2REKA

Crystal structure of tetr-family transcriptional regulator
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
181
structure length
172
Chain Sequence
ADARRNYDRIIEAAAAEVARHGADASLEEIARRAGVGSATLHRHFPSRWGLLQAVFQERVAQLCDEARSLAAEHPPATALTRWLTSLAVFGAVTRGAARSLAALDSRCEQLLTEAGADLLARAQEDGTVRDDVTALELLSLANAVSLAAEHTPDAAHHATRLMGIALGGLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR-family transcriptional regulator
publication title Crystal structure of tetR-family transcriptional regulator.
rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
total genus 70
structure length 172
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2rekA00
2W53A 4JYKA 1JUPA 3IH4A 1A6IA 5EFYA 1JTYA 4ACIA 2G7GA 2UXPA 3V6GA 3BHQA 3BTJA 3CCYA 2QWTA 1QVTA 2OPTA 2HXIA 3AQSA 1BJZA 3RH2A 3VVZA 2O7TA 3GEUA 5J1RA 4HKUA 5HSZA 2Y31A 3Q0UA 2VKVA 2G3BA 3ANPA 3FK6A 5K7HA 3NI7A 1JT6A 3O8HA 3S5RA 5FGLA 3NNRA 4M3BA 3DPJA 4MXMA 3F1BA 3MNLA 2O7OA 3VPRA 3BR6A 3PPBA 1UI6A 5DAJA 5CW8A 2QCOA 5F0FA 3G1MA 5IP6A 4NELA 4MK6A 2G7SA 2DTZA 3NRGA 3QPSA 2NX4A 2XB5A 4D5FA 2X6OA 4W97A 3CWRA 3V78A 5IOZA 3O60A 1ZK8A 3BR2A 2UXUA 4GFLA 2QKOA 5J1YA 3CRJA 3JSJA 4W1UA 3HGGA 2G0EA 1UI5A 3ZQIA 4V2FA 4D7NA 2VPRA 3Q0WA 2GBYA 4GCKA 4AUXA 3VP5A 3G1LA 5GPCA 5GP9A 3B6AA 3EUPA 4MO7A 3BQYA 2WV1A 1ZKGA 3E7QA 3ZQGA 3BTLA 3GZIA 5FMPA 3MVPA 3CJDA 2OF7A 3DEWA 2NP5A 3Q3SA 2QOPA 2NS7A 3B81A 2VKEA 5HAWA 2TCTA 3WHCA 2GENA 1Z77A 3BTCA 4M3FA 3IH3A 3FRQA 2IBDA 2XRLA 3VIBA 2YVHA 3Q0VA 2DG8A 2HYTA 2NS8A 3LSJA 1QPIA 4D7MA 2IU5A 3EGQA 2ID6A 4GCLA 3T6NA 3G1OA 5IOYA 2EH3A 1JUSA 2HKUA 3DCFA 2ZCMA 2RHAA 3PM1A 3HE0A 5F0CA 3C2BA 2I10A 2JJ7A 2OERA 1RPWA 3VVYA 3BT9A 5EYRA 3HTJA 2UXIA 4ABZA 2ZCNA 5D1RA 2HQ5A 3G7RA 3BR1A 3HIMA 1JTXA 3VW0A 3HTHA 5FKNA 5F1JA 3BJBA 3KKCA 3P9TA 5F08A 2WGBA 2PZ9A 1U9OA 5K7FA 2HXOA 2QTQA 5CXGA 3O8GA 2ZOYA 3ANGA 2OI8A 3VOKA 2D6YA 5FKLA 2FD5A 1T56A 3HTAA 3PASA 2XPVA 3ZQLA 3ZQFA 4XK4A 4DW6A 3HTIA 2UXOA 2DG7A 4M3DA 4NN1A 3F0CA 5F27A 5K7ZA 2Y2ZA 4AC0A 2XPWA 2REKA 4I76A 2XGDA 3LSRA 1JT0A 3G56A 1RKWA 1VI0A 5CXIA 3KZ9A 3LJLA 5D18A 2GUHA 2YVEA 5F04A 3ON2A 3FIWA 3VOXA 3TP3A 4B3AA 5H9TA 4M3EA 2FBQA 5F0HA 2ZOZA 5FKOA 3SDGA 4G12A 3LSPA 3CDLA 2RASA 4YZEA 3BQZA 3KKDA 5J3LA 3KNWA 2XGEA 2FJ1A 2XPUA 