2REKA

Crystal structure of tetr-family transcriptional regulator
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
181
structure length
172
Chain Sequence
ADARRNYDRIIEAAAAEVARHGADASLEEIARRAGVGSATLHRHFPSRWGLLQAVFQERVAQLCDEARSLAAEHPPATALTRWLTSLAVFGAVTRGAARSLAALDSRCEQLLTEAGADLLARAQEDGTVRDDVTALELLSLANAVSLAAEHTPDAAHHATRLMGIALGGLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tetR-family transcriptional regulator.
rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
molecule keywords Putative tetR-family transcriptional regulator
total genus 70
structure length 172
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2rekA00
3DCFA 5J1UA 3BJBA 3LJLA 3G1LA 5D18A 5IOZA 4V2FA 2UXOA 1Z77A 2ZB9A 3PM1A 4ABZA 3QQAA 2HXOA 2REKA 3SFIA 3HTJA 3RD3A 4D5FA 3VVXA 2WV1A 3VW2A 4GCTA 5F27A 2FD5A 4DW6A 3ZQFA 3HTAA 2GENA 4AC6A 2X6OA 2GFNA 3COLA 4JKZA 2JK3A 3EUPA 2HYTA 4JL3A 2NP5A 3NNRA 3AQSA 3RH2A 3GZIA 5K58A 4JYKA 3CWRA 5EZHA 3BHQA 3ZQHA 2VPRA 3IH2A 1T56A 1T33A 4X1EA 2ZCMA 2RASA 5FKLA 3BR2A 2HYJA 5CW8A 2FQ4A 3KNWA 2GUHA 4M3GA 2YVEA 3BR6A 3VOXA 1U9OA 3MNLA 3BQZA 3VOKA 2NS7A 2IAIA 2NP3A 2RAEA 2UXHA 3G56A 1UI6A 2HQ5A 2EH3A 3ANGA 2XGEA 2UXUA 4L62A 2UXPA 1U9NA 4V2GA 2Y30A 4MK6A 5F0HA 3HIMA 4B3AA 2YVHA 1ZK8A 5HAWA 4I76A 3F1BA 2FBQA 3VVZA 3LSRA 3FK6A 1UI5A 3C2BA 2ZCNA 3BRUA 1QVUA 3LOCA 4CGRA 3QBMA 5J1YA 2VKVA 3ON4A 3HTIA 2IEKA 2XPUA 3C07A 2G7SA 4M3EA 2NX4A 3JSJA 3BQYA 5CXGA 5GPCA 1RPWA 3LSPA 4NELA 3ZQGA 3V6GA 2QOPA 3HGYA 3NXCA 5FHPA 2UXIA 2FX0A 4GFLA 1RKTA 1ZKGA 5HBUA 5F1JA 2XRLA 4NN1A 2PBXA 3NI7A 2JJ7A 5EYRA 2ZOYA 2ID3A 3NRGA 2XPWA 1JT6A 2ZCXA 5FKMA 2NS8A 4D7MA 2TCTA 3KZ9A 3Q0UA 3IH3A 4ME9A 2XB5A 2G7LA 2D6YA 3PPBA 2VKEA 3BTIA 3VW0A 3LWJA 3VW1A 3PASA 4JNNA 5D19A 2DTZA 1QPIA 3ZQIA 5F04A 4MXMA 3VP5A 5FMPA 4GCKA 3ON2A 3BR5A 5IPAA 3O60A 2V57A 2PZ9A 2FJ1A 3KKCA 3DPJA 3E7QA 2XGDA 2QIBA 1SGMA 4W1UA 4XK4A 3EGQA 5FKNA 2XGCA 3QPSA 3T6NA 2ID6A 5EFYA 3BCGA 3HE0A 4D7NA 3MVPA 3AQTA 3HGGA 4M3BA 3S5RA 4AC0A 1A6IA 1ORKA 3P9TA 5DAJA 4AUXA 3VIBA 3LHQA 2G0EA 3DEWA 2OI8A 3KKDA 5FKKA 3IUVA 2GBYA 5D1RA 1JTYA 3BR0A 2IU5A 4G12A 3F0CA 3Q3SA 3VUQA 1JUPA 4GCLA 1QVTA 3O8HA 5FGLA 2WGBA 3FIWA 2IBDA 2W53A 3CJDA 5J1RA 3WHCA 5C4YA 4I6ZA 3CRJA 3FRQA 5AQCA 4M3FA 3B6CA 2OERA 