2RF0A

Crystal structure of human mixed lineage kinase map3k10 sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
b'AGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFPSNYVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 10
publication title The crystal structure of human Mixed lineage kinase MAP3K10 SH3 domain.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 12
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rf0A00
2LX7A 1UJYA 2YUQA 1JO8A 2CH4W 1AWJA 2K9GA 1UGVA 3ULRB 2O31A 1CKBA 2BZYA 1UJ0A 2K2MA 1AEYA 1ZBJA 3KFVA 4Y92A 1BU1A 1YNZA 1RLPC 2XMFA 2D1XA 2X3WD 1A0NB 2HCKA 1VYUA 2M51A 1B07A 1YP5A 1K1ZA 2EVRA 1T0JA 2CT3A 2JXBA 3TVTA 2RQWA 2JS0A 2DE0X 1ZUUA 4IIMA 1B3QA 1UDLA 2L0AA 2MOXA 2ABLA 4HVVA 3QWXX 1I07A 2C0TA 3EG2A 4AG1C 1KSWA 2DILA 1HJDA 2CUBA 2BZ8A 1WX6A 2OAWA 1W6XA 1BBZA 2VKNA 1M8MA 2EYZA 1PNJA 1SHFA 1X6GA 2DL4A 3CQTA 4OMMA 2E5KA 2DL3A 4JJCA 4RTTA 4A63B 2AKKA 2PNIA 3EG0A 2C0OA 3VS4A 4CC2A 4IIOA 5HCKA 4J9CA 1M3CA 2FPEA 1G83A 2EYYA 2A28A 2NWMA 1IO6A 2BTTA 2L3PA 1M3BA 1WYXA 4Z8AA 2K3BA 1X6BA 2CSQA 2JT4A 4LUEA 2DBMA 1UTIA 3THKA 2RMOA 2KRNA 4F17A 4J9HA 3EHQA 1M30A 1JU5C 1GFDA 1X2KA 4AFZC 2HEQA 2JTEA 4J9DA 1J3TA 4FSSA 3NGPA 1U5SA 2EKHA 4D8KA 2EBPA 2DM1A 2DL7A 3M0SA 1YWOA 2FO0A 4OMLA 5L23A 2O9SA 1OV3A 3REBB 5ECAA 1SEMA 4LNPA 4OMOA 1G2BA 3M0TA 1JEGA 3UATA 5I11A 2MIOA 2L2PA 2X3XD 1GCPA 3PVQA 1WA7A 2KRMA 3O5ZA 3EG1A 2F2XA 4DEXA 2DF6A 1VA7A 2YUPA 2JMAA 2GNCA 2RN8A 2BZXA 3JV3A 2PTKA 1GRIA 2K79A 1NG2A 2AZVA 3VS5A 4AFQC 3C0CA 1T3LA 2KEAA 4CC4B 3UF4A 1NLOC 2W0ZA 1H92A 1K9AA 1WI7A 1HSQA 4JZ4A 2RQUA 4RTYA 2DVJA 2O2OA 1ZUKA 1NLPC 2ESWA 1KJWA 1AZEA 4ZNXA 1YWPA 2V1RA 1ZX6A 2HBWA 2LJ1A 1TUDA 1K4US 1WXTA 1W70A 1QWFA 1UE9A 2SEMA 4J9IA 4OMNA 5IHKA 1UFFA 4LE9A 1T3SA 2DBKA 1NM7A 1QLYA 1LCKA 2RF0A 4M4ZA 1GCQA 1XOVA 4WCIA 2KYMA 2KGTA 4AFUC 2FRYA 1CKAA 2VWFA 3EGUA 2NUZA 2F2WA 3VRYA 1Z9ZA 1ABQA 1Y0MA 1TUCA 3PE0A 4RTVA 1YN8A 4Z89A 1KIKA 1NYGA 2HDAA 2KXDA 1AWXA 5EC7A 1RUWA 2DMOA 3I9QA 1H3HA 1MV3A 2FRWA 2EGEA 2RNAA 4ESRA 1AVZC 1N5ZA 2OJ2A 1QKWA 2D8HA 2J6FA 1X2QA 5GJVB 2V1QA 1WLPB 1PKSA 2J05A 2RQTA 2A37A 1M27C 1M3AA 1UHFA 4J9EA 1GCQC 2KR3A 1OPLA 3NMZC 3VS2A 1KFZA 1BK2A 1JXMA 4JJBA 3H0HA 3SHWA 3ZL7C 1SPKA 1WXBA 5FWCA 4Z88A 3TSZA 2DLPA 2D8JA 1RLQC 2ECZA 2H8HA 2QDLA 2YT6A 2J7IA 2GBQA 2OI3A 1SRMA 3RBBB 1ARKA 2DA9A 2D0NA 2EYXA 2AK5A 2P4RA 5IXFA 1SHGA 1MUZA 4RTXA 4J9GA 2K6DA 4RTWA 1SRLA 2EPDA 3A98A 1RI9A 2SRCA 4JJDA 4GBQA 1GBRA 2KROA 2KE9A 4ORZA 5FW9A 4F14A 3VS0A 2L3QA 1E6GA 1CSKA 1TG0A 1T0HA 1U3OA 4DEYA 1H8KA 2VVKA 4KRTA 2EQIA 3EHRA 3I35A 1BB9A 2GTOA 3VS6A 3U23A 1I1JA 2EW3A 3REAB 2DJQA 2DL5A 2GTJA 1UHCA 4OMPA 2JW4A 1GFCA 1NEBA 2EGCA 2CH4A 1QCFA 2LMJA 2JMCA 3SEMA 1WDXA 2FPFA 4CC3A 3VRZA 1K0XA 4HXJA 2F2VA 1AWOA 2J6KA 2KYBA 2LP5A 2RQRA 1YCSB 3M0RA 4F16A 1QWEA 2JM8A 4GLMA 3GBQA 2KNBB 2YSQA 2CUDA 3LH5A 1AWWA 2C0IA 2EYWA 2DRKA 2RPNA 1JXOA 1PHTA 1PKTA 2ENMA 2G6FX 2YDLA 2DX1A 1FMKA 1UUEA 1ZLMA 1AOJA 2CREA 2CT4A 1NEGA 1NYFA 3QWYA 2KT8A 1Y57A 1ABOA 2JM9A 1X69A 4RUGA 1AZGB 1OOTA 2KT1A 4HVUA 4AG2C 2J6OA 2GGRA 3NHNA 4QT7A 2YUNA 2B86A 4HVWA 3IQLA 3RNJA 2A36A 4X1VA 2LJ3A 2L3SA 4LN2A 4E6RA 2K7AA 2W10A 4RTUA 1MV0B 4JPBW 3H0FA 1EFNA 1E6HA 1GBQA 2KRSA 4AFSC 2FPDA 1WFWA 4OMQA 4LUDA 3UA6A 2CDTA 4RTZA 3VS1A 2KXCA 2LNHB 3EG3A 1V1CA 4D8DA 3I5SA 2LZ6B 2IIMA 1ZUYA 1UG1A 3M0QA 2J06A 1WXUA 5IHNA 2O9VA 1GL5A 2DYBA 3H41A 2I0NA 2HSPA 3I5RA 3M0PA 3NPFA 1W1FA 2JS2A 4EIKA 3VS3A 2AZSA 2DRMA 4K11A 1UECA 1X43A 2LQWA 1I0CA 1X27A 3VS7A 1K0SA 1Z9QA 2ROLA 5FWBA 2A08A 1SSHA 4R0KA 2AKLA 5GJWB 1VYVA 1JQQA 2O88A 4JZ3A 2KBTA 2EGAA 3H0IA 4CC7A 2ED1A 3UA7A 1E7OA 1QKXA 1PRMC 2RQVA 5IXBA 1U06A 1AD5A 2FEIA 4J9FA 2DNUA 1FYNA 5IHIA 1VYTA 3R6NA 1S1NA 2LCSA 2M0YA 2ED0A 2MCNA 2LJ0A 2DL8A 2YUOA 2PZ1A 1PWTA 4HCKA 3TSWA 2LQNA 1K76A 2CSIA 1WIEA 2FG0A 3FJ5A 3M0UA 4J9BA 3PVLA 1OPKA 1OEBA 2GQIA 2ROTA 1PRLC 5I22A 5IH2A 1HD3A 1ZSGA
