A 2UXUA 4GCTA 5AQCA 2FD5A 2NP3A 2PFVA 5F0HA 2A2FX 3CRJA 3BCGA 3ZQLA 3LSJA 2NS7A 4WIBA 3QBMA 3BRUA 2FBQA 3Q0UA 3G1OA 1JT6A 3GEUA 3LJLA 2QOPA 2XPUA 2QIBA 2HKUA 5F27A 2FX0A 2D6YA 3SWHA 4NN1A 2F07A 3BTCA 3BR6A 3VVYA 3MVPA 5HBUA 4AF5A 2HXOA 3BR2A 3PPBA 5EZHA 2R7TA 4G12A 3F1BA 1Z0XA 2W53A 3BTJA 4JKZA 5K7ZA 2GENA 3B6AA 3WHBA 4ME9A 2REKA 4W97A 3FK7A 4M3DA 3VTIA 2R7SA 3FHNA 2Y31A 3PM1A 3PASA 2OERA 5CW8A 2YVHA 2ID3A 3DCFA 4D5CA 1JT0A 4MO7A 2PBXA 2R7UA 4D5FA 5F08A 1T56A 2IU5A 3QQAA 1T33A 4M3FA 2ZCMA 4GCLA 2Q24A 3O8GA 4HKUA 3HTAA 3AQTA 3DU5A 3QPLA 5D1RA 3HTJA 2HYTA 2RAEA 5CXIA 3V78A 2XPWA 3BR1A 3BQZA 1RKTA 3BNIA 4IRVA 3KKDA 5C4YA 1QVUA 2I10A 4B1RA 4OD4A 5DAJA 2XPVA 3CWRA 2QTQA 4I76A 4U9NA 3BR0A 4ABZA 1RKWA 3SDGA 2QWTA 3DU6A 3P9TA 2NS8A 4C2MA 3COLA 3LOCA 3IH2A 3HE0A 4ACIA 4CGRA 3G56A 4D7NA 5D18A 2YVXA 2VKVA 3ANPA 3QPSA 4XK4A 3BHQA 2DTZA 4JYKA 2R7WA 3CDLA 3WHCA 1U9OA 3FIWA 1JUSA 5EFYA 2DG7A 4M3EA 5IOZA 2WUIA 2OI8A 5F04A 1ZK8A 4NELA 3VVZA 1U9NA 2ZOYA 2Y30A 2Y2ZA 2ZB9A 3VPRA 3ZQHA 5IP6A 4D7MA 2IEKA 2YVEA 3VP5A 2JK3A 3FRQA 3ON4A 3S5RA 3Q3SA 4V2GA 2O7OA 3B6CA 3V6GA 5IPAA 3HIMA 1A6IA 5FKMA 2R7VA 3BT9A 4U9LA 5J1RA 2ZCNA 3HTHA 5FKNA 2QKOA 2R7QA 4OD5A 4GFKA 3VW2A 2XGDA 2G0EA 3GZIA 3IUVA 3G1MA 4DW6A 1RPWA 5FHPA 2GBYA 3EUPA
chains in the Genus database with same CATH topology
4M3GA 3Q0VA 3RD3A 4UDSA 4I6ZA 2GUHA 3BTIA 2XDNA 2HQ5A 3HGYA 3C2BA 5EZGA 3BJBA 1UI5A 5CXGA 5HSZA 3G7RA 1QVTA 2OF7A 2UXIA 3C07A 3IH3A 3E7QA 2VKEA 3CJDA 4JNNA 3MNLA 1VI0A 5J1UA 1Z77A 4PXIA 5J1YA 4AUXA 5F1JA 5K7HA 3KZ9A 3HTIA 4JL3A 2GFNA 2X6OA 3VUQA 4V2FA 3VOXA 3AQSA 4B3AA 2FQ4A 2G7GA 4GCKA 5EYRA 1ORKA 3O60A 5GPCA 4M3BA 3O8HA 5FKKA 1JTXA 2QCOA 4L62A 3VIBA 3NXCA 3ON2A 3QKXA 3TP3A 2VPRA 3BR5A 3SFIA 4GFLA 2WGBA 4MK6A 4YZEA 2ID6A 5HAWA 3DPJA 1JUPA 5J3LA 2X9DA 2PZ9A 2WV1A 2RASA 2IAIA 3LHQA 3LWJA 2JJ7A 3LSRA 3Q0WA 3BR3A 2HXIA 2UXPA 2NP5A 1BJZA 1SGMA 3RH2A 3KKCA 3ZQFA 4MXMA 1UI6A 3T6NA 2V57A 3F0CA 3DEWA 5K7FA 3NNRA 3NPIA 2IBDA 4AC6A 3HGGA 