5H9TA 4KWAA 3NPIA 2QCOA 2HKUA 3ANPA 2ZOZA 2Y31A 3CDLA 4D5CA 5EZGA 3G1OA 2TRTA 5K7ZA 3GEUA 3G1MA 3QKXA 4M3DA 3LSJA 4HKUA 3V78A 5F0FA 3BR3A 2Y2ZA 3B81A 3ZQLA 2O7TA 3HTHA 3G7RA 3TP0A 1JT0A 3IH4A 1Z0XA 3SDGA 3QPLA 3TP3A 2HXIA 4MO7A 4W97A 5HSZA 2G3BA 3Q0WA 1JUMA 3Q0VA 4GFKA 3BTCA 4PXIA 1JUSA 2XPVA 2OF7A 1RKWA 3BT9A 5K7HA 2QWTA 3CCYA 5FKOA 5K7FA 2I10A 3FK7A 2QKOA 2F07A 2O7OA 4UDSA 3VPRA 5F0CA 2Q24A 2OPTA 5GP9A 4AF5A 2QTQA 5J3LA 3B6AA 4ICHA 4ACIA 3BTJA 2DG8A 2G7GA 3O8GA 5IP6A 5GPAA 1VI0A 2DG7A 5F08A 1JTXA 2RHAA 5IOYA 2X9DA 3BR1A 1BJZA 2WUIA 3BTLA 3VVYA 4YZEA 5CXIA 3BNIA 4B1RA 2XDNA 3WHBA
chains in the Genus database with same CATH superfamily
3DCFA 5J1UA 3BJBA 3LJLA 3G1LA 5D18A 5IOZA 4V2FA 2UXOA 1Z77A 2ZB9A 3PM1A 4ABZA 3QQAA 4U9NA 2HXOA 2FJI1 2REKA 3SFIA 3HTJA 3RD3A 4D5FA 3VVXA 2WV1A 3VW2A 4GCTA 5F27A 2FD5A 4DW6A 3ZQFA 3HTAA 2GENA 4IRVA 4AC6A 2X6OA 2GFNA 3COLA 4JKZA 2JK3A 3EUPA 2HYTA 4JL3A 2NP5A 3NNRA 3AQSA 3RH2A 3GZIA 5K58A 4JYKA 3CWRA 5EZHA 3BHQA 3ZQHA 2VPRA 3IH2A 1T56A 1T33A 4X1EA 2ZCMA 2RASA 5FKLA 3BR2A 2HYJA 5CW8A 2FQ4A 3KNWA 2GUHA 4M3GA 2YVEA 3BR6A 3VOXA 3FHNA 1U9OA 3MNLA 3BQZA 3VOKA 2NS7A 2IAIA 2NP3A 2YVXA 2RAEA 2UXHA 3G56A 1UI6A 2HQ5A 2EH3A 3ANGA 2XGEA 2UXUA 4L62A 2UXPA 1U9NA 4V2GA 2Y30A 4MK6A 5F0HA 2R7RA 3HIMA 4OD4A 4B3AA 2YVHA 1ZK8A 5HAWA 4I76A 3F1BA 2FBQA 2ZY9A 3VVZA 3K8PC 3LSRA 3FK6A 1UI5A 3C2BA 2ZCNA 3BRUA 1QVUA 3LOCA 4CGRA 3QBMA 5J1YA 2VKVA 3ON4A 3HTIA 2IEKA 2XPUA 4WIBA 3C07A 2G7SA 4M3EA 2NX4A 3JSJA 3BQYA 5CXGA 2R7OA 5GPCA 1RPWA 3LSPA 4NELA 3ZQGA 3V6GA 4U9LA 2QOPA 3HGYA 3NXCA 5FHPA 4OD5A 2UXIA 2FX0A 4GFLA 1RKTA 1ZKGA 2B3WA 5HBUA 5F1JA 2XRLA 4NN1A 2PBXA 3NI7A 2JJ7A 5EYRA 2ZOYA 2ID3A 3NRGA 2XPWA 1JT6A 2ZCXA 3VTIA 5FKMA 2NS8A 4D7MA 2TCTA 3KZ9A 3Q0UA 3IH3A 4ME9A 2A2FX 3NS4A 2XB5A 2G7LA 2D6YA 3DU5A 2R7QA 3PPBA 2VKEA 3BTIA 3VW0A 3LWJA 3VW1A 3PASA 4JNNA 5D19A 2DTZA 1QPIA 2PFVA 3ZQIA 5F04A 4MXMA 3VP5A 5FMPA 4GCKA 3ON2A 3BR5A 5IPAA 3O60A 2V57A 2PZ9A 2FJ1A 3KKCA 3DPJA 3E7QA 2R7TA 2XGDA 2QIBA 2R7XA 1SGMA 4W1UA 4XK4A 3EGQA 5FKNA 2XGCA 3QPSA 3T6NA 2ID6A 5EFYA 2B1EA 3BCGA 3HE0A 4D7NA 3MVPA 3AQTA 3HGGA 4M3BA 3S5RA 3DU6A 4AC0A 1A6IA 1ORKA 3P9TA 5DAJA 4AUXA 3VIBA 3LHQA 2G0EA 3DEWA 2OI8A 3KKDA 5FKKA 3IUVA 2GBYA 5D1RA 1JTYA 3BR0A 