chains in the Genus database with same CATH superfamily
1UGPB 2RHUA 2GFAA 3AHUA 1VQ4A 1JO8A 2CS7A 1UGVA 4AMCA 4XTWA 4QW2A 4C8QB 2DERA 2D9TA 1BU1A 4PJOF 1H641 5CVIA 2X3WD 5CQXA 2X4WA 2HCKA 1VYUA 1PD1A 4EDUA 4FYWB 2CKKA 1K1ZA 2EVRA 1D1BA 1N8RC 3TCJA 4O5VA 2X9HA 1UDLA 4A4KA 5L8RE 2D0QB 4BE2A 9ATCB 3C95A 2MOXA 2ABLA 4HVVA 2PQWA 2C0TA 5GAOm 4X9DA 4AG1C 1M2VB 2DILA 1HJDA 2BZ8A 3QO3A 2GCXA 2CP7A 1VQMT 2RJCA 4LDUA 2EYZA 1X6GA 1BIAA 3Q1JA 4QVCA 4XK8E 2FPEA 3CCQT 1VIFA 1SG5A 2EYYA 4C92D 1RADB 2K3BA 2CSQA 4DBRA 4DBFA 1WJRA 2XDDA 4OB2B 3THKA 2RJDA 2RMOA 1JB0E 3J81E 4F17A 4FCYA 2P0QA 1VQMQ 1GFDA 3JB9D 4J83A 1W2BS 4FSSA 5CAIA 2DM1A 4RG2A 1YWOA 1OV3A 1SEMA 3L2UA 3E1SA 3CCQQ 2RA2A 3M0TA 3GIBA 4OB0B 4C92A 4PJOB 2XK0A 1U1TA 1R0CB 1WA7A 1OI1A 4BI8B 1YI2A 2RHZA 1EX4A 2NUPA 3NTHA 4A53A 2JMAA 3BFMA 2NYSA 2RN8A 3ZEHA 2BZXA 3MP8A 1GRIA 1FMVA 4JUVA 3JCMP 2EJGA 5IN1A 3V8JA 4D6WA 4CC4B 2COZA 3RUXA 1K9AA 1WI7A 1M5Q1 3RDVA 5LJ3g 1HSQA 2RQUA 2JNGA 2DPPB 7AT1B 2KK4A 1ZUKA 2LCCA 3S6WA 3META 2XD0A 5FU7C 5I2SA 3A8LB 1QWFA 1S72T 3EFRA 3A8MB 4OMNA 5EG2A 5GMKi 1VQ9T 4PFOA 2RO0A 1LVKA 3GPLA 4LE9A 4QVZA 4XTUA 4P5NA 4FT2A 4M4ZA 2YLCA 1SSFA 4FW1A 1Q7YU 4WCIA 2QTVA 5DY9A 1VQPA 1D3BA 4EPCA 4AFUC 2QQAA 1CKAA 2HQXA 3VRYA 1Z9ZA 2CP5A 1MMAA 2M1HA 4PJJA 1TUCA 2HNIA 3SWNC 2QAZA 4XTVA 1KIKA 2JVVA 1I5OB 1RUWA 3CCUA 3DB4A 4KULA 2FRWA 2KI7A 2RNAA 4ESRA 3CBPA 3EFSA 1AVZC 4KGZB 1I8FA 2R58A 2J6FA 4FM4B 5HK0A 1S72Q 3T9NA 2J05A 3LLRA 3HFOA 1VQ9Q 4QVDA 1ZHIA 2B8AA 2DXTA 3X25B 4M78D 1Q86R 5LJ3j 3OW2S 3QXEB 1KFZA 2BE9B 4M7AG 1VQ6T 3SHWA 4PJMA 2CP3A 3CCET 3ZL7C 2KDSA 3PIPA 3QDRB 1JJ2A 2ZGWA 5AT1B 4A4HA 4C0FA 2GBQA 3RBBB 1ARKA 1QVGS 1G3SA 1MUZA 4IUQA 2K6DA 3OYKA 3PNWC 3JCMW 1N27A 4GBQA 2KE9A 3LYIA 4C0DC 6AT1B 3GF5A 4M78A 1UEBA 2P0PA 5GANg 1E6GA 5KYNA 4ZGDB 1CSKA 1NZ9A 1WJSA 5DLQE 1VQ6Q 1H8KA 1M2OA 2EQIA 1W4SA 3CCEQ 4C8QA 4M77D 4A4FA 4XU0A 2RI5A 3SFMA 3G6EA 3JCMJ 1M1GA 2DZCA 4OMPA 2RK2A 1WHMA 4DA4A 4M7AC 1KD1U 5KYUB 1JJ2P 1WHJA 2JMCA 4MDWA 1OZ3A 1AWOA 1KQSA 2LP5A 2K5LA 1IZ6A 3G71T 4PJLA 3D7SB 1QWEA 4KUIA 1Q81U 1UGRB 5FU7B 1OZ2A 2YSQA 2CUDA 1WPYA 1AWWA 2DIGA 4M77A 2EYWA 2DRKA 1JXOA 2E5QA 1BIBA 1PHTA 1PKTA 2ENMA 2YLBA 1RL2A 1NYFA 4GY5A 5GANj 2RH2A 4M7AF 1AZGB 3FRNA 2KMTA 3SWNB 5GAN7 2J6OA 1K8AU 3G71Q 4HCZA 4QT7A 2B86A 2Y4XA 1KQSP 1U1SA 4XU1A 4OB1B 3CD6T 3OYYA 4DOVA 2HAXA 4JLGA 2RK1A 4C0ZA 3CCLA 3X20B 4XTXA 1EFNA 4OGEA 1GBQA 4AFSC 1WFWA 1ZQ1A 4ZN1A 4LUDA 5D7UA 3FLGA 3FJPA 4PJOA 4O6JA 1V1CA 3QDFA 3I5SA 2IIMA 2DXCA 1O75A 1ZUYA 2J06A 1M90U 1GL5A 2PVOB 2DD4A 1IGUA 2QGFB 4C8QG 1FWZA 2QEXT 2LT1A 2MMPA 2V26A 2LDMA 3M57A 1V29B 1GXIE 3CD6Q 1W2BA 3VS3A 1VQLA 4BI3A 2ZZDA 2I2LA 8AT1B 1WJQA 2IG0A 4C0DB 1OYXA 2COYA 3OYAA 1LNXA 1SSHA 5HK3A 2KQWA 1VYVA 4JZ3A 2EGAA 3DKMA 3I55T 1M9SA 2PVDB 5GAOn 2HSEB 3BY7A 3L42A 2YHTA 5IXBA 2FEIA 1BYMA 4XTYA 4M75C 3MO8A 1FYNA 2AIRB 2MWPA 1Q7YR 2M0YA 2QEXQ 2MCNA 5A0GA 2PZ1A 1X6OA 2LQNA 1K76A 2CSIA 3M0UA 1QVFP 3PVLA 1OEBA 3G4ST 2ROTA 1Y7XA 1HD3A 2ATCB 1ZSGA 2DKGA 4BB7A 2YUQA 4A54A 