3QKXA 2JK3A 3BCGA 3FK7A 3BRUA 1SGMA 2GFNA 3NXCA 5AQCA 1T33A 3IUVA 3BNIA 4AF5A 2X9DA 4ICHA 2WUIA 3VVXA 2G7LA 3HGYA 2PBXA 4CGRA 5K58A 3IH2A 4V2GA 5HBUA 2ID3A 4JNNA 3TP0A 3LHQA 4I6ZA 4AC6A 5EZHA 3COLA 2FX0A 2IAIA 3QPLA 5FKMA 3QBMA 2FQ4A 3LWJA 5D19A 3LOCA 1U9NA 1QVUA 3WHBA 2ZB9A 3BR5A 5GPAA 1JUMA 3BR0A 4UDSA 5C4YA 3NPIA 2ZCXA 4M3GA 4JL3A 2HYJA 1RKTA 4D5CA 2QIBA 5FKKA 2V57A 4JKZA 5FHPA 2IEKA 3C07A 4KWAA 5J1UA 4ME9A 1Z0XA 4B1RA 2UXHA 2F07A 3ON4A 3VW1A 4GCTA 3B6CA 2XDNA 3QQAA 3BTIA 3ZQHA 2NP3A 3RD3A 4GFKA 3AQTA 5EZGA 2TRTA 3VW2A 4X1EA 1ORKA 3BR3A 4L62A 2RAEA 5IPAA 2Q24A 3SFIA 3VUQA 2Y30A 4PXIA 2XGCA
chains in the Genus database with same CATH superfamily
2W53A 4JYKA 1JUPA 3IH4A 1A6IA 5EFYA 1JTYA 4ACIA 2G7GA 2UXPA 3DU5A 3V6GA 3BHQA 3BTJA 3CCYA 2QWTA 1QVTA 2OPTA 2HXIA 3AQSA 1BJZA 3RH2A 3VVZA 2O7TA 3GEUA 5J1RA 4HKUA 5HSZA 2B1EA 2Y31A 3Q0UA 2VKVA 2G3BA 4U9NA 3ANPA 3FK6A 5K7HA 3NI7A 1JT6A 4U9LA 3O8HA 2B3WA 3S5RA 5FGLA 3NNRA 4M3BA 2ZY9A 3DPJA 4MXMA 3F1BA 3MNLA 2O7OA 3VPRA 3BR6A 3PPBA 1UI6A 5DAJA 5CW8A 2QCOA 5F0FA 5CQGA 3G1MA 5IP6A 4NELA 4MK6A 2G7SA 2DTZA 3NRGA 3QPSA 2NX4A 2XB5A 4D5FA 2X6OA 4W97A 3CWRA 3V78A 2R7VA 5IOZA 3O60A 1ZK8A 3BR2A 2UXUA 4GFLA 2QKOA 5J1YA 3CRJA 3JSJA 4W1UA 3HGGA 2G0EA 1UI5A 3ZQIA 4V2FA 4D7NA 2VPRA 3Q0WA 2GBYA 4GCKA 2A2FX 4AUXA 3VP5A 3G1LA 5GPCA 5GP9A 3B6AA 3EUPA 2FJI1 4MO7A 3BQYA 2WV1A 1ZKGA 3E7QA 3ZQGA 3BTLA 3GZIA 5FMPA 4DVYP 3MVPA 4WIBA 3CJDA 2OF7A 3DEWA 2NP5A 3Q3SA 2QOPA 2NS7A 3B81A 2VKEA 5HAWA 2TCTA 3WHCA 2GENA 1Z77A 3BTCA 4M3FA 2R7WA 3IH3A 3FRQA 2R7QA 2IBDA 2XRLA 3VIBA 4OD5A 2YVHA 3Q0VA 2DG8A 2HYTA 2NS8A 3VTIA 3LSJA 1QPIA 4D7MA 2IU5A 3EGQA 2ID6A 4GCLA 3T6NA 3G1OA 5IOYA 2EH3A 1JUSA 2HKUA 3DCFA 2ZCMA 2RHAA 3PM1A 3HE0A 5F0CA 3C2BA 2I10A 2JJ7A 2OERA 1RPWA 3VVYA 3BT9A 5EYRA 3HTJA 2UXIA 4ABZA 2ZCNA 5D1RA 2HQ5A 3G7RA 2YVXA 2R7TA 3BR1A 3HIMA 1JTXA 3VW0A 3HTHA 5FKNA 5F1JA 3BJBA 3KKCA 3P9TA 3DU6A 5F08A 2WGBA 2PZ9A 1U9OA 5K7FA 2R7OA 2HXOA 2QTQA 5CXGA 3O8GA 2ZOYA 3ANGA 2OI8A 3VOKA 2D6YA 5FKLA 2FD5A 1T56A 3HTAA 3PASA 2XPVA 3ZQLA 3ZQFA 4XK4A 3SWHA 4DW6A 3HTIA 2UXOA 2DG7A 4M3DA 4NN1A 3F0CA 5F27A 5K7ZA 2Y2ZA 4AC0A 2XPWA 2REKA 4I76A 2XGDA 3LSRA 1JT0A 3G56A 1RKWA 1VI0A 5CXIA 2R7UA 3KZ9A 3LJLA 5D18A 2GUHA 2YVEA 5F04A 3ON2A 3FIWA 