2IU5A 4G12A 3F0CA 3Q3SA 3VUQA 1JUPA 4GCLA 1QVTA 3O8HA 5FGLA 2WGBA 3FIWA 2IBDA 2W53A 3CJDA 3WHCA 5J1RA 5C4YA 4I6ZA 3CRJA 3FRQA 5AQCA 4M3FA 3B6CA 3SWHA 2OERA 5H9TA 2R7SA 4KWAA 3NPIA 3KYLA 2QCOA 2HKUA 3ANPA 2ZOZA 2Y31A 3CDLA 4D5CA 5EZGA 5CQGA 3G1OA 2TRTA 5K7ZA 3GEUA 3G1MA 3QKXA 4M3DA 3LSJA 4HKUA 3V78A 5F0FA 3BR3A 2Y2ZA 3B81A 3ZQLA 2O7TA 3HTHA 3G7RA 3TP0A 1JT0A 3IH4A 1Z0XA 3SDGA 3QPLA 3TP3A 2HXIA 2R7WA 4MO7A 4W97A 5HSZA 2G3BA 3Q0WA 1JUMA 3Q0VA 4GFKA 3BTCA 4DVYP 4PXIA 1JUSA 2XPVA 2OF7A 1RKWA 3BT9A 5K7HA 2QWTA 3CCYA 5FKOA 5K7FA 2I10A 3FK7A 2QKOA 2F07A 2O7OA 4UDSA 3VPRA 5F0CA 2Q24A 2OPTA 5GP9A 4AF5A 2QTQA 5J3LA 3B6AA 4ICHA 4ACIA 2R7VA 3BTJA 4C2MA 2R7UA 2DG8A 2G7GA 3O8GA 5IP6A 5GPAA 1VI0A 2DG7A 5F08A 1JTXA 2RHAA 2X9DA 5IOYA 3BR1A 1BJZA 2WUIA 3BTLA 3VVYA 4YZEA 5CXIA 3BNIA 4B1RA 2XDNA 3WHBA
chains in the Genus database with same CATH topology
3DCFA 5J1UA 3BJBA 3LJLA 3G1LA 5D18A 5IOZA 4V2FA 2UXOA 1Z77A 2ZB9A 3PM1A 4ABZA 3QQAA 2HXOA 2REKA 3SFIA 3HTJA 3RD3A 4D5FA 3VVXA 2WV1A 3VW2A 4GCTA 5F27A 2FD5A 4DW6A 3ZQFA 3HTAA 2GENA 4AC6A 2X6OA 2GFNA 3COLA 4JKZA 2JK3A 3EUPA 2HYTA 4JL3A 2NP5A 3NNRA 3AQSA 3RH2A 3GZIA 5K58A 4JYKA 3CWRA 5EZHA 3BHQA 3ZQHA 2VPRA 3IH2A 1T56A 1T33A 4X1EA 2ZCMA 2RASA 5FKLA 3BR2A 2HYJA 5CW8A 2FQ4A 3KNWA 2GUHA 4M3GA 2YVEA 3BR6A 3VOXA 1U9OA 3MNLA 3BQZA 3VOKA 2NS7A 2IAIA 2NP3A 2RAEA 2UXHA 3G56A 1UI6A 2HQ5A 2EH3A 3ANGA 2XGEA 2UXUA 4L62A 2UXPA 1U9NA 4V2GA 2Y30A 4MK6A 5F0HA 3HIMA 4B3AA 2YVHA 1ZK8A 5HAWA 4I76A 3F1BA 2FBQA 3VVZA 3LSRA 3FK6A 1UI5A 3C2BA 2ZCNA 3BRUA 1QVUA 3LOCA 4CGRA 3QBMA 5J1YA 2VKVA 3ON4A 3HTIA 2IEKA 2XPUA 3C07A 2G7SA 4M3EA 2NX4A 3JSJA 3BQYA 5CXGA 5GPCA 1RPWA 3LSPA 4NELA 3ZQGA 3V6GA 2QOPA 3HGYA 3NXCA 5FHPA 2UXIA 2FX0A 4GFLA 1RKTA 1ZKGA 5HBUA 5F1JA 2XRLA 4NN1A 2PBXA 3NI7A 2JJ7A 5EYRA 2ZOYA 2ID3A 3NRGA 2XPWA 1JT6A 2ZCXA 5FKMA 2NS8A 4D7MA 2TCTA 3KZ9A 3Q0UA 3IH3A 4ME9A 2XB5A 2G7LA 2D6YA 3PPBA 2VKEA 3BTIA 3VW0A 3LWJA 3VW1A 3PASA 4JNNA 5D19A 2DTZA 1QPIA 3ZQIA 5F04A 4MXMA 3VP5A 5FMPA 4GCKA 3ON2A 3BR5A 5IPAA 3O60A 2V57A 2PZ9A 2FJ1A 3KKCA 3DPJA 3E7QA 2XGDA 2QIBA 1SGMA 4W1UA 4XK4A 3EGQA 5FKNA 2XGCA 3QPSA 3T6NA 2ID6A 5EFYA 3BCGA 3HE0A 4D7NA 3MVPA 3AQTA 3HGGA 4M3BA 3S5RA 4AC0A 1A6IA 1ORKA 3P9TA 5DAJA 4AUXA 3VIBA 3LHQA 