3PMTA 3CPWP 1OU8A 1RAHB 4ANJA 2YRCA 2O31A 2ZPGB 3I55Q 2BZYA 1UJ0A 3F70A 1KHIA 2LTOA 3LGFA 2EKOA 1PM3A 1NBEB 2M51A 2HL3A 4J6XA 2VXEA 2XU8A 1RACB 4M75F 4BD3A 1NE8A 5DLOA 1T0JA 2CT3A 1Y96A 5C0MA 2JXBA 1BI0A 3TVTA 2JN0A 4HT9A 2QGGA 1QMCA 2R5MA 2MI6A 3H9NA 1ZUUA 3L2QA 3G4SQ 1VQOT 4HT8A 5C6SA 1ACMB 1K9MC 2DO3A 2AT1B 5CR2A 1R77A 4PJOG 3VUZA 1I07A 3OYEA 3EG2A 1Q82U 1KSWA 1LOJA 5KYXB 5FROA 2DZ9A 2EQJA 3HHTB 3ZFJA 2BIVA 1M8MA 1YJWA 3MEVA 2DL4A 4QQDA 3DLLA 2AKKA 2PNIA 2X4XA 2C0OA 4KBMB 4IIOA 2RJFA 5KE2A 1G83A 2K3XA 2L3PA 2BTTA 4YTLA 1WYXA 3RKYA 2LQKA 4Z8AA 2JT4A 3L2ZA 2AHJB 1OULA 4WF2A 5CIUA 2KVQG 3FDRA 3C12A 1R8OB 1VQ5T 2A7YA 3M59A 1M30A 1KD1R 1QVGA 2YXYA 4NOYA 2HEQA 4OGCA 2EBPA 2DL7A 5LJ3e 2EAYA 1O9SA 4FU6A 3J7AF 4J8OA 5J39A 2E12A 3REBB 5CKEA 4LDYA 1Q81R 3LX7A 1YBYA 4OMOA 5M9OA 4JS5A 1B34A 2MAMA 1JEGA 1TOVA 3UATA 2XIDA 3LH0A 1MNDA 4E7JA 5I11A 2L2PA 5GAMg 2X3XD 3PVQA 4F7UF 3JCMc 4N4IA 3V7SA 2QA4T 3OBWA 2F2XA 3HL8A 4M75B 2QQ9A 4DEXA 2DF6A 1VQ5Q 1VA7A 1RAGB 3JV3A 1KQSS 2PTKA 2AZVA 4XTZA 5GAOl 1YITA 1T3LA 2PUKB 3CCMT 3QZ5B 4FL6A 5GAN6 4C92E 4DQ2A 3SWNA 3GOXA 1KG1A 2W0ZA 1K8AR 4BACA 3AT1B 4JZ4A 4LDVA 4FIBA 1QVGP 2O2OA 2GFUA 4JDSA 3TU4K 3A8GB 1QP2A 3EFOB 5KCOA 5LJ5g 1YWPA 4C5GA 2HBWA 1TU0B 1TUDA 1YJ9T 4JRKA 1W70A 1UE9A 2SEMA 4J9IA 1YIJT 4IUUA 2QA4Q 3CC7T 4A4EA 4KH0B 1VUBA 1XOVA 2JOYA 3SD4A 1UGQB 4B9XA 1VQ4T 2VWFA 2CP6A 3OS5A 2DXBA 3CCMQ 4RTVA 1YN8A 4LD6A 2NUTB 4ZGEB 4LDXA 2HMAA 5GAMj 5EC7A 1M90R 2DMOA 3I9QA 1H3HA 1HXDA 2RM4A 5FRMA 5LJ3h 2A3LA 1N5ZA 3LGLA 4M7AD 1YJ9Q 2DEQA 1X2QA 3PFSA 4NL2A 1PKSA 2L89A 1YIJQ 1WQWA 3WVEB 3CC7Q 3CC4A 1M27C 4BDZA 1UHFA 3JCMb 1NJIU 5GANe 1GCQC 3QJYA 3NMZC 3BW1A 1LPLA 1VQ4Q 1BK2A 1JXMA 4AT1B 4F7UB 4BE1A 4MZPA 1QVFS 5LJ5j 5FWCA 3S3OA 4E47A 2DLPA 2D8JA 1HYOA 2HZYA 2ECZA 3EG9B 3CPWS 2BE7D 3CBMA 4XU2A 1G3TA 5GMKm 3MP6A 5IXFA 3BDLA 4M7AA 2OAUA 2OTJA 4J9GA 4N0AC 2EPDA 3GP8A 3MEAA 5FW9A 2OTLA 2RI3A 2XG8D 4E7LA 1TG0A 1T0HA 3JSCA 4L5GA 1QCOA 3MEWA 4KRTA 3EHRA 3I35A 5CKDA 1BB9A 4EMHA 2HQEA 3QKJA 3V8LA 3CC2A 4JS4A 1EZZB 1IHWA 1UHCA 3WVDB 1FXXA 4M78E 1AHJB 1BI2A 2ZPIB 1QCFA 3SEMA 1WDXA 2FPFA 1XNIA 1TTHB 1Q86C 3SB2A 2F2VA 1YCSB 5KYWB 3JCMQ 3PGGA 1WHGA 1YI2T 3VU3C 1Q82R 1I5LA 4HCCA 2LNVA 3JCMX 5GAOq 5KYXA 1QP3A 5GANh 4BDYA 1YFNA 3EGDB 2QG9B 3LH5A 3S3NA 3QPHA 5I21A 2IVWA 2YDLA 1FMKA 1ZLMA 1AOJA 2CT4A 2ZPEB 3QWYA 2CZ7B 5GAN5 2CP2A 4RKUE 2MYSA 1K73U 4II1A 3EAEA 4ZTFA 3QHSA 2X51A 4M77E 4RMOA 2F5TX 3V8KA 4MDXA 2RB6A 1F1BB 1YI2Q 5FLXE 4EMGA 4HVWA 1WGSA 2A36A 1VQPT 2L3SA 3L2VA 1LJOA 2VASA 2W10A 4KGXB 4RTUA 1MV0B 4JPBW 3H0FA 2XI9A 2VC8A 4GLKA 2HQHA 2YWWA 3CCUT 4C8QD 5FU6B 2YRVA 4OMQA 3OS1A 2DTIA 2LC4A 4OVAA 5J3BA 3EG3A 1XQHA 4M7DC 2EYQA 5IHNA 3OYFA 1M1KU 2CP0A 4M75A 3H41A 2I0NA 1TS9A 1VQPQ 1C0MA 2QQBA 2JS2A 4K11A 4PLIA 1HK9A 4PJOE 4E7ZA 1X43A 1I0CA 1X27A 1K0SA 3CMAA 3OBYA 5FWBA 3CCUQ 2AKLA 3CMEA 1JQQA 1KC8U 1I4K1 3H0IA 4CC7A 3MKDA 3UA7A 1WHHA 5AYFA 2RQVA 3OSSC 2FZCB 1U06A 2ZCFB 4MZMA 4J9FA 2DNUA 3HPWA 5IHIA 2LCSA 4M7DF 3BDUA 3EGXB 3I56A 2ED0A 2DL8A 2YUOA 3MP1A 1PWTA 4HCKA 3TSWA 2FG0A 1D1AA 3FJ5A 4J9BA 1YJNA 2GQIA 5I22A 2O01E 1OQKA 3HKSA 2NUTA 3O8VA 3DB3A 1M2VA 2DEUA 1G8XA 4HCBA 3SDZA 1MMNA 1VQNA 4QQGA 2DTOA 3G6ET 4PKCC 1P92A 1VQ8A 2L3RA 4HA8A 5LJ3f 2K2MA 1AEYA 2F5KA 3C4SA 1JBMA 1K9MU 3GNGA 3E2UA 1QCNA 3V7RA 2XMFA 3EH1A 2JUFA 4IURA 1NJIR 3HTRA 1B07A 1FX7A 1YP5A 4EMKC 4PJOD 2CYZB 4DBQA 2RQWA 1BI1A 1KQ1A 4F7UA 1RI0A 3M54A 2DE0X 4IIMA 4LDWA 1B3QA 1ZSZC 2L0AA 