3VOXA 3TP3A 4B3AA 5H9TA 4M3EA 2FBQA 5F0HA 2ZOZA 5FKOA 3SDGA 4G12A 3LSPA 3CDLA 2RASA 4YZEA 3K8PC 3BQZA 3KKDA 5J3LA 2PFVA 3NS4A 4IRVA 3KNWA 2XGEA 2FJ1A 2XPUA 3QKXA 2JK3A 3BCGA 3FK7A 3BRUA 1SGMA 2GFNA 3NXCA 5AQCA 1T33A 3IUVA 3BNIA 4AF5A 2X9DA 4ICHA 2WUIA 3VVXA 2G7LA 3HGYA 2PBXA 4CGRA 5K58A 3IH2A 4V2GA 5HBUA 2ID3A 4JNNA 3TP0A 3LHQA 4C2MA 4I6ZA 4AC6A 5EZHA 3COLA 2FX0A 2IAIA 3QPLA 5FKMA 3QBMA 2FQ4A 3LWJA 5D19A 3LOCA 1U9NA 1QVUA 3WHBA 3KYLA 2ZB9A 2R7XA 3BR5A 5GPAA 1JUMA 3BR0A 4UDSA 5C4YA 3NPIA 2ZCXA 4M3GA 4JL3A 2HYJA 1RKTA 4D5CA 2QIBA 5FKKA 2R7SA 2V57A 4JKZA 5FHPA 2IEKA 3C07A 4KWAA 5J1UA 4ME9A 1Z0XA 4B1RA 2UXHA 2F07A 3ON4A 3VW1A 4GCTA 3B6CA 2XDNA 3QQAA 3FHNA 3BTIA 3ZQHA 2NP3A 3RD3A 4GFKA 3AQTA 5EZGA 2TRTA 3VW2A 4X1EA 1ORKA 3BR3A 4L62A 2RAEA 5IPAA 4OD4A 2Q24A 3SFIA 3VUQA 2R7RA 2Y30A 4PXIA 2XGCA
chains in the Genus database with same CATH topology
2W53A 4JYKA 1JUPA 3IH4A 1A6IA 5EFYA 1JTYA 4ACIA 2G7GA 2UXPA 3V6GA 3BHQA 3BTJA 3CCYA 2QWTA 1QVTA 2OPTA 2HXIA 3AQSA 1BJZA 3RH2A 3VVZA 2O7TA 3GEUA 5J1RA 4HKUA 5HSZA 2Y31A 3Q0UA 2VKVA 2G3BA 3ANPA 3FK6A 5K7HA 3NI7A 1JT6A 3O8HA 3S5RA 5FGLA 3NNRA 4M3BA 3DPJA 4MXMA 3F1BA 3MNLA 2O7OA 3VPRA 3BR6A 3PPBA 1UI6A 5DAJA 5CW8A 2QCOA 5F0FA 3G1MA 5IP6A 4NELA 4MK6A 2G7SA 2DTZA 3NRGA 3QPSA 2NX4A 2XB5A 4D5FA 2X6OA 4W97A 3CWRA 3V78A 5IOZA 3O60A 1ZK8A 3BR2A 2UXUA 4GFLA 2QKOA 5J1YA 3CRJA 3JSJA 4W1UA 3HGGA 2G0EA 1UI5A 3ZQIA 4V2FA 4D7NA 2VPRA 3Q0WA 2GBYA 4GCKA 4AUXA 3VP5A 3G1LA 5GPCA 5GP9A 3B6AA 3EUPA 4MO7A 3BQYA 2WV1A 1ZKGA 3E7QA 3ZQGA 3BTLA 3GZIA 5FMPA 3MVPA 3CJDA 2OF7A 3DEWA 2NP5A 3Q3SA 2QOPA 2NS7A 3B81A 2VKEA 5HAWA 2TCTA 3WHCA 2GENA 1Z77A 3BTCA 4M3FA 3IH3A 3FRQA 2IBDA 2XRLA 3VIBA 2YVHA 3Q0VA 2DG8A 2HYTA 2NS8A 3LSJA 1QPIA 4D7MA 2IU5A 3EGQA 2ID6A 4GCLA 3T6NA 3G1OA 5IOYA 2EH3A 1JUSA 2HKUA 3DCFA 2ZCMA 2RHAA 3PM1A 3HE0A 5F0CA 3C2BA 2I10A 2JJ7A 2OERA 1RPWA 3VVYA 3BT9A 5EYRA 3HTJA 2UXIA 4ABZA 2ZCNA 5D1RA 2HQ5A 3G7RA 3BR1A 3HIMA 1JTXA 3VW0A 3HTHA 5FKNA 5F1JA 3BJBA 3KKCA 3P9TA 5F08A 2WGBA 2PZ9A 1U9OA 5K7FA 2HXOA 2QTQA 5CXGA 3O8GA 2ZOYA 3ANGA 2OI8A 3VOKA 2D6YA 5FKLA 2FD5A 1T56A 3HTAA 3PASA 2XPVA 3ZQLA 3ZQFA 4XK4A 4DW6A 3HTIA 2UXOA 2DG7A 4M3DA 4NN1A 3F0CA 5F27A 5K7ZA 2Y2ZA 4AC0A 2XPWA 2REKA 4I76A 2XGDA 3LSRA 1JT0A 