2G0EA 3DEWA 2OI8A 3KKDA 5FKKA 3IUVA 2GBYA 5D1RA 1JTYA 3BR0A 2IU5A 4G12A 3F0CA 3Q3SA 3VUQA 1JUPA 4GCLA 1QVTA 3O8HA 5FGLA 2WGBA 3FIWA 2IBDA 2W53A 3CJDA 5J1RA 3WHCA 5C4YA 4I6ZA 3CRJA 3FRQA 5AQCA 4M3FA 3B6CA 2OERA 5H9TA 4KWAA 3NPIA 2QCOA 2HKUA 3ANPA 2ZOZA 2Y31A 3CDLA 4D5CA 5EZGA 3G1OA 2TRTA 5K7ZA 3GEUA 3G1MA 3QKXA 4M3DA 3LSJA 4HKUA 3V78A 5F0FA 3BR3A 2Y2ZA 3B81A 3ZQLA 2O7TA 3HTHA 3G7RA 3TP0A 1JT0A 3IH4A 1Z0XA 3SDGA 3QPLA 3TP3A 2HXIA 4MO7A 4W97A 5HSZA 2G3BA 3Q0WA 1JUMA 3Q0VA 4GFKA 3BTCA 4PXIA 1JUSA 2XPVA 2OF7A 1RKWA 3BT9A 5K7HA 2QWTA 3CCYA 5FKOA 5K7FA 2I10A 3FK7A 2QKOA 2F07A 2O7OA 4UDSA 3VPRA 5F0CA 2Q24A 2OPTA 5GP9A 4AF5A 2QTQA 5J3LA 3B6AA 4ICHA 4ACIA 3BTJA 2DG8A 2G7GA 3O8GA 5IP6A 5GPAA 1VI0A 2DG7A 5F08A 1JTXA 2RHAA 5IOYA 2X9DA 3BR1A 1BJZA 2WUIA 3BTLA 3VVYA 4YZEA 5CXIA 3BNIA 4B1RA 2XDNA 3WHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCF A;  5J1U A;  3BJB A;  3LJL A;  3G1L A;  5D18 A;  5IOZ A;  4V2F A;  2UXO A;  1Z77 A;  2ZB9 A;  3PM1 A;  4ABZ A;  3QQA A;  2HXO A;  2REK A;  3SFI A;  3HTJ A;  3RD3 A;  4D5F A;  3VVX A;  2WV1 A;  3VW2 A;  4GCT A;  5F27 A;  2FD5 A;  4DW6 A;  3ZQF A;  3HTA A;  2GEN A;  4AC6 A;  2X6O A;  2GFN A;  3COL A;  4JKZ A;  2JK3 A;  3EUP A;  2HYT A;  4JL3 A;  2NP5 A;  3NNR A;  3AQS A;  3RH2 A;  3GZI A;  5K58 A;  4JYK A;  3CWR A;  5EZH A;  3BHQ A;  3ZQH A;  2VPR A;  3IH2 A;  1T56 A;  1T33 A;  4X1E A;  2ZCM A;  2RAS A;  5FKL A;  3BR2 A;  2HYJ A;  5CW8 A;  2FQ4 A;  3KNW A;  2GUH A;  4M3G A;  2YVE A;  3BR6 A;  3VOX A;  1U9O A;  3MNL A;  3BQZ A;  3VOK A;  2NS7 A;  2IAI A;  2NP3 A;  2RAE A;  2UXH A;  3G56 A;  1UI6 A;  2HQ5 A;  2EH3 A;  3ANG A;  2XGE A;  2UXU A;  4L62 A;  2UXP A;  1U9N A;  4V2G A;  2Y30 A;  4MK6 A;  5F0H A;  3HIM A;  4B3A A;  2YVH A;  1ZK8 A;  5HAW A;  4I76 A;  3F1B A;  2FBQ A;  3VVZ A;  3LSR A;  3FK6 A;  1UI5 A;  3C2B A;  2ZCN A;  3BRU A;  1QVU A;  3LOC A;  4CGR A;  3QBM A;  5J1Y A;  2VKV A;  3ON4 A;  3HTI A;  2IEK A;  2XPU A;  3C07 A;  2G7S A;  4M3E A;  2NX4 A;  3JSJ A;  3BQY A;  5CXG A;  5GPC A;  1RPW A;  3LSP A;  4NEL A;  3ZQG A;  3V6G A;  2QOP A;  3HGY A;  3NXC A;  5FHP A;  2UXI A;  2FX0 A;  4GFL A;  1RKT A;  1ZKG A;  5HBU A;  5F1J A;  2XRL A;  4NN1 A;  2PBX A;  3NI7 A;  2JJ7 A;  5EYR