4PLLA 3NFCA 3QWXX 5HKCA 3G6EQ 3URGA 3HRUA 3NTKA 1W6XA 2G3RA 3JB9J 1QQJA 5GAOr 1BBZA 2VKNA 3QG1A 4M75G 2E64A 2DVEA 1KK7A 4F04B 1Q7YC 3CQTA 2E5KA 4JJCA 2NLUA 4ME7A 4RTTA 3CCJA 4CC2A 5HCKA 1N6AA 4J9CA 1M3CA 1G3WA 3FB9A 3P8HA 2A28A 2NWMA 5GAMe 1M3BA 2K4YA 1QVFA 4A4GA 2EJFA 4TVRA 2DBMA 4M7DB 3JB9F 3CCLT 1VQKA 2EQKA 2VUBA 2KRNA 3CPWA 4J9HA 1XTDA 4ZTJA 1UB4A 3KBGA 3L1AA 3QBYA 2KY9A 2DK3A 3OYJA 4J9DA 1RAFB 1U5SA 2DAQA 2EKHA 3M0SA 5J26A 2FO0A 3CCVA 4OMLA 4KH1B 5L23A 2O9SA 5ECAA 5KYWA 2E65A 2JZ2A 5LJ5e 4LNPA 3OMGA 1G2BA 2RD1A 4CI0C 5KH6A 1GCPA 5GANf 3EGDA 1TWBA 1VQLT 3CCLQ 4IUTA 1WHKA 2YUPA 3UT1A 2DYIA 3OA6A 4L6V5 2A0FB 5A0DA 2K79A 1K73R 1NG2A 4AFQC 1JRIA 3FC3A 2JTMA 2HD0A 1U8RA 2KEAA 1Y71A 3UF4A 1NLOC 5GAN2 3A8HB 5LJ3d 2M16A 1N8RU 2DVJA 2K5FA 4F7UG 1NLPC 4X9CA 2ESWA 1KJWA 1AZEA 4ZNXA 2E6ZA 1M8VA 1ZX6A 2LJ1A 4DOWA 1K4US 4IKFA 2HBPA 4C92B 3H8ZA 1UFFA 1VQLQ 5GAMh 3CCRA 2DBKA 1IRXA 3BE3A 1KD1C 4C5HA 2X35A 2RF0A 2F69A 1GCQA 1BKBA 4EMKB 2F1LA 2KYMA 2FRYA 2NUPB 2NUZA 1Y0MA 4HKEA 3PE0A 3QSUA 2E10A 1NYGA 2KXDA 2FYKA 1Q81C 1G5VA 1M1KR 1ZSZB 3DLMA 1PSEA 1MV3A 3UWNA 2XHCA 1VIEA 3KXTA 1QKWA 2X4YA 5GJVB 1WLPB 5LJ5h 2C06A 2E4HA 4N0AA 2A37A 3A8OB 4JRPA 3CCSA 3QIIA 3S3MA 2KR3A 2QDYB 1VQ7A 3JCMV 2M9UA 1KC8R 4XAXB 2MK5A 1K8AC 4DBHA 1SPKA 3L2WA 5GMKj 4Z88A 4XU3A 2CZ6B 4UC4A 4FT4A 1YJWT 5CKBA 2E1HA 1NPRA 5KYUA 1SRMA 3OYIA 2VGMA 2DA9A 2P4RA 3LWHA 1SHGA 4RTXA 2ZPBB 1SRLA 1WQ7A 1RI9A 1RAEB 4JJDA 1GBRA 4ORZA 1TXQA 1EIFA 4F14A 4IUPA 2L3QA 5FRNA 5GANd 5A0LA 2M02A 4OMFB 2L5QA 3VKIA 4PK4A 2VVKA 4FYYB 3JCMg 2V8IA 3VS6A 4MMKA 4M7AE 1YJWQ 1I1JA 2EW3A 4E7KA 1RAIB 2DL5A 4B6MA 1GFCA 2CH4A 2VGNA 1D0XA 4QKUA 5I2MA 2MF2A 3PMIA 3CXCP 3ER0A 3RR6A 4CC3A 4ELYC 1K0XA 5CKHA 1B7TA 2RQRA 1Q95G 3M0RA 4F16A 3E9FA 2O4XB 3QYHB 4M78B 2QXFA 3M55A 2KNBB 2FL7A 4NS5A 2C0IA 3OYCA 1YITT 4C5IA 3JAME 1C1AA 1UUEA 4E2FB 2CREA 2GQVA 1NEGA 1D1CA 1VQMA 4E7IA 1Y57A 2CGHA 1MHNA 2E6NA 1X69A 3G7ZA 2KT1A 1IGQA 4AG2C 5GMKl 3PT9A 2RJEA 3FIFA 2GGRA 2LQ8A 3NHNA 4M7DA 1BCMA 1TH7A 2K2VA 3CCQA 3IQLA 2QYZA 3RNJA 2P84A 4LN2A 4E6RA 2K7AA 4BY6C 1YITQ 1SKUB 5KCHA 3INZA 1E6HA 5FU6C 4M77B 3GLXA 3JB9H 3KUFA 5CQYA 2EQMA 2LRQA 1XJWB 3QUIA 4RTZA 3VS1A 2WSEE 1YCYA 3OYBA 4PJNA 4D8DA 2LZ6B 3MJXA 2PVGB 1Q82C 1UG1A 3CC4T 2R5AA 3H6ZA 3VUBA 5GAOp 2HSPA 3M0PA 3OYGA 4KGVB 2AZSA 2H3JA 2DRMA 2OX7A 3N5BB 4J6WA 1UECA 3VJPA 1N8RR 2LQWA 3X26B 1Z9QA 2KSSA 2E3IA 4M75E 1QW1A 2O88A 2P4TA 2KBTA 4J6YA 2ZAEA 4PFPA 3MHXA 3UDCA 2D6FA 2OTJT 2EWNA 1M4ZA 2DXUA 2V8JA 3CC4Q 2FZGB 4X34A 1VYTA 5GAMf 4EMKA 4N4HA 2ZPHB 2OTLT 2LJ0A 1S72A 4J7FA 3JCMf 4C8QE 1VQ9A 4MMLA 3A1PA 4PNOA 1WIEA 1OPKA 1PRLC 3OSVA 2H3EB 5IH2A 2E70A 1ZSZA 2LX7A 1UJYA 3CC2T 3MCAB 3ME9A 2CH4W 1AWJA 2K9GA 3HSBA 3ULRB 2EFIA 1CKBA 4OF1A 1ZBJA 3KFVA 4M7DG 4Y92A 2XICA 2OTJQ 1YNZA 1RLPC 1OX8A 2QASA 1ZA2B 5LJ5f 2D1XA 1A0NB 2YRDA 2VV5A 4BE0A 3P8DA 3HP9A 3EH2A 3RMQA 2OTLQ 4R56A 3MEUA 2K5IA 5KE3A 2JS0A 3M58A 1SF9A 4V2SA 4XQ3A 4M75D 3HRSA 4ZN3A 3CC2Q 1PC0A 4PL6A 2QQSA 1VQ6A 4Q5WA 2KAFA 4C0GA 2CUBA 1WX6A 3CCEA 2OAWA 4OP0A 5GAN8 4BY6B 1PNJA 1SHFA 3X24B 2GF7A 1D0ZA 4F7UE 4OMMA 2DL3A 3LW5E 4A63B 3EG0A 3VS4A 5HY6A 5CO7A 1C6VX 1BCOA 4ZGJB 1MMGA 2RHIA 3CXCS 2EQUA 1IO6A 1H3ZA 3OMCA 2MWOA 1ZA1B 1X6BA 4LUEA 5D6YA 2R57A 1Y96B 3TEEA 5LL6S 1UTIA 4IUVA 4L59A 1IHVA 3EHQA 4C92G 3QJ6A 1JU5C 4ATOA 3FEOA 1X2KA 1IREB 4AFZC 1NJIC 2JTEA 1J3TA 2LVMA 3NGPA 3OYNA 4LD9K 4D8KA 3RESA 4BI4A 1TSFA 2L8DA 3EFOA 3OYLA 1I81A 2O4XA 2FVUA 5GMKe 3JB9G 