5D19A 3ANGA 2DG8A 5K58A 5GP9A 3VVXA 2NX4A 3VW1A 4X1EA 4AC0A 5H9TA 3KNWA 2OPTA 1JTYA 2XGCA 2G7SA 2TCTA 2ZOZA 2TRTA 3BQYA 4ICHA 3CCYA 2RHAA 3NRGA 2XB5A 1QPIA 4W1UA 3NI7A 1JUMA 3TP0A 3BTLA 2EH3A 1ZKGA 5FKLA 2UXOA 3ZQIA 2XGEA 3IH4A 2UXHA 3B81A 4KWAA 5GPAA 5F0CA 5FMPA 5IOYA 2ZCXA 3JSJA 5F0FA 2FJ1A 2XRLA 3ZQGA 3G1LA 3LSPA 2O7TA 2G3BA 5FKOA 3EGQA 5FGLA 3VOKA 3FK6A 2HYJA 2G7LA 3VW0A 2UXUA 4GCTA 5AQCA 2FD5A 2NP3A 5F0HA 3CRJA 3BCGA 3ZQLA 3LSJA 2NS7A 3QBMA 3BRUA 2FBQA 3Q0UA 3G1OA 1JT6A 3GEUA 3LJLA 2QOPA 2XPUA 2QIBA 2HKUA 5F27A 2FX0A 2D6YA 4NN1A 2F07A 3BTCA 3BR6A 3VVYA 3MVPA 5HBUA 4AF5A 2HXOA 3BR2A 3PPBA 5EZHA 4G12A 3F1BA 1Z0XA 2W53A 3BTJA 4JKZA 5K7ZA 2GENA 3B6AA 3WHBA 4ME9A 2REKA 4W97A 3FK7A 4M3DA 2Y31A 3PM1A 3PASA 2OERA 5CW8A 2YVHA 2ID3A 3DCFA 4D5CA 1JT0A 4MO7A 2PBXA 4D5FA 5F08A 1T56A 2IU5A 3QQAA 1T33A 4M3FA 2ZCMA 4GCLA 2Q24A 3O8GA 4HKUA 3HTAA 3AQTA 3QPLA 5D1RA 3HTJA 2HYTA 2RAEA 5CXIA 3V78A 2XPWA 3BR1A 3BQZA 1RKTA 3BNIA 3KKDA 5C4YA 1QVUA 2I10A 4B1RA 5DAJA 2XPVA 3CWRA 2QTQA 4I76A 4ABZA 3BR0A 1RKWA 3SDGA 2QWTA 3P9TA 2NS8A 3COLA 3LOCA 3IH2A 3HE0A 4ACIA 4CGRA 3G56A 4D7NA 5D18A 2VKVA 3ANPA 3QPSA 4XK4A 3BHQA 2DTZA 4JYKA 3CDLA 3WHCA 1U9OA 3FIWA 1JUSA 5EFYA 2DG7A 4M3EA 5IOZA 2WUIA 2OI8A 5F04A 1ZK8A 4NELA 3VVZA 1U9NA 2ZOYA 2Y30A 2Y2ZA 2ZB9A 3VPRA 3ZQHA 5IP6A 4D7MA 2IEKA 2YVEA 3VP5A 2JK3A 3FRQA 3ON4A 3S5RA 3Q3SA 4V2GA 2O7OA 3B6CA 3V6GA 5IPAA 3HIMA 1A6IA 5FKMA 3BT9A 5J1RA 2ZCNA 3HTHA 5FKNA 2QKOA 4GFKA 3VW2A 2XGDA 2G0EA 3GZIA 3IUVA 3G1MA 4DW6A 1RPWA 5FHPA 2GBYA 3EUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3G A;  3Q0V A;  3RD3 A;  4UDS A;  4I6Z A;  2GUH A;  3BTI A;  2XDN A;  2HQ5 A;  3HGY A;  3C2B A;  5EZG A;  3BJB A;  1UI5 A;  5CXG A;  5HSZ A;  3G7R A;  1QVT A;  2OF7 A;  2UXI A;  3C07 A;  3IH3 A;  3E7Q A;  2VKE A;  3CJD A;  4JNN A;  3MNL A;  1VI0 A;  5J1U A;  1Z77 A;  4PXI A;  5J1Y A;  4AUX A;  5F1J A;  5K7H A;  3KZ9 A;  3HTI A;  4JL3 A;  2GFN A;  2X6O A;  3VUQ A;  4V2F A;  3VOX A;  3AQS