A;  2ZOY A;  2ID3 A;  3NRG A;  2XPW A;  1JT6 A;  2ZCX A;  5FKM A;  2NS8 A;  4D7M A;  2TCT A;  3KZ9 A;  3Q0U A;  3IH3 A;  4ME9 A;  2XB5 A;  2G7L A;  2D6Y A;  3PPB A;  2VKE A;  3BTI A;  3VW0 A;  3LWJ A;  3VW1 A;  3PAS A;  4JNN A;  5D19 A;  2DTZ A;  1QPI A;  3ZQI A;  5F04 A;  4MXM A;  3VP5 A;  5FMP A;  4GCK A;  3ON2 A;  3BR5 A;  5IPA A;  3O60 A;  2V57 A;  2PZ9 A;  2FJ1 A;  3KKC A;  3DPJ A;  3E7Q A;  2XGD A;  2QIB A;  1SGM A;  4W1U A;  4XK4 A;  3EGQ A;  5FKN A;  2XGC A;  3QPS A;  3T6N A;  2ID6 A;  5EFY A;  3BCG A;  3HE0 A;  4D7N A;  3MVP A;  3AQT A;  3HGG A;  4M3B A;  3S5R A;  4AC0 A;  1A6I A;  1ORK A;  3P9T A;  5DAJ A;  4AUX A;  3VIB A;  3LHQ A;  2G0E A;  3DEW A;  2OI8 A;  3KKD A;  5FKK A;  3IUV A;  2GBY A;  5D1R A;  1JTY A;  3BR0 A;  2IU5 A;  4G12 A;  3F0C A;  3Q3S A;  3VUQ A;  1JUP A;  4GCL A;  1QVT A;  3O8H A;  5FGL A;  2WGB A;  3FIW A;  2IBD A;  2W53 A;  3CJD A;  5J1R A;  3WHC A;  5C4Y A;  4I6Z A;  3CRJ A;  3FRQ A;  5AQC A;  4M3F A;  3B6C A;  2OER A;  5H9T A;  4KWA A;  3NPI A;  2QCO A;  2HKU A;  3ANP A;  2ZOZ A;  2Y31 A;  3CDL A;  4D5C A;  5EZG A;  3G1O A;  2TRT A;  5K7Z A;  3GEU A;  3G1M A;  3QKX A;  4M3D A;  3LSJ A;  4HKU A;  3V78 A;  5F0F A;  3BR3 A;  2Y2Z A;  3B81 A;  3ZQL A;  2O7T A;  3HTH A;  3G7R A;  3TP0 A;  1JT0 A;  3IH4 A;  1Z0X A;  3SDG A;  3QPL A;  3TP3 A;  2HXI A;  4MO7 A;  4W97 A;  5HSZ A;  2G3B A;  3Q0W A;  1JUM A;  3Q0V A;  4GFK A;  3BTC A;  4PXI A;  1JUS A;  2XPV A;  2OF7 A;  1RKW A;  3BT9 A;  5K7H A;  2QWT A;  3CCY A;  5FKO A;  5K7F A;  2I10 A;  3FK7 A;  2QKO A;  2F07 A;  2O7O A;  4UDS A;  3VPR A;  5F0C A;  2Q24 A;  2OPT A;  5GP9 A;  4AF5 A;  2QTQ A;  5J3L A;  3B6A A;  4ICH A;  4ACI A;  3BTJ A;  2DG8 A;  2G7G A;  3O8G A;  5IP6 A;  5GPA A;  1VI0 A;  2DG7 A;  5F08 A;  1JTX A;  2RHA A;  5IOY A;  2X9D A;  3BR1 A;  1BJZ A;  2WUI A;  3BTL A;  3VVY A;  4YZE A;  5CXI A;  3BNI A;  4B1R A;  2XDN A;  3WHB A; 
#chains in the Genus database with same CATH topology