3OYMA 3M9QA 5GAN4 2MIOA 2RHXA 5GAMd 2KRMA 3VYGA 3O5ZA 3G71A 3EG1A 2DTHA 3JCMd 4KUDK 3TREA 1QVPA 1X01A 2GNCA 3CMAT 2XDBA 3VS5A 3C0CA 3CMET 4FYXB 2VYTA 2ZPFB 4R55A 3C94A 1H92A 4ELZC 3LWIA 4JJNK 3PIOA 4RTYA 4QQ6A 3M5AA 2E3HA 5IAYA 3L2RA 3NTIA 5IT9E 5LJ5d 2V1RA 4C92C 5KYYB 3I56T 1M1FA 1WXTA 2QQRA 1B34B 3CEYA 1PG5B 5IHKA 1TUGB 3E19A 4FW2A 1YJNT 1T3SA 3M4GA 3VV0A 1NM7A 1QLYA 1LCKA 3CMAQ 4E7SA 2KGTA 2QI2A 3RKWA 4WTOB 1VQNT 3G1JA 3QZ9B 3EGUA 3CMEQ 3CD6A 2F2WA 1ABQA 1VQ8T 5A2QE 3TQ7P 4Z89A 1AT1B 3EG9A 2HDAA 5CCAA 3RERA 1AWXA 3OYHA 1MMDA 2PU9B 1G3YA 2WSFE 2EGEA 1N9SA 2IPOB 1KHCA 3HRTA 2OJ2A 3I56Q 2D8HA 2LX9A 2V1QA 4C92F 5GMKh 5CK9A 2RQTA 4Y28E 1M3AA 1YJNQ 2JJ9A 3OB9A 4J9EA 1K73C 2EIFA 1BI3A 1OPLA 2VB6A 4JLIA 2QEXA 3VS2A 1VQNQ 2BUDA 3ASKA 4JJBA 3H0HA 3R6OA 3JCMe 1VQ8Q 1WZOA 1UGSB 1WXBA 4E7HA 2P0KA 3TSZA 1RLQC 1PCXA 4M78G 2H8HA 2QDLA 2YT6A 4RG8A 2J7IA 2OI3A 3RMSA 1KQ2A 3CCJT 2XKOC 3RIRA 3I55A 3ZBDA 2LT4A 5DM7R 2D0NA 2EYXA 2AK5A 4LXCA 1MNEA 3UPUA 4PFZA 4Z02A 4RTWA 4JRIA 3PTAA 3OQ5A 3A98A 1X75C 2FB7A 2SRCA 2BKDN 4RCCA 2KROA 1VOMA 3VS0A 2WSCE 4FSXA 3M4YA 1RABB 2CZ0B 4J7IA 1VQKT 1U3OA 4DEYA 3J80E 5D6WA 4JRQA 1ZBXA 3G4SA 4BUGA 2GTOA 1M1KC 2Z0WA 3U23A 3REAB 2DJQA 2GTJA 1WHLA 3CCVT 3CCJQ 2JW4A 3OS2A 1NEBA 2EGCA 2M0OA 4KT0E 4RCBA 1IB8A 2LMJA 1D0YA 2QK0A 4M77G 3VRZA 4M7AB 3MPUB 4HXJA 1DJ7B 2J6KA 2KYBA 4CRIA 3JB9I 4M78C 2RI2A 1KC8C 4N4GA 2CZ1B 3CBOA 3JRZA 1VQKQ 2JM8A 4GLMA 1N9RA 4C5EA 3QYGB 1RAAB 3GBQA 2K57A 1VQOA 4C8QC 2JTFA 1W2BP 2MPXC 2RPNA 2G6FX 3JCMh 1MGQA 2DX1A 3OYDA 3CPFA 3CCVQ 3RKXA 2KT8A 4NL3A 5CKFA 1ABOA 3GNFB 2JM9A 4RUGA 1OOTA 4HVUA 3V7CA 1R0BG 1NPPA 2YUNA 3CCRT 2HL5C 4M78F 1WNLA 8ATCB 2QTXA 4X1VA 2LJ3A 2PUOB 4M77C 1YHQA 4C8QF 3M53A 1VQ5A 2KRSA 2HKNA 2K3YA 4VUBA 3P8BB 2DETA 1OU9A 1D3BB 2FPDA 4M7DE 2E41A 3A5ZB 4J5YA 3UA6A 2CDTA 2KXCA 3WXMB 3CXCA 2DJZA 2LNHB 2DFUA 1Y07A 2EJ9A 3OW2A 1JJ2S 2COWA 3EGXA 3M0QA 1V76A 1WXUA 2O9VA 1VQOQ 3CCRQ 3CCST 2DYBA 2HKQB 2VXFA 3I5RA 4MZTA 1YHQT 4FYVB 1FMWA 1VQ7T 3NPFA 1W1FA 2LCLA 2XDPA 2FZKB 2QA4A 4EIKA 2Y90A 2DIQA 4M77F 1PD0A 2RHYA 3VS7A 3X28B 2WACA 2ROLA 1Q86U 2A08A 1K9MR 1M90C 4R0KA 4Y91A 5GJWB 2FHDA 3CCMA 5KYYA 2V8KA 4PJOC 2ED1A 1PSFA 1IXDA 1E7OA 1QKXA 1PRMC 4OB3B 5D6XA 3VYHB 2DD5A 1AD5A 1D09B 3HFNA 4B9WA 3E9GA 3CCSQ 3OY9A 3R6NA 1S1NA 1YHQQ 1YJ9A 3OW2P 1VQ7Q 2Y4YA 1YIJA 3OS0A 3CC7A 4M7DD 1OX9A 5GAN3 3M56A 2X4JA
chains in the Genus database with same CATH topology
2LX7A 1UJYA 2YUQA 1JO8A 2CH4W 1AWJA 2K9GA 1UGVA 3ULRB 2O31A 1CKBA 2BZYA 1UJ0A 2K2MA 1AEYA 1ZBJA 3KFVA 4Y92A 1BU1A 1YNZA 1RLPC 2XMFA 2D1XA 2X3WD 1A0NB 2HCKA 1VYUA 2M51A 1B07A 1YP5A 1K1ZA 2EVRA 1T0JA 2CT3A 2JXBA 3TVTA 2RQWA 2JS0A 2DE0X 1ZUUA 4IIMA 1B3QA 1UDLA 2L0AA 2MOXA 2ABLA 4HVVA 3QWXX 1I07A 2C0TA 3EG2A 4AG1C 1KSWA 2DILA 1HJDA 2CUBA 2BZ8A 1WX6A 2OAWA 1W6XA 1BBZA 2VKNA 1M8MA 2EYZA 1PNJA 1SHFA 1X6GA 2DL4A 3CQTA 4OMMA 2E5KA 2DL3A 4JJCA 4RTTA 4A63B 2AKKA 2PNIA 3EG0A 2C0OA 3VS4A 4CC2A 4IIOA 5HCKA 4J9CA 1M3CA 2FPEA 1G83A 2EYYA 2A28A 2NWMA 1IO6A 2BTTA 2L3PA 1M3BA 1WYXA 4Z8AA 2K3BA 1X6BA 2CSQA 2JT4A 4LUEA 2DBMA 1UTIA 3THKA 2RMOA 2KRNA 4F17A 4J9HA 3EHQA 1M30A 1JU5C 1GFDA 1X2KA 4AFZC 2HEQA 2JTEA 4J9DA 1J3TA 4FSSA 3NGPA 1U5SA 2EKHA 4D8KA 2EBPA 2DM1A 2DL7A 3M0SA 1YWOA 2FO0A 4OMLA 5L23A 2O9SA 1OV3A 3REBB 5ECAA 1SEMA 4LNPA 4OMOA 1G2BA 3M0TA 1JEGA 3UATA 5I11A 2MIOA 2L2PA 2X3XD 1GCPA 3PVQA 1WA7A 2KRMA 3O5ZA 3EG1A 2F2XA 4DEXA 2DF6A 1VA7A 2YUPA 2JMAA 2GNCA 2RN8A 2BZXA 3JV3A 2PTKA 1GRIA 2K79A 1NG2A 2AZVA 3VS5A 4AFQC 3C0CA 1T3LA 2KEAA 4CC4B 3UF4A 1NLOC 2W0ZA 1H92A 1K9AA 1WI7A 1HSQA 4JZ4A 2RQUA 4RTYA 2DVJA 2O2OA 1ZUKA 1NLPC 2ESWA 1KJWA 1AZEA 4ZNXA 1YWPA 2V1RA 1ZX6A 2HBWA 2LJ1A 1TUDA 1K4US 1WXTA 1W70A 1QWFA 1UE9A 2SEMA 4J9IA 4OMNA 5IHKA 1UFFA 4LE9A 1T3SA 2DBKA 1NM7A 1QLYA 1LCKA 2RF0A 4M4ZA 1GCQA 1XOVA 4WCIA 2KYMA 2KGTA 4AFUC 2FRYA 1CKAA 2VWFA 3EGUA 2NUZA 2F2WA 3VRYA 1Z9ZA 1ABQA 1Y0MA 1TUCA 3PE0A 4RTVA 1YN8A 4Z89A 1KIKA 1NYGA 2HDAA 2KXDA 1AWXA 5EC7A 1RUWA 2DMOA 3I9QA 1H3HA 1MV3A 2FRWA 2EGEA 2RNAA 4ESRA 1AVZC 1N5ZA 2OJ2A 1QKWA 2D8HA 2J6FA 1X2QA 5GJVB 2V1QA 1WLPB 1PKSA 2J05A 2RQTA 2A37A 1M27C 1M3AA 1UHFA 4J9EA 1GCQC 2KR3A 1OPLA 3NMZC 3VS2A 1KFZA 1BK2A 1JXMA 4JJBA 3H0HA 3SHWA 3ZL7C 1SPKA 1WXBA 5FWCA 4Z88A 3TSZA 2DLPA 2D8JA 1RLQC 2ECZA 2H8HA 2QDLA 2YT6A 2J7IA 2GBQA 2OI3A 1SRMA 3RBBB 1ARKA 2DA9A 2D0NA 2EYXA 2AK5A 2P4RA 5IXFA 1SHGA 1MUZA 4RTXA 4J9GA 2K6DA 4RTWA 1SRLA 2EPDA 3A98A 1RI9A 2SRCA 4JJDA 4GBQA 1GBRA 2KROA 2KE9A 4ORZA 5FW9A 4F14A 3VS0A 2L3QA 1E6GA 1CSKA 1TG0A 1T0HA 1U3OA 4DEYA 1H8KA 2VVKA 4KRTA 2EQIA 3EHRA 3I35A 1BB9A 2GTOA 3VS6A 3U23A 1I1JA 2EW3A 3REAB 2DJQA 2DL5A 2GTJA 1UHCA 4OMPA 2JW4A 1GFCA 1NEBA 2EGCA 2CH4A 1QCFA 2LMJA 2JMCA 3SEMA 1WDXA 2FPFA 4CC3A 3VRZA 1K0XA 4HXJA 2F2VA 1AWOA 2J6KA 2KYBA 2LP5A 2RQRA 1YCSB 3M0RA 4F16A 1QWEA 2JM8A 4GLMA 3GBQA 2KNBB 2YSQA 2CUDA 3LH5A 1AWWA 2C0IA 2EYWA 2DRKA 2RPNA 1JXOA 1PHTA 1PKTA 2ENMA 2G6FX 2YDLA 2DX1A 1FMKA 1UUEA 1ZLMA 1AOJA 2CREA 2CT4A 1NEGA 1NYFA 3QWYA 2KT8A 1Y57A 1ABOA 2JM9A 1X69A 4RUGA 1AZGB 1OOTA 2KT1A 4HVUA 4AG2C 2J6OA 2GGRA 3NHNA 4QT7A 2YUNA 2B86A 4HVWA 3IQLA 3RNJA 2A36A 4X1VA 2LJ3A 2L3SA 4LN2A 4E6RA 2K7AA 2W10A 4RTUA 1MV0B 4JPBW 3H0FA 1EFNA 1E6HA 1GBQA 2KRSA 4AFSC 2FPDA 1WFWA 4OMQA 4LUDA 3UA6A 2CDTA 4RTZA 3VS1A 2KXCA 2LNHB 3EG3A 1V1CA 4D8DA 3I5SA 2LZ6B 2IIMA 1ZUYA 1UG1A 3M0QA 2J06A 1WXUA 5IHNA 2O9VA 1GL5A 2DYBA 3H41A 2I0NA 2HSPA 3I5RA 3M0PA 3NPFA 1W1FA 2JS2A 4EIKA 3VS3A 2AZSA 2DRMA 4K11A 1UECA 1X43A 2LQWA 1I0CA 1X27A 3VS7A 1K0SA 1Z9QA 2ROLA 5FWBA 2A08A 1SSHA 4R0KA 2AKLA 5GJWB 1VYVA 1JQQA 2O88A 4JZ3A 2KBTA 2EGAA 3H0IA 4CC7A 2ED1A 3UA7A 1E7OA 1QKXA 1PRMC 2RQVA 5IXBA 1U06A 1AD5A 2FEIA 4J9FA 2DNUA 1FYNA 5IHIA 1VYTA 3R6NA 1S1NA 2LCSA 2M0YA 2ED0A 2MCNA 2LJ0A 2DL8A 2YUOA 2PZ1A 1PWTA 4HCKA 3TSWA 2LQNA 1K76A 2CSIA 1WIEA 2FG0A 3FJ5A 3M0UA 4J9BA 3PVLA 1OPKA 1OEBA 2GQIA 2ROTA 1PRLC 5I22A 5IH2A 1HD3A 1ZSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LX7 A;  1UJY A;  2YUQ A;  1JO8 A;  2CH4 W;  1AWJ A;  2K9G A;  1UGV A;  3ULR B;  2O31 A;  1CKB A;  2BZY A;  1UJ0 A;  2K2M A;  1AEY A;  1ZBJ A;  3KFV A;  4Y92 A;  1BU1 A;  1YNZ A;  1RLP C;  2XMF A;  2D1X A;  2X3W D;  1A0N B;  2HCK A;  1VYU A;  2M51 A;  1B07 A;  1YP5 A;  1K1Z A;  2EVR A;  1T0J A;  2CT3 A;  2JXB A;  3TVT A;  2RQW A;  2JS0 A;  2DE0 X;  1ZUU A;  4IIM A;  1B3Q A;  1UDL A;  2L0A A;  2MOX A;  2ABL A;  4HVV A;  3QWX X;  1I07 A;  2C0T A;  3EG2 A;  4AG1 C;  1KSW A;  2DIL A;  1HJD A;  2CUB A;  2BZ8 A;  1WX6 A;  2OAW A;  1W6X A;  1BBZ A;  2VKN A;  1M8M A;  2EYZ A;  1PNJ A;  1SHF A;  1X6G A;  2DL4 A;  3CQT A;  4OMM A;  2E5K A;  2DL3 A;  4JJC A;  4RTT A;  4A63 B;  2AKK A;  2PNI A;  3EG0 A;  2C0O A;  3VS4 A;  4CC2 A;  4IIO A;  5HCK A;  4J9C A;  1M3C A;  2FPE A;  1G83 A;  2EYY A;  2A28 A;  2NWM A;  1IO6 A;  2BTT A;  2L3P A;  1M3B A;  1WYX A;  4Z8A A;  2K3B A;  1X6B A;  2CSQ A;  2JT4 A;  4LUE A;  2DBM A;  1UTI A;  3THK A;  2RMO A;  2KRN