A;  4B3A A;  2FQ4 A;  2G7G A;  4GCK A;  5EYR A;  1ORK A;  3O60 A;  5GPC A;  4M3B A;  3O8H A;  5FKK A;  1JTX A;  2QCO A;  4L62 A;  3VIB A;  3NXC A;  3ON2 A;  3QKX A;  3TP3 A;  2VPR A;  3BR5 A;  3SFI A;  4GFL A;  2WGB A;  4MK6 A;  4YZE A;  2ID6 A;  5HAW A;  3DPJ A;  1JUP A;  5J3L A;  2X9D A;  2PZ9 A;  2WV1 A;  2RAS A;  2IAI A;  3LHQ A;  3LWJ A;  2JJ7 A;  3LSR A;  3Q0W A;  3BR3 A;  2HXI A;  2UXP A;  2NP5 A;  1BJZ A;  1SGM A;  3RH2 A;  3KKC A;  3ZQF A;  4MXM A;  1UI6 A;  3T6N A;  2V57 A;  3F0C A;  3DEW A;  5K7F A;  3NNR A;  3NPI A;  2IBD A;  4AC6 A;  3HGG A;  5D19 A;  3ANG A;  2DG8 A;  5K58 A;  5GP9 A;  3VVX A;  2NX4 A;  3VW1 A;  4X1E A;  4AC0 A;  5H9T A;  3KNW A;  2OPT A;  1JTY A;  2XGC A;  2G7S A;  2TCT A;  2ZOZ A;  2TRT A;  3BQY A;  4ICH A;  3CCY A;  2RHA A;  3NRG A;  2XB5 A;  1QPI A;  4W1U A;  3NI7 A;  1JUM A;  3TP0 A;  3BTL A;  2EH3 A;  1ZKG A;  5FKL A;  2UXO A;  3ZQI A;  2XGE A;  3IH4 A;  2UXH A;  3B81 A;  4KWA A;  5GPA A;  5F0C A;  5FMP A;  5IOY A;  2ZCX A;  3JSJ A;  5F0F A;  2FJ1 A;  2XRL A;  3ZQG A;  3G1L A;  3LSP A;  2O7T A;  2G3B A;  5FKO A;  3EGQ A;  5FGL A;  3VOK A;  3FK6 A;  2HYJ A;  2G7L A;  3VW0 A;  2UXU A;  4GCT A;  5AQC A;  2FD5 A;  2NP3 A;  5F0H A;  3CRJ A;  3BCG A;  3ZQL A;  3LSJ A;  2NS7 A;  3QBM A;  3BRU A;  2FBQ A;  3Q0U A;  3G1O A;  1JT6 A;  3GEU A;  3LJL A;  2QOP A;  2XPU A;  2QIB A;  2HKU A;  5F27 A;  2FX0 A;  2D6Y A;  4NN1 A;  2F07 A;  3BTC A;  3BR6 A;  3VVY A;  3MVP A;  5HBU A;  4AF5 A;  2HXO A;  3BR2 A;  3PPB A;  5EZH A;  4G12 A;  3F1B A;  1Z0X A;  2W53 A;  3BTJ A;  4JKZ A;  5K7Z A;  2GEN A;  3B6A A;  3WHB A;  4ME9 A;  2REK A;  4W97 A;  3FK7 A;  4M3D A;  2Y31 A;  3PM1 A;  3PAS A;  2OER A;  5CW8 A;  2YVH A;  2ID3 A;  3DCF A;  4D5C A;  1JT0 A;  4MO7 A;  2PBX A;  4D5F A;  5F08 A;  1T56 A;  2IU5 A;  3QQA A;  1T33 A;  4M3F A;  2ZCM A;  4GCL A;  2Q24 A;  3O8G A;  4HKU A;  3HTA A;  3AQT A;  3QPL A;  5D1R A;  3HTJ A;  2HYT A;  2RAE A;  5CXI A;  3V78 A;  2XPW