3G56A 1RKWA 1VI0A 5CXIA 3KZ9A 3LJLA 5D18A 2GUHA 2YVEA 5F04A 3ON2A 3FIWA 3VOXA 3TP3A 4B3AA 5H9TA 4M3EA 2FBQA 5F0HA 2ZOZA 5FKOA 3SDGA 4G12A 3LSPA 3CDLA 2RASA 4YZEA 3BQZA 3KKDA 5J3LA 3KNWA 2XGEA 2FJ1A 2XPUA 3QKXA 2JK3A 3BCGA 3FK7A 3BRUA 1SGMA 2GFNA 3NXCA 5AQCA 1T33A 3IUVA 3BNIA 4AF5A 2X9DA 4ICHA 2WUIA 3VVXA 2G7LA 3HGYA 2PBXA 4CGRA 5K58A 3IH2A 4V2GA 5HBUA 2ID3A 4JNNA 3TP0A 3LHQA 4I6ZA 4AC6A 5EZHA 3COLA 2FX0A 2IAIA 3QPLA 5FKMA 3QBMA 2FQ4A 3LWJA 5D19A 3LOCA 1U9NA 1QVUA 3WHBA 2ZB9A 3BR5A 5GPAA 1JUMA 3BR0A 4UDSA 5C4YA 3NPIA 2ZCXA 4M3GA 4JL3A 2HYJA 1RKTA 4D5CA 2QIBA 5FKKA 2V57A 4JKZA 5FHPA 2IEKA 3C07A 4KWAA 5J1UA 4ME9A 1Z0XA 4B1RA 2UXHA 2F07A 3ON4A 3VW1A 4GCTA 3B6CA 2XDNA 3QQAA 3BTIA 3ZQHA 2NP3A 3RD3A 4GFKA 3AQTA 5EZGA 2TRTA 3VW2A 4X1EA 1ORKA 3BR3A 4L62A 2RAEA 5IPAA 2Q24A 3SFIA 3VUQA 2Y30A 4PXIA 2XGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W53 A;  4JYK A;  1JUP A;  3IH4 A;  1A6I A;  5EFY A;  1JTY A;  4ACI A;  2G7G A;  2UXP A;  3V6G A;  3BHQ A;  3BTJ A;  3CCY A;  2QWT A;  1QVT A;  2OPT A;  2HXI A;  3AQS A;  1BJZ A;  3RH2 A;  3VVZ A;  2O7T A;  3GEU A;  5J1R A;  4HKU A;  5HSZ A;  2Y31 A;  3Q0U A;  2VKV A;  2G3B A;  3ANP A;  3FK6 A;  5K7H A;  3NI7 A;  1JT6 A;  3O8H A;  3S5R A;  5FGL A;  3NNR A;  4M3B A;  3DPJ A;  4MXM A;  3F1B A;  3MNL A;  2O7O A;  3VPR A;  3BR6 A;  3PPB A;  1UI6 A;  5DAJ A;  5CW8 A;  2QCO A;  5F0F A;  3G1M A;  5IP6 A;  4NEL A;  4MK6 A;  2G7S A;  2DTZ A;  3NRG A;  3QPS A;  2NX4 A;  2XB5 A;  4D5F A;  2X6O A;  4W97 A;  3CWR A;  3V78 A;  5IOZ A;  3O60 A;  1ZK8 A;  3BR2 A;  2UXU A;  4GFL A;  2QKO A;  5J1Y A;  3CRJ A;  3JSJ A;  4W1U A;  3HGG A;  2G0E A;  1UI5 A;  3ZQI A;  4V2F A;  4D7N A;  2VPR A;  3Q0W A;  2GBY A;  4GCK A;  4AUX A;  3VP5 A;  3G1L A;  5GPC A;  5GP9 A;  3B6A A;  3EUP A;  4MO7 A;  3BQY A;  2WV1 A;  1ZKG A;  3E7Q A;  3ZQG A;  3BTL A;  3GZI A;  5FMP A;  3MVP A;  3CJD A;  2OF7 A;  3DEW A;  2NP5 A;  3Q3S A;  2QOP A;  2NS7 A;  3B81 A;  2VKE A;  5HAW A;  2TCT A;  3WHC A;  2GEN A;  1Z77 A;  3BTC A;  4M3F A;  3IH3 A;  3FRQ A;  2IBD A;  2XRL A;  3VIB A;  2YVH A;  3Q0V A;  2DG8 A;  2HYT A;  2NS8 A;  3LSJ A;  1QPI A;  4D7M A;  2IU5 A;  3EGQ A;  2ID6 A;  4GCL A;  3T6N A;  3G1O A;  5IOY A;  2EH3 A;  1JUS A;  