A;  4F17 A;  4J9H A;  3EHQ A;  1M30 A;  1JU5 C;  1GFD A;  1X2K A;  4AFZ C;  2HEQ A;  2JTE A;  4J9D A;  1J3T A;  4FSS A;  3NGP A;  1U5S A;  2EKH A;  4D8K A;  2EBP A;  2DM1 A;  2DL7 A;  3M0S A;  1YWO A;  2FO0 A;  4OML A;  5L23 A;  2O9S A;  1OV3 A;  3REB B;  5ECA A;  1SEM A;  4LNP A;  4OMO A;  1G2B A;  3M0T A;  1JEG A;  3UAT A;  5I11 A;  2MIO A;  2L2P A;  2X3X D;  1GCP A;  3PVQ A;  1WA7 A;  2KRM A;  3O5Z A;  3EG1 A;  2F2X A;  4DEX A;  2DF6 A;  1VA7 A;  2YUP A;  2JMA A;  2GNC A;  2RN8 A;  2BZX A;  3JV3 A;  2PTK A;  1GRI A;  2K79 A;  1NG2 A;  2AZV A;  3VS5 A;  4AFQ C;  3C0C A;  1T3L A;  2KEA A;  4CC4 B;  3UF4 A;  1NLO C;  2W0Z A;  1H92 A;  1K9A A;  1WI7 A;  1HSQ A;  4JZ4 A;  2RQU A;  4RTY A;  2DVJ A;  2O2O A;  1ZUK A;  1NLP C;  2ESW A;  1KJW A;  1AZE A;  4ZNX A;  1YWP A;  2V1R A;  1ZX6 A;  2HBW A;  2LJ1 A;  1TUD A;  1K4U S;  1WXT A;  1W70 A;  1QWF A;  1UE9 A;  2SEM A;  4J9I A;  4OMN A;  5IHK A;  1UFF A;  4LE9 A;  1T3S A;  2DBK A;  1NM7 A;  1QLY A;  1LCK A;  2RF0 A;  4M4Z A;  1GCQ A;  1XOV A;  4WCI A;  2KYM A;  2KGT A;  4AFU C;  2FRY A;  1CKA A;  2VWF A;  3EGU A;  2NUZ A;  2F2W A;  3VRY A;  1Z9Z A;  1ABQ A;  1Y0M A;  1TUC A;  3PE0 A;  4RTV A;  1YN8 A;  4Z89 A;  1KIK A;  1NYG A;  2HDA A;  2KXD A;  1AWX A;  5EC7 A;  1RUW A;  2DMO A;  3I9Q A;  1H3H A;  1MV3 A;  2FRW A;  2EGE A;  2RNA A;  4ESR A;  1AVZ C;  1N5Z A;  2OJ2 A;  1QKW A;  2D8H A;  2J6F A;  1X2Q A;  5GJV B;  2V1Q A;  1WLP B;  1PKS A;  2J05 A;  2RQT A;  2A37 A;  1M27 C;  1M3A A;  1UHF A;  4J9E A;  1GCQ C;  2KR3 A;  1OPL A;  3NMZ C;  3VS2 A;  1KFZ A;  1BK2 A;  1JXM A;  4JJB A;  3H0H A;  3SHW A;  3ZL7 C;  1SPK A;  1WXB A;  5FWC A;  4Z88 A;  3TSZ A;  2DLP A;  2D8J A;  1RLQ C;  2ECZ A;  2H8H A;  2QDL A;  2YT6 A;  2J7I A;  2GBQ A;  2OI3 A;  1SRM A;  3RBB B;  1ARK A;  2DA9 A;  2D0N A;  2EYX A;  2AK5 A;  2P4R A;  5IXF A;  1SHG A;  1MUZ A;  4RTX A;  4J9G A;  2K6D A;  4RTW A;  1SRL A;  2EPD A;  3A98 A;  1RI9 A;  2SRC A;  4JJD A;  4GBQ A;  1GBR A;  2KRO A;  2KE9 A;  4ORZ A;  5FW9 A;  4F14 A;  3VS0 A;  2L3Q A;  1E6G A;  1CSK A;  1TG0 A;  1T0H A;  1U3O A;  4DEY A;  1H8K A;  2VVK A;  4KRT A;  2EQI A;  3EHR A;  3I35 A;  1BB9 A;  2GTO A;  3VS6 A;  3U23 A;  1I1J A;  2EW3 A;  3REA B;  2DJQ A;  2DL5 A;  2GTJ A;  1UHC A;  4OMP A;  2JW4 A;  1GFC A;  1NEB A;  2EGC A;  2CH4 A;  1QCF A;  2LMJ A;  2JMC A;  3SEM A;  1WDX A;  2FPF A;  4CC3 A;  3VRZ A;  1K0X A;  4HXJ A;  2F2V A;  1AWO A;  2J6K A;  2KYB A;  2LP5 A;  2RQR A;  1YCS B;  3M0R A;  4F16 A;  1QWE A;  2JM8 A;  4GLM A;  3GBQ A;  2KNB B;  2YSQ A;  2CUD A;  3LH5 A;  1AWW A;  2C0I A;  2EYW A;  2DRK A;  2RPN A;  1JXO A;  1PHT A;  1PKT A;  2ENM A;  2G6F X;  2YDL A;  2DX1 A;  1FMK A;  1UUE A;  1ZLM A;  1AOJ A;  2CRE A;  2CT4 A;  1NEG A;  1NYF A;  3QWY A;  2KT8 A;  1Y57 A;  1ABO A;  2JM9 A;  1X69 A;  4RUG A;  1AZG B;  1OOT A;  2KT1 A;  4HVU A;  4AG2 C;  2J6O A;  2GGR A;  3NHN A;  4QT7 A;  2YUN A;  2B86 A;  4HVW A;  3IQL A;  3RNJ A;  2A36 A;  4X1V A;  2LJ3 A;  2L3S A;  4LN2 A;  4E6R A;  2K7A A;  2W10 A;  4RTU A;  1MV0 B;  4JPB W;  3H0F A;  1EFN A;  1E6H A;  1GBQ A;  2KRS A;  4AFS C;  2FPD A;  1WFW A;  4OMQ A;  4LUD A;  3UA6 A;  2CDT A;  4RTZ A;  3VS1 A;  2KXC A;  2LNH B;  3EG3 A;  1V1C A;  4D8D A;  3I5S A;  2LZ6 B;  2IIM A;  1ZUY A;  1UG1 A;  3M0Q A;  2J06 A;  1WXU A;  5IHN A;  2O9V A;  1GL5 A;  2DYB A;  3H41 A;  2I0N A;  2HSP A;  3I5R A;  3M0P A;  3NPF A;  1W1F A;  2JS2 