 3DCF A;  5J1U A;  3BJB A;  3LJL A;  3G1L A;  5D18 A;  5IOZ A;  4V2F A;  2UXO A;  1Z77 A;  2ZB9 A;  3PM1 A;  4ABZ A;  3QQA A;  4U9N A;  2HXO A;  2FJI 1;  2REK A;  3SFI A;  3HTJ A;  3RD3 A;  4D5F A;  3VVX A;  2WV1 A;  3VW2 A;  4GCT A;  5F27 A;  2FD5 A;  4DW6 A;  3ZQF A;  3HTA A;  2GEN A;  4IRV A;  4AC6 A;  2X6O A;  2GFN A;  3COL A;  4JKZ A;  2JK3 A;  3EUP A;  2HYT A;  4JL3 A;  2NP5 A;  3NNR A;  3AQS A;  3RH2 A;  3GZI A;  5K58 A;  4JYK A;  3CWR A;  5EZH A;  3BHQ A;  3ZQH A;  2VPR A;  3IH2 A;  1T56 A;  1T33 A;  4X1E A;  2ZCM A;  2RAS A;  5FKL A;  3BR2 A;  2HYJ A;  5CW8 A;  2FQ4 A;  3KNW A;  2GUH A;  4M3G A;  2YVE A;  3BR6 A;  3VOX A;  3FHN A;  1U9O A;  3MNL A;  3BQZ A;  3VOK A;  2NS7 A;  2IAI A;  2NP3 A;  2YVX A;  2RAE A;  2UXH A;  3G56 A;  1UI6 A;  2HQ5 A;  2EH3 A;  3ANG A;  2XGE A;  2UXU A;  4L62 A;  2UXP A;  1U9N A;  4V2G A;  2Y30 A;  4MK6 A;  5F0H A;  2R7R A;  3HIM A;  4OD4 A;  4B3A A;  2YVH A;  1ZK8 A;  5HAW A;  4I76 A;  3F1B A;  2FBQ A;  2ZY9 A;  3VVZ A;  3K8P C;  3LSR A;  3FK6 A;  1UI5 A;  3C2B A;  2ZCN A;  3BRU A;  1QVU A;  3LOC A;  4CGR A;  3QBM A;  5J1Y A;  2VKV A;  3ON4 A;  3HTI A;  2IEK A;  2XPU A;  4WIB A;  3C07 A;  2G7S A;  4M3E A;  2NX4 A;  3JSJ A;  3BQY A;  5CXG A;  2R7O A;  5GPC A;  1RPW A;  3LSP A;  4NEL A;  3ZQG A;  3V6G A;  4U9L A;  2QOP A;  3HGY A;  3NXC A;  5FHP A;  4OD5 A;  2UXI A;  2FX0 A;  4GFL A;  1RKT A;  1ZKG A;  2B3W A;  5HBU A;  5F1J A;  2XRL A;  4NN1 A;  2PBX A;  3NI7 A;  2JJ7 A;  5EYR A;  2ZOY A;  2ID3 A;  3NRG A;  2XPW A;  1JT6 A;  2ZCX A;  3VTI A;  5FKM A;  2NS8 A;  4D7M A;  2TCT A;  3KZ9 A;  3Q0U A;  3IH3 A;  4ME9 A;  2A2F X;  3NS4 A;  2XB5 A;  2G7L A;  2D6Y A;  3DU5 A;  2R7Q A;  3PPB A;  2VKE A;  3BTI A;  3VW0 A;  3LWJ A;  3VW1 A;  3PAS A;  4JNN A;  5D19 A;  2DTZ A;  1QPI A;  2PFV A;  3ZQI A;  5F04 A;  4MXM A;  3VP5 A;  5FMP A;  4GCK A;  3ON2 A;  3BR5 A;  5IPA A;  3O60 A;  2V57 A;  2PZ9 A;  2FJ1 A;  3KKC A;  3DPJ A;  3E7Q A;  2R7T A;  2XGD A;  2QIB A;  2R7X A;  1SGM A;  4W1U A;  4XK4 A;  3EGQ A;  5FKN A;  2XGC A;  3QPS A;  3T6N A;  2ID6 A;  5EFY A;  2B1E A;  3BCG A;  3HE0 A;  4D7N A;  3MVP A;  3AQT A;  3HGG A;  4M3B A;  3S5R A;  3DU6 A;  4AC0 A;  1A6I A;  1ORK A;  3P9T A;  5DAJ A;  4AUX A;  3VIB A;  3LHQ A;  2G0E A;  3DEW A;  2OI8 A;  3KKD A;  5FKK A;  3IUV A;  2GBY A;  5D1R A;  1JTY A;  3BR0 A;  2IU5 A;  4G12 A;  3F0C A;  3Q3S A;  3VUQ A;  1JUP A;  4GCL A;  1QVT A;  3O8H A;  5FGL A;  2WGB A;  3FIW A;  2IBD A;  2W53 A;  3CJD A;  3WHC