2HKU A;  3DCF A;  2ZCM A;  2RHA A;  3PM1 A;  3HE0 A;  5F0C A;  3C2B A;  2I10 A;  2JJ7 A;  2OER A;  1RPW A;  3VVY A;  3BT9 A;  5EYR A;  3HTJ A;  2UXI A;  4ABZ A;  2ZCN A;  5D1R A;  2HQ5 A;  3G7R A;  3BR1 A;  3HIM A;  1JTX A;  3VW0 A;  3HTH A;  5FKN A;  5F1J A;  3BJB A;  3KKC A;  3P9T A;  5F08 A;  2WGB A;  2PZ9 A;  1U9O A;  5K7F A;  2HXO A;  2QTQ A;  5CXG A;  3O8G A;  2ZOY A;  3ANG A;  2OI8 A;  3VOK A;  2D6Y A;  5FKL A;  2FD5 A;  1T56 A;  3HTA A;  3PAS A;  2XPV A;  3ZQL A;  3ZQF A;  4XK4 A;  4DW6 A;  3HTI A;  2UXO A;  2DG7 A;  4M3D A;  4NN1 A;  3F0C A;  5F27 A;  5K7Z A;  2Y2Z A;  4AC0 A;  2XPW A;  2REK A;  4I76 A;  2XGD A;  3LSR A;  1JT0 A;  3G56 A;  1RKW A;  1VI0 A;  5CXI A;  3KZ9 A;  3LJL A;  5D18 A;  2GUH A;  2YVE A;  5F04 A;  3ON2 A;  3FIW A;  3VOX A;  3TP3 A;  4B3A A;  5H9T A;  4M3E A;  2FBQ A;  5F0H A;  2ZOZ A;  5FKO A;  3SDG A;  4G12 A;  3LSP A;  3CDL A;  2RAS A;  4YZE A;  3BQZ A;  3KKD A;  5J3L A;  3KNW A;  2XGE A;  2FJ1 A;  2XPU A;  3QKX A;  2JK3 A;  3BCG A;  3FK7 A;  3BRU A;  1SGM A;  2GFN A;  3NXC A;  5AQC A;  1T33 A;  3IUV A;  3BNI A;  4AF5 A;  2X9D A;  4ICH A;  2WUI A;  3VVX A;  2G7L A;  3HGY A;  2PBX A;  4CGR A;  5K58 A;  3IH2 A;  4V2G A;  5HBU A;  2ID3 A;  4JNN A;  3TP0 A;  3LHQ A;  4I6Z A;  4AC6 A;  5EZH A;  3COL A;  2FX0 A;  2IAI A;  3QPL A;  5FKM A;  3QBM A;  2FQ4 A;  3LWJ A;  5D19 A;  3LOC A;  1U9N A;  1QVU A;  3WHB A;  2ZB9 A;  3BR5 A;  5GPA A;  1JUM A;  3BR0 A;  4UDS A;  5C4Y A;  3NPI A;  2ZCX A;  4M3G A;  4JL3 A;  2HYJ A;  1RKT A;  4D5C A;  2QIB A;  5FKK A;  2V57 A;  4JKZ A;  5FHP A;  2IEK A;  3C07 A;  4KWA A;  5J1U A;  4ME9 A;  1Z0X A;  4B1R A;  2UXH A;  2F07 A;  3ON4 A;  3VW1 A;  4GCT A;  3B6C A;  2XDN A;  3QQA A;  3BTI A;  3ZQH A;  2NP3 A;  3RD3 A;  4GFK A;  3AQT A;  5EZG A;  2TRT A;  3VW2 A;  4X1E A;  1ORK A;  3BR3 A;  4L62 A;  2RAE A;  5IPA A;  2Q24 A;  3SFI A;  3VUQ A;  2Y30 A;  4PXI A;  2XGC A; 
#chains in the Genus database with same CATH topology