A;  3BR1 A;  3BQZ A;  1RKT A;  3BNI A;  3KKD A;  5C4Y A;  1QVU A;  2I10 A;  4B1R A;  5DAJ A;  2XPV A;  3CWR A;  2QTQ A;  4I76 A;  4ABZ A;  3BR0 A;  1RKW A;  3SDG A;  2QWT A;  3P9T A;  2NS8 A;  3COL A;  3LOC A;  3IH2 A;  3HE0 A;  4ACI A;  4CGR A;  3G56 A;  4D7N A;  5D18 A;  2VKV A;  3ANP A;  3QPS A;  4XK4 A;  3BHQ A;  2DTZ A;  4JYK A;  3CDL A;  3WHC A;  1U9O A;  3FIW A;  1JUS A;  5EFY A;  2DG7 A;  4M3E A;  5IOZ A;  2WUI A;  2OI8 A;  5F04 A;  1ZK8 A;  4NEL A;  3VVZ A;  1U9N A;  2ZOY A;  2Y30 A;  2Y2Z A;  2ZB9 A;  3VPR A;  3ZQH A;  5IP6 A;  4D7M A;  2IEK A;  2YVE A;  3VP5 A;  2JK3 A;  3FRQ A;  3ON4 A;  3S5R A;  3Q3S A;  4V2G A;  2O7O A;  3B6C A;  3V6G A;  5IPA A;  3HIM A;  1A6I A;  5FKM A;  3BT9 A;  5J1R A;  2ZCN A;  3HTH A;  5FKN A;  2QKO A;  4GFK A;  3VW2 A;  2XGD A;  2G0E A;  3GZI A;  3IUV A;  3G1M A;  4DW6 A;  1RPW A;  5FHP A;  2GBY A;  3EUP A; 
#chains in the Genus database with same CATH topology
 4M3G A;  3Q0V A;  3RD3 A;  4UDS A;  4I6Z A;  2GUH A;  3BTI A;  3K8P C;  2XDN A;  2HQ5 A;  3HGY A;  3C2B A;  5EZG A;  3BJB A;  1UI5 A;  5CXG A;  5HSZ A;  3G7R A;  1QVT A;  2OF7 A;  2UXI A;  3C07 A;  3IH3 A;  3E7Q A;  2VKE A;  3CJD A;  4JNN A;  2B3W A;  3MNL A;  1VI0 A;  5CQG A;  5J1U A;  1Z77 A;  4PXI A;  5J1Y A;  2R7R A;  4AUX A;  5F1J A;  5K7H A;  3KZ9 A;  3HTI A;  4JL3 A;  2GFN A;  2X6O A;  3VUQ A;  4V2F A;  3VOX A;  3AQS A;  4B3A A;  2FQ4 A;  2FJI 1;  2G7G A;  4GCK A;  5EYR A;  1ORK A;  3O60 A;  5GPC A;  4M3B A;  3O8H A;  5FKK A;  1JTX A;  2QCO A;  4L62 A;  3VIB A;  3NXC A;  3ON2 A;  3QKX A;  2R7O A;  3TP3 A;  2VPR A;  3BR5 A;  3SFI A;  4GFL A;  2WGB A;  4MK6 A;  4YZE A;  2ID6 A;  5HAW A;  3DPJ A;  1JUP A;  5J3L A;  2X9D A;  2PZ9 A;  2WV1 A;  2RAS A;  2IAI A;  3LHQ A;  3LWJ A;  2JJ7 A;  3LSR A;  3Q0W A;  3BR3 A;  2HXI A;  2UXP A;  2NP5 A;  1BJZ A;  1SGM A;  3RH2 A;  3KKC A;  3ZQF A;  4MXM A;  1UI6 A;  3T6N A;  2V57 A;  3F0C A;  3DEW A;  5K7F A;  3NNR A;  4AC6 A;  2IBD A;  3NPI