A;  5J1R A;  5C4Y A;  4I6Z A;  3CRJ A;  3FRQ A;  5AQC A;  4M3F A;  3B6C A;  3SWH A;  2OER A;  5H9T A;  2R7S A;  4KWA A;  3NPI A;  3KYL A;  2QCO A;  2HKU A;  3ANP A;  2ZOZ A;  2Y31 A;  3CDL A;  4D5C A;  5EZG A;  5CQG A;  3G1O A;  2TRT A;  5K7Z A;  3GEU A;  3G1M A;  3QKX A;  4M3D A;  3LSJ A;  4HKU A;  3V78 A;  5F0F A;  3BR3 A;  2Y2Z A;  3B81 A;  3ZQL A;  2O7T A;  3HTH A;  3G7R A;  3TP0 A;  1JT0 A;  3IH4 A;  1Z0X A;  3SDG A;  3QPL A;  3TP3 A;  2HXI A;  2R7W A;  4MO7 A;  4W97 A;  5HSZ A;  2G3B A;  3Q0W A;  1JUM A;  3Q0V A;  4GFK A;  3BTC A;  4DVY P;  4PXI A;  1JUS A;  2XPV A;  2OF7 A;  1RKW A;  3BT9 A;  5K7H A;  2QWT A;  3CCY A;  5FKO A;  5K7F A;  2I10 A;  3FK7 A;  2QKO A;  2F07 A;  2O7O A;  4UDS A;  3VPR A;  5F0C A;  2Q24 A;  2OPT A;  5GP9 A;  4AF5 A;  2QTQ A;  5J3L A;  3B6A A;  4ICH A;  4ACI A;  2R7V A;  3BTJ A;  4C2M A;  2R7U A;  2DG8 A;  2G7G A;  3O8G A;  5IP6 A;  5GPA A;  1VI0 A;  2DG7 A;  5F08 A;  1JTX A;  2RHA A;  2X9D A;  5IOY A;  3BR1 A;  1BJZ A;  2WUI A;  3BTL A;  3VVY A;  4YZE A;  5CXI A;  3BNI A;  4B1R A;  2XDN A;  3WHB A; 
#chains in the Genus database with same CATH homology
 3DCF A;  5J1U A;  3BJB A;  3LJL A;  3G1L A;  5D18 A;  5IOZ A;  4V2F A;  2UXO A;  1Z77 A;  2ZB9 A;  3PM1 A;  4ABZ A;  3QQA A;  2HXO A;  2REK A;  3SFI A;  3HTJ A;  3RD3 A;  4D5F A;  3VVX A;  2WV1 A;  3VW2 A;  4GCT A;  5F27 A;  2FD5 A;  4DW6 A;  3ZQF A;  3HTA A;  2GEN A;  4AC6 A;  2X6O A;  2GFN A;  3COL A;  4JKZ A;  2JK3 A;  3EUP A;  2HYT A;  4JL3 A;  2NP5 A;  3NNR A;  3AQS A;  3RH2 A;  3GZI A;  5K58 A;  4JYK A;  3CWR A;  5EZH A;  3BHQ A;  3ZQH A;  2VPR A;  3IH2 A;  1T56 A;  1T33 A;  4X1E A;  2ZCM A;  2RAS A;  5FKL A;  3BR2 A;  2HYJ A;  5CW8 A;  2FQ4 A;  3KNW A;  2GUH A;  4M3G A;  2YVE A;  3BR6 A;  3VOX A;  1U9O A;  3MNL A;  3BQZ A;  3VOK A;  2NS7 A;  2IAI A;  2NP3 A;  2RAE A;  2UXH A;  3G56 A;  1UI6 A;  2HQ5 A;  2EH3 A;  3ANG A;  2XGE A;  2UXU A;  4L62 A;  2UXP A;  1U9N A;  4V2G A;  2Y30 A;  4MK6 A;  5F0H A;  3HIM A;  4B3A A;  2YVH A;  1ZK8 A;  5HAW A;  4I76 A;  3F1B A;  2FBQ A;  3VVZ A;  3LSR A;  3FK6 A;  1UI5 A;  3C2B A;  2ZCN A;  3BRU A;  1QVU A;  3LOC A;  4CGR A;  3QBM A;  5J1Y A;  2VKV A;  3ON4 A;  3HTI A;  2IEK A;  2XPU A;  3C07 A;  