 2W53 A;  4JYK A;  1JUP A;  3IH4 A;  1A6I A;  5EFY A;  1JTY A;  4ACI A;  2G7G A;  2UXP A;  3DU5 A;  3V6G A;  3BHQ A;  3BTJ A;  3CCY A;  2QWT A;  1QVT A;  2OPT A;  2HXI A;  3AQS A;  1BJZ A;  3RH2 A;  3VVZ A;  2O7T A;  3GEU A;  5J1R A;  4HKU A;  5HSZ A;  2B1E A;  2Y31 A;  3Q0U A;  2VKV A;  2G3B A;  4U9N A;  3ANP A;  3FK6 A;  5K7H A;  3NI7 A;  1JT6 A;  4U9L A;  3O8H A;  2B3W A;  3S5R A;  5FGL A;  3NNR A;  4M3B A;  2ZY9 A;  3DPJ A;  4MXM A;  3F1B A;  3MNL A;  2O7O A;  3VPR A;  3BR6 A;  3PPB A;  1UI6 A;  5DAJ A;  5CW8 A;  2QCO A;  5F0F A;  5CQG A;  3G1M A;  5IP6 A;  4NEL A;  4MK6 A;  2G7S A;  2DTZ A;  3NRG A;  3QPS A;  2NX4 A;  2XB5 A;  4D5F A;  2X6O A;  4W97 A;  3CWR A;  3V78 A;  2R7V A;  5IOZ A;  3O60 A;  1ZK8 A;  3BR2 A;  2UXU A;  4GFL A;  2QKO A;  5J1Y A;  3CRJ A;  3JSJ A;  4W1U A;  3HGG A;  2G0E A;  1UI5 A;  3ZQI A;  4V2F A;  4D7N A;  2VPR A;  3Q0W A;  2GBY A;  4GCK A;  2A2F X;  4AUX A;  3VP5 A;  3G1L A;  5GPC A;  5GP9 A;  3B6A A;  3EUP A;  2FJI 1;  4MO7 A;  3BQY A;  2WV1 A;  1ZKG A;  3E7Q A;  3ZQG A;  3BTL A;  3GZI A;  5FMP A;  4DVY P;  3MVP A;  4WIB A;  3CJD A;  2OF7 A;  3DEW A;  2NP5 A;  3Q3S A;  2QOP A;  2NS7 A;  3B81 A;  2VKE A;  5HAW A;  2TCT A;  3WHC A;  2GEN A;  1Z77 A;  3BTC A;  4M3F A;  2R7W A;  3IH3 A;  3FRQ A;  2R7Q A;  2IBD A;  2XRL A;  3VIB A;  4OD5 A;  2YVH A;  3Q0V A;  2DG8 A;  2HYT A;  2NS8 A;  3VTI A;  3LSJ A;  1QPI A;  4D7M A;  2IU5 A;  3EGQ A;  2ID6 A;  4GCL A;  3T6N A;  3G1O A;  5IOY A;  2EH3 A;  1JUS A;  2HKU A;  3DCF A;  2ZCM A;  2RHA A;  3PM1 A;  3HE0 A;  5F0C A;  3C2B A;  2I10 A;  2JJ7 A;  2OER A;  1RPW A;  3VVY A;  3BT9 A;  5EYR A;  3HTJ A;  2UXI A;  4ABZ A;  2ZCN A;  5D1R A;  2HQ5 A;  3G7R A;  2YVX A;  2R7T A;  3BR1 A;  3HIM A;  1JTX A;  3VW0 A;  3HTH A;  5FKN A;  5F1J A;  3BJB A;  3KKC A;  3P9T A;  3DU6 A;  5F08 A;  2WGB A;  2PZ9 A;  1U9O A;  5K7F A;  2R7O A;  2HXO A;  2QTQ A;  5CXG A;  3O8G A;  2ZOY A;  3ANG A;  2OI8 A;  3VOK A;  2D6Y A;  5FKL A;  2FD5 A;  1T56 A;  3HTA A;  3PAS A;  2XPV A;  3ZQL A;  3ZQF A;  4XK4 A;  3SWH A;  4DW6 A;  3HTI A;  2UXO A;  2DG7 A;  4M3D A;  4NN1 A;  3F0C A;  5F27 A;  5K7Z A;  2Y2Z A;  4AC0 A;  2XPW A;  2REK A;  4I76 A;  2XGD A;  3LSR A;  1JT0 A;  3G56 A;  1RKW A;  1VI0 A;  5CXI A;  2R7U A;  3KZ9 A;  3LJL A;  5D18 A;  2GUH A;  2YVE A;  5F04 A;  3ON2 A;  3FIW A;  3VOX A;  3TP3 A;  4B3A A;  5H9T A;  4M3E A;  2FBQ A;  5F0H A;  2ZOZ A;  5FKO A;  3SDG A;  4G12 A;  3LSP A;  3CDL A;  2RAS A;  4YZE A;  3K8P C;  3BQZ A;  3KKD A;  5J3L A;  2PFV A;  3NS4 A;  4IRV A;  3KNW A;  2XGE A;  2FJ1 A;  2XPU A;  3QKX A;  2JK3 A;  3BCG A;  3FK7 A;  3BRU A;  1SGM A;  2GFN A;  3NXC A;  5AQC A;  1T33 A;  3IUV A;  3BNI A;  4AF5 A;  2X9D A;  4ICH A;  2WUI A;  3VVX A;  2G7L A;  3HGY A;  2PBX A;  4CGR A;  5K58 A;  3IH2 A;  4V2G A;  5HBU A;  2ID3 A;  4JNN A;  3TP0 A;  3LHQ A;  4C2M A;  4I6Z A;  4AC6 A;  5EZH A;  3COL A;  2FX0 A;  2IAI A;  3QPL A;  5FKM A;  3QBM A;  2FQ4 A;  3LWJ A;  5D19 A;  3LOC A;  1U9N A;  1QVU A;  3WHB A;  3KYL A;  2ZB9 A;  2R7X A;  3BR5 A;  5GPA A;  1JUM A;  3BR0 A;  4UDS A;  5C4Y A;  3NPI A;  2ZCX A;  4M3G A;  4JL3 A;  2HYJ A;  1RKT A;  4D5C A;  2QIB A;  5FKK A;  2R7S A;  2V57 A;  4JKZ A;  5FHP A;  2IEK A;  3C07 A;  4KWA A;  5J1U A;  4ME9 A;  1Z0X A;  4B1R A;  2UXH A;  2F07 A;  3ON4 A;  3VW1 A;  4GCT A;  3B6C A;  2XDN A;  3QQA A;  3FHN A;  3BTI A;  3ZQH A;  2NP3 A;  3RD3 A;  4GFK A;  3AQT A;  5EZG A;  2TRT A;  3VW2 A;  4X1E A;  1ORK A;  3BR3 A;  4L62 A;  2RAE A;  5IPA A;  4OD4 A;  2Q24 A;  3SFI A;  3VUQ A;  2R7R A;  2Y30 A;  4PXI A;  2XGC A; 
#chains in the Genus database with same CATH homology
 2W53 A;  4JYK A;  1JUP A;  3IH4 A;  1A6I A;  5EFY A;  1JTY A;  4ACI A;  2G7G A;  2UXP A;  3V6G A;  3BHQ A;  3BTJ A;  3CCY A;  2QWT A;  1QVT A;  2OPT A;  2HXI A;  3AQS A;  1BJZ A;  3RH2 A;  3VVZ A;  2O7T A;  3GEU A;  5J1R A;  4HKU A;  5HSZ A;  2Y31 A;  3Q0U A;  2VKV A;  2G3B A;  3ANP A;  3FK6 A;  5K7H A;  3NI7 A;  1JT6 A;  3O8H A;  3S5R A;  5FGL A;  3NNR A;  4M3B A;  3DPJ A;  4MXM A;  3F1B A;  3MNL A;  2O7O A;  3VPR A;  3BR6 A;  3PPB A;  1UI6 A;  5DAJ A;  5CW8 A;  2QCO A;  5F0F A;  3G1M A;  5IP6 A;  4NEL A;  4MK6 A;  2G7S A;  2DTZ A;  3NRG A;  3QPS A;  2NX4 A;  2XB5 A;  4D5F A;  2X6O A;  4W97 A;  3CWR A;  3V78 A;  5IOZ A;  3O60 A;  1ZK8 A;  3BR2 A;  2UXU A;  4GFL A;  2QKO A;  5J1Y A;  3CRJ A;  3JSJ A;  4W1U A;  3HGG A;  2G0E A;  1UI5 A;  3ZQI A;  4V2F A;  4D7N A;  2VPR A;  3Q0W A;  2GBY A;  4GCK A;  4AUX A;  3VP5 A;  3G1L A;  5GPC A;  5GP9 A;  3B6A A;  3EUP A;  4MO7 A;  3BQY A;  2WV1 A;  1ZKG A;  3E7Q A;  3ZQG A;  3BTL A;  3GZI A;  5FMP A;  3MVP A;  3CJD A;  2OF7 A;  3DEW A;  2NP5 A;  3Q3S A;  2QOP A;  2NS7 A;  3B81 A;  2VKE A;  5HAW A;  