A;  3HGG A;  5D19 A;  2ZY9 A;  3NS4 A;  3ANG A;  2DG8 A;  5K58 A;  5GP9 A;  3VVX A;  2NX4 A;  3VW1 A;  4X1E A;  4AC0 A;  5H9T A;  3KNW A;  2OPT A;  4DVY P;  1JTY A;  2XGC A;  2G7S A;  2TCT A;  2ZOZ A;  2TRT A;  3BQY A;  4ICH A;  3KYL A;  3CCY A;  2RHA A;  3NRG A;  2XB5 A;  1QPI A;  4W1U A;  3NI7 A;  1JUM A;  3TP0 A;  3BTL A;  2B1E A;  2EH3 A;  1ZKG A;  5FKL A;  2UXO A;  3ZQI A;  2XGE A;  3IH4 A;  2UXH A;  3B81 A;  4KWA A;  5GPA A;  5F0C A;  5FMP A;  5IOY A;  2R7X A;  2ZCX A;  3JSJ A;  5F0F A;  2FJ1 A;  2XRL A;  3ZQG A;  3G1L A;  3LSP A;  2O7T A;  2G3B A;  5FKO A;  3EGQ A;  5FGL A;  3VOK A;  3FK6 A;  2HYJ A;  2G7L A;  3VW0 A;  2UXU A;  4GCT A;  5AQC A;  2FD5 A;  2NP3 A;  2PFV A;  5F0H A;  2A2F X;  3CRJ A;  3BCG A;  3ZQL A;  3LSJ A;  2NS7 A;  4WIB A;  3QBM A;  3BRU A;  2FBQ A;  3Q0U A;  3G1O A;  1JT6 A;  3GEU A;  3LJL A;  2QOP A;  2XPU A;  2QIB A;  2HKU A;  5F27 A;  2FX0 A;  2D6Y A;  3SWH A;  4NN1 A;  2F07 A;  3BTC A;  3BR6 A;  3VVY A;  3MVP A;  5HBU A;  4AF5 A;  2HXO A;  3BR2 A;  3PPB A;  5EZH A;  2R7T A;  4G12 A;  3F1B A;  1Z0X A;  2W53 A;  3BTJ A;  4JKZ A;  5K7Z A;  2GEN A;  3B6A A;  3WHB A;  4ME9 A;  2REK A;  4W97 A;  3FK7 A;  4M3D A;  3VTI A;  2R7S A;  3FHN A;  2Y31 A;  3PM1 A;  3PAS A;  2OER A;  5CW8 A;  2YVH A;  2ID3 A;  3DCF A;  4D5C A;  1JT0 A;  4MO7 A;  2PBX A;  2R7U A;  4D5F A;  5F08 A;  1T56 A;  2IU5 A;  3QQA A;  1T33 A;  4M3F A;  2ZCM A;  4GCL A;  2Q24 A;  3O8G A;  4HKU A;  3HTA A;  3AQT A;  3DU5 A;  3QPL A;  5D1R A;  3HTJ A;  2HYT A;  2RAE A;  5CXI A;  3V78 A;  2XPW A;  3BR1 A;  3BQZ A;  1RKT A;  3BNI A;  4IRV A;  3KKD A;  5C4Y A;  1QVU A;  2I10 A;  4B1R A;  4OD4 A;  5DAJ A;  2XPV A;  3CWR A;  2QTQ A;  4I76 A;  4U9N A;  3BR0 A;  4ABZ A;  1RKW A;  3SDG A;  2QWT A;  3DU6 A;  3P9T A;  2NS8 A;  4C2M A;  3COL A;  3LOC A;  3IH2 A;  3HE0 A;  4ACI A;  4CGR A;  3G56 A;  4D7N A;  5D18 A;  2YVX A;  2VKV A;  3ANP A;  3QPS A;  4XK4 A;  3BHQ A;  2DTZ A;  4JYK A;  2R7W A;  3CDL