2G7S A;  4M3E A;  2NX4 A;  3JSJ A;  3BQY A;  5CXG A;  5GPC A;  1RPW A;  3LSP A;  4NEL A;  3ZQG A;  3V6G A;  2QOP A;  3HGY A;  3NXC A;  5FHP A;  2UXI A;  2FX0 A;  4GFL A;  1RKT A;  1ZKG A;  5HBU A;  5F1J A;  2XRL A;  4NN1 A;  2PBX A;  3NI7 A;  2JJ7 A;  5EYR A;  2ZOY A;  2ID3 A;  3NRG A;  2XPW A;  1JT6 A;  2ZCX A;  5FKM A;  2NS8 A;  4D7M A;  2TCT A;  3KZ9 A;  3Q0U A;  3IH3 A;  4ME9 A;  2XB5 A;  2G7L A;  2D6Y A;  3PPB A;  2VKE A;  3BTI A;  3VW0 A;  3LWJ A;  3VW1 A;  3PAS A;  4JNN A;  5D19 A;  2DTZ A;  1QPI A;  3ZQI A;  5F04 A;  4MXM A;  3VP5 A;  5FMP A;  4GCK A;  3ON2 A;  3BR5 A;  5IPA A;  3O60 A;  2V57 A;  2PZ9 A;  2FJ1 A;  3KKC A;  3DPJ A;  3E7Q A;  2XGD A;  2QIB A;  1SGM A;  4W1U A;  4XK4 A;  3EGQ A;  5FKN A;  2XGC A;  3QPS A;  3T6N A;  2ID6 A;  5EFY A;  3BCG A;  3HE0 A;  4D7N A;  3MVP A;  3AQT A;  3HGG A;  4M3B A;  3S5R A;  4AC0 A;  1A6I A;  1ORK A;  3P9T A;  5DAJ A;  4AUX A;  3VIB A;  3LHQ A;  2G0E A;  3DEW A;  2OI8 A;  3KKD A;  5FKK A;  3IUV A;  2GBY A;  5D1R A;  1JTY A;  3BR0 A;  2IU5 A;  4G12 A;  3F0C A;  3Q3S A;  3VUQ A;  1JUP A;  4GCL A;  1QVT A;  3O8H A;  5FGL A;  2WGB A;  3FIW A;  2IBD A;  2W53 A;  3CJD A;  5J1R A;  3WHC A;  5C4Y A;  4I6Z A;  3CRJ A;  3FRQ A;  5AQC A;  4M3F A;  3B6C A;  2OER A;  5H9T A;  4KWA A;  3NPI A;  2QCO A;  2HKU A;  3ANP A;  2ZOZ A;  2Y31 A;  3CDL A;  4D5C A;  5EZG A;  3G1O A;  2TRT A;  5K7Z A;  3GEU A;  3G1M A;  3QKX A;  4M3D A;  3LSJ A;  4HKU A;  3V78 A;  5F0F A;  3BR3 A;  2Y2Z A;  3B81 A;  3ZQL A;  2O7T A;  3HTH A;  3G7R A;  3TP0 A;  1JT0 A;  3IH4 A;  1Z0X A;  3SDG A;  3QPL A;  3TP3 A;  2HXI A;  4MO7 A;  4W97 A;  5HSZ A;  2G3B A;  3Q0W A;  1JUM A;  3Q0V A;  4GFK A;  3BTC A;  4PXI A;  1JUS A;  2XPV A;  2OF7 A;  1RKW A;  3BT9 A;  5K7H A;  2QWT A;  3CCY A;  5FKO A;  5K7F A;  2I10 A;  3FK7 A;  2QKO A;  2F07 A;  2O7O A;  4UDS A;  3VPR A;  5F0C A;  2Q24 A;  2OPT A;  5GP9 A;  4AF5 A;  2QTQ A;  5J3L A;  3B6A A;  4ICH A;  4ACI A;  3BTJ A;  2DG8 A;  2G7G A;  3O8G A;  5IP6 A;  5GPA A;  1VI0 A;  2DG7 A;  5F08 A;  1JTX A;  2RHA A;  5IOY A;  2X9D A;  3BR1 A;  1BJZ A;  2WUI A;  3BTL A;  3VVY A;  4YZE A;  5CXI A;  3BNI A;  4B1R A;  2XDN A;  3WHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...