2TCT A;  3WHC A;  2GEN A;  1Z77 A;  3BTC A;  4M3F A;  3IH3 A;  3FRQ A;  2IBD A;  2XRL A;  3VIB A;  2YVH A;  3Q0V A;  2DG8 A;  2HYT A;  2NS8 A;  3LSJ A;  1QPI A;  4D7M A;  2IU5 A;  3EGQ A;  2ID6 A;  4GCL A;  3T6N A;  3G1O A;  5IOY A;  2EH3 A;  1JUS A;  2HKU A;  3DCF A;  2ZCM A;  2RHA A;  3PM1 A;  3HE0 A;  5F0C A;  3C2B A;  2I10 A;  2JJ7 A;  2OER A;  1RPW A;  3VVY A;  3BT9 A;  5EYR A;  3HTJ A;  2UXI A;  4ABZ A;  2ZCN A;  5D1R A;  2HQ5 A;  3G7R A;  3BR1 A;  3HIM A;  1JTX A;  3VW0 A;  3HTH A;  5FKN A;  5F1J A;  3BJB A;  3KKC A;  3P9T A;  5F08 A;  2WGB A;  2PZ9 A;  1U9O A;  5K7F A;  2HXO A;  2QTQ A;  5CXG A;  3O8G A;  2ZOY A;  3ANG A;  2OI8 A;  3VOK A;  2D6Y A;  5FKL A;  2FD5 A;  1T56 A;  3HTA A;  3PAS A;  2XPV A;  3ZQL A;  3ZQF A;  4XK4 A;  4DW6 A;  3HTI A;  2UXO A;  2DG7 A;  4M3D A;  4NN1 A;  3F0C A;  5F27 A;  5K7Z A;  2Y2Z A;  4AC0 A;  2XPW A;  2REK A;  4I76 A;  2XGD A;  3LSR A;  1JT0 A;  3G56 A;  1RKW A;  1VI0 A;  5CXI A;  3KZ9 A;  3LJL A;  5D18 A;  2GUH A;  2YVE A;  5F04 A;  3ON2 A;  3FIW A;  3VOX A;  3TP3 A;  4B3A A;  5H9T A;  4M3E A;  2FBQ A;  5F0H A;  2ZOZ A;  5FKO A;  3SDG A;  4G12 A;  3LSP A;  3CDL A;  2RAS A;  4YZE A;  3BQZ A;  3KKD A;  5J3L A;  3KNW A;  2XGE A;  2FJ1 A;  2XPU A;  3QKX A;  2JK3 A;  3BCG A;  3FK7 A;  3BRU A;  1SGM A;  2GFN A;  3NXC A;  5AQC A;  1T33 A;  3IUV A;  3BNI A;  4AF5 A;  2X9D A;  4ICH A;  2WUI A;  3VVX A;  2G7L A;  3HGY A;  2PBX A;  4CGR A;  5K58 A;  3IH2 A;  4V2G A;  5HBU A;  2ID3 A;  4JNN A;  3TP0 A;  3LHQ A;  4I6Z A;  4AC6 A;  5EZH A;  3COL A;  2FX0 A;  2IAI A;  3QPL A;  5FKM A;  3QBM A;  2FQ4 A;  3LWJ A;  5D19 A;  3LOC A;  1U9N A;  1QVU A;  3WHB A;  2ZB9 A;  3BR5 A;  5GPA A;  1JUM A;  3BR0 A;  4UDS A;  5C4Y A;  3NPI A;  2ZCX A;  4M3G A;  4JL3 A;  2HYJ A;  1RKT A;  4D5C A;  2QIB A;  5FKK A;  2V57 A;  4JKZ A;  5FHP A;  2IEK A;  3C07 A;  4KWA A;  5J1U A;  4ME9 A;  1Z0X A;  4B1R A;  2UXH A;  2F07 A;  3ON4 A;  3VW1 A;  4GCT A;  3B6C A;  2XDN A;  3QQA A;  3BTI A;  3ZQH A;  2NP3 A;  3RD3 A;  4GFK A;  3AQT A;  5EZG A;  2TRT A;  3VW2 A;  4X1E A;  1ORK A;  3BR3 A;  4L62 A;  2RAE A;  5IPA A;  2Q24 A;  3SFI A;  3VUQ A;  2Y30 A;  4PXI A;  2XGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...