A;  3WHC A;  1U9O A;  3FIW A;  1JUS A;  5EFY A;  2DG7 A;  4M3E A;  5IOZ A;  2WUI A;  2OI8 A;  5F04 A;  1ZK8 A;  4NEL A;  3VVZ A;  1U9N A;  2ZOY A;  2Y30 A;  2Y2Z A;  2ZB9 A;  3VPR A;  3ZQH A;  5IP6 A;  4D7M A;  2IEK A;  2YVE A;  3VP5 A;  2JK3 A;  3FRQ A;  3ON4 A;  3S5R A;  3Q3S A;  4V2G A;  2O7O A;  3B6C A;  3V6G A;  5IPA A;  3HIM A;  1A6I A;  5FKM A;  2R7V A;  3BT9 A;  4U9L A;  5J1R A;  2ZCN A;  3HTH A;  5FKN A;  2QKO A;  2R7Q A;  4OD5 A;  4GFK A;  3VW2 A;  2XGD A;  2G0E A;  3GZI A;  3IUV A;  3G1M A;  4DW6 A;  1RPW A;  5FHP A;  2GBY A;  3EUP A; 
#chains in the Genus database with same CATH homology
 4M3G A;  3Q0V A;  3RD3 A;  4UDS A;  4I6Z A;  2GUH A;  3BTI A;  2XDN A;  2HQ5 A;  3HGY A;  3C2B A;  5EZG A;  3BJB A;  1UI5 A;  5CXG A;  5HSZ A;  3G7R A;  1QVT A;  2OF7 A;  2UXI A;  3C07 A;  3IH3 A;  3E7Q A;  2VKE A;  3CJD A;  4JNN A;  3MNL A;  1VI0 A;  5J1U A;  1Z77 A;  4PXI A;  5J1Y A;  4AUX A;  5F1J A;  5K7H A;  3KZ9 A;  3HTI A;  4JL3 A;  2GFN A;  2X6O A;  3VUQ A;  4V2F A;  3VOX A;  3AQS A;  4B3A A;  2FQ4 A;  2G7G A;  4GCK A;  5EYR A;  1ORK A;  3O60 A;  5GPC A;  4M3B A;  3O8H A;  5FKK A;  1JTX A;  2QCO A;  4L62 A;  3VIB A;  3NXC A;  3ON2 A;  3QKX A;  3TP3 A;  2VPR A;  3BR5 A;  3SFI A;  4GFL A;  2WGB A;  4MK6 A;  4YZE A;  2ID6 A;  5HAW A;  3DPJ A;  1JUP A;  5J3L A;  2X9D A;  2PZ9 A;  2WV1 A;  2RAS A;  2IAI A;  3LHQ A;  3LWJ A;  2JJ7 A;  3LSR A;  3Q0W A;  3BR3 A;  2HXI A;  2UXP A;  2NP5 A;  1BJZ A;  1SGM A;  3RH2 A;  3KKC A;  3ZQF A;  4MXM A;  1UI6 A;  3T6N A;  2V57 A;  3F0C A;  3DEW A;  5K7F A;  3NNR A;  3NPI A;  2IBD A;  4AC6 A;  3HGG A;  5D19 A;  3ANG A;  2DG8 A;  5K58 A;  5GP9 A;  3VVX A;  2NX4 A;  3VW1 A;  4X1E A;  4AC0 A;  5H9T A;  3KNW A;  2OPT A;  1JTY A;  2XGC A;  2G7S A;  2TCT A;  2ZOZ A;  2TRT A;  3BQY A;  4ICH A;  3CCY A;  2RHA A;  3NRG A;  2XB5 A;  1QPI A;  4W1U A;  3NI7 A;  1JUM A;  3TP0 A;  3BTL A;  2EH3 A;  1ZKG A;  5FKL A;  2UXO A;  3ZQI A;  2XGE A;  3IH4 A;  2UXH A;  3B81 A;  4KWA A;  5GPA A;  5F0C A;  5FMP A;  5IOY A;  2ZCX A;  3JSJ A;  5F0F A;  2FJ1 A;  2XRL A;  3ZQG A;  3G1L A;  3LSP A;  2O7T A;  2G3B A;  5FKO A;  3EGQ A;  5FGL A;  3VOK A;  3FK6 A;  2HYJ A;  2G7L A;  3VW0 A;  2UXU A;  4GCT A;  5AQC A;  2FD5 A;  2NP3 A;  5F0H A;  3CRJ A;  3BCG A;  3ZQL A;  3LSJ A;  2NS7 A;  3QBM A;  3BRU A;  2FBQ A;  3Q0U A;  3G1O A;  1JT6 A;  3GEU A;  3LJL A;  2QOP A;  2XPU A;  2QIB A;  2HKU A;  5F27 A;  2FX0 A;  2D6Y A;  4NN1 A;  2F07 A;  3BTC A;  3BR6 A;  3VVY A;  3MVP A;  5HBU A;  4AF5 A;  2HXO A;  3BR2 A;  3PPB A;  5EZH A;  4G12 A;  3F1B A;  1Z0X A;  2W53 A;  3BTJ A;  4JKZ A;  5K7Z A;  2GEN A;  3B6A A;  3WHB A;  4ME9 A;  2REK A;  4W97 A;  3FK7 A;  4M3D A;  2Y31 A;  3PM1 A;  3PAS A;  2OER A;  5CW8 A;  2YVH A;  2ID3 A;  3DCF A;  4D5C A;  1JT0 A;  4MO7 A;  2PBX A;  4D5F A;  5F08 A;  1T56 A;  2IU5 A;  3QQA A;  1T33 A;  4M3F A;  2ZCM A;  4GCL A;  2Q24 A;  3O8G A;  4HKU A;  3HTA A;  3AQT A;  3QPL A;  5D1R A;  3HTJ A;  2HYT A;  2RAE A;  5CXI A;  3V78 A;  2XPW A;  3BR1 A;  3BQZ A;  1RKT A;  3BNI A;  3KKD A;  5C4Y A;  1QVU A;  2I10 A;  4B1R A;  5DAJ A;  2XPV A;  3CWR A;  2QTQ A;  4I76 A;  4ABZ A;  3BR0 A;  1RKW A;  3SDG A;  2QWT A;  3P9T A;  2NS8 A;  3COL A;  3LOC A;  3IH2 A;  3HE0 A;  4ACI A;  4CGR A;  3G56 A;  4D7N A;  5D18 A;  2VKV A;  3ANP A;  3QPS A;  4XK4 A;  3BHQ A;  2DTZ A;  4JYK A;  3CDL A;  3WHC A;  1U9O A;  3FIW A;  1JUS A;  5EFY A;  2DG7 A;  4M3E A;  5IOZ A;  2WUI A;  2OI8 A;  5F04 A;  1ZK8 A;  4NEL A;  3VVZ A;  1U9N A;  2ZOY A;  2Y30 A;  2Y2Z A;  2ZB9 A;  3VPR A;  3ZQH A;  5IP6 A;  4D7M A;  2IEK A;  2YVE A;  3VP5 A;  2JK3 A;  3FRQ A;  3ON4 A;  3S5R A;  3Q3S A;  4V2G A;  2O7O A;  3B6C A;  3V6G A;  5IPA A;  3HIM A;  1A6I A;  5FKM A;  3BT9 A;  5J1R A;  2ZCN A;  3HTH A;  5FKN A;  2QKO A;  4GFK A;  3VW2 A;  2XGD A;  2G0E A;  3GZI A;  3IUV A;  3G1M A;  4DW6 A;  1RPW A;  5FHP A;  2GBY A;  3EUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...