A;  4EIK A;  3VS3 A;  2AZS A;  2DRM A;  4K11 A;  1UEC A;  1X43 A;  2LQW A;  1I0C A;  1X27 A;  3VS7 A;  1K0S A;  1Z9Q A;  2ROL A;  5FWB A;  2A08 A;  1SSH A;  4R0K A;  2AKL A;  5GJW B;  1VYV A;  1JQQ A;  2O88 A;  4JZ3 A;  2KBT A;  2EGA A;  3H0I A;  4CC7 A;  2ED1 A;  3UA7 A;  1E7O A;  1QKX A;  1PRM C;  2RQV A;  5IXB A;  1U06 A;  1AD5 A;  2FEI A;  4J9F A;  2DNU A;  1FYN A;  5IHI A;  1VYT A;  3R6N A;  1S1N A;  2LCS A;  2M0Y A;  2ED0 A;  2MCN A;  2LJ0 A;  2DL8 A;  2YUO A;  2PZ1 A;  1PWT A;  4HCK A;  3TSW A;  2LQN A;  1K76 A;  2CSI A;  1WIE A;  2FG0 A;  3FJ5 A;  3M0U A;  4J9B A;  3PVL A;  1OPK A;  1OEB A;  2GQI A;  2ROT A;  1PRL C;  5I22 A;  5IH2 A;  1HD3 A;  1ZSG A; 
#chains in the Genus database with same CATH topology
 1UGP B;  2RHU A;  2GFA A;  3AHU A;  1VQ4 A;  1JO8 A;  2CS7 A;  1UGV A;  4AMC A;  4XTW A;  4QW2 A;  4C8Q B;  2DER A;  2D9T A;  1BU1 A;  4PJO F;  1H64 1;  5CVI A;  2X3W D;  5CQX A;  2X4W A;  2HCK A;  1VYU A;  1PD1 A;  4EDU A;  4FYW B;  2CKK A;  1K1Z A;  2EVR A;  1D1B A;  1N8R C;  3TCJ A;  4O5V A;  2X9H A;  1UDL A;  4A4K A;  5L8R E;  2D0Q B;  4BE2 A;  9ATC B;  3C95 A;  2MOX A;  2ABL A;  4HVV A;  2PQW A;  2C0T A;  5GAO m;  4X9D A;  4AG1 C;  1M2V B;  2DIL A;  1HJD A;  2BZ8 A;  3QO3 A;  2GCX A;  2CP7 A;  1VQM T;  2RJC A;  4LDU A;  2EYZ A;  1X6G A;  1BIA A;  3Q1J A;  4QVC A;  4XK8 E;  2FPE A;  3CCQ T;  1VIF A;  1SG5 A;  2EYY A;  4C92 D;  1RAD B;  2K3B A;  2CSQ A;  4DBR A;  4DBF A;  1WJR A;  2XDD A;  4OB2 B;  3THK A;  2RJD A;  2RMO A;  1JB0 E;  3J81 E;  4F17 A;  4FCY A;  2P0Q A;  1VQM Q;  1GFD A;  3JB9 D;  4J83 A;  1W2B S;  4FSS A;  5CAI A;  2DM1 A;  4RG2 A;  1YWO A;  1OV3 A;  1SEM A;  3L2U A;  3E1S A;  3CCQ Q;  2RA2 A;  3M0T A;  3GIB A;  4OB0 B;  4C92 A;  4PJO B;  2XK0 A;  1U1T A;  1R0C B;  1WA7 A;  1OI1 A;  4BI8 B;  1YI2 A;  2RHZ A;  1EX4 A;  2NUP A;  3NTH A;  4A53 A;  2JMA A;  3BFM A;  2NYS A;  2RN8 A;  3ZEH A;  2BZX A;  3MP8 A;  1GRI A;  1FMV A;  4JUV A;  3JCM P;  2EJG A;  5IN1 A;  3V8J A;  4D6W A;  4CC4 B;  2COZ A;  3RUX A;  1K9A A;  1WI7 A;  1M5Q 1;  3RDV A;  5LJ3 g;  1HSQ A;  2RQU A;  2JNG A;  2DPP B;  7AT1 B;  2KK4 A;  1ZUK A;  2LCC A;  3S6W A;  3MET A;  2XD0 A;  5FU7 C;  5I2S A;  3A8L B;  1QWF A;  1S72 T;  3EFR A;  3A8M B;  4OMN A;  5EG2 A;  5GMK i;  1VQ9 T;  4PFO A;  2RO0 A;  1LVK A;  3GPL A;  4LE9 A;  4QVZ A;  4XTU A;  4P5N A;  4FT2 A;  4M4Z A;  2YLC A;  1SSF A;  4FW1 A;  1Q7Y U;  4WCI A;  2QTV A;  5DY9 A;  1VQP A;  1D3B A;  4EPC A;  4AFU C;  2QQA A;  1CKA A;  2HQX A;  3VRY A;  1Z9Z A;  2CP5 A;  1MMA A;  2M1H A;  4PJJ A;  1TUC A;  2HNI A;  3SWN C;  2QAZ A;  4XTV A;  1KIK A;  2JVV A;  1I5O B;  1RUW A;  3CCU A;  3DB4 A;  4KUL A;  2FRW A;  2KI7 A;  2RNA A;  4ESR A;  3CBP A;  3EFS A;  1AVZ C;  4KGZ B;  1I8F A;  2R58 A;  2J6F A;  4FM4 B;  5HK0 A;  1S72 Q;  3T9N A;  2J05 A;  3LLR A;  3HFO A;  1VQ9 Q;  4QVD A;  1ZHI A;  2B8A A;  2DXT A;  3X25 B;  4M78 D;  1Q86 R;  5LJ3 j;  3OW2 S;  3QXE B;  1KFZ A;  2BE9 B;  4M7A G;  1VQ6 T;  3SHW A;  4PJM A;  2CP3 A;  3CCE T;  3ZL7 C;  2KDS A;  3PIP A;  3QDR B;  1JJ2 A;  2ZGW A;  5AT1 B;  4A4H A;  4C0F A;  2GBQ A;  3RBB B;  1ARK A;  1QVG S;  1G3S A;  1MUZ A;  4IUQ A;  2K6D A;  3OYK A;  3PNW C;  3JCM W;  1N27 A;  4GBQ A;  2KE9 A;  3LYI A;  4C0D C;  6AT1 B;  3GF5 A;  4M78 A;  1UEB A;  2P0P A;  5GAN g;  1E6G A;  5KYN A;  4ZGD B;  1CSK A;  1NZ9 A;  1WJS A;  5DLQ E;  1VQ6 Q;  1H8K A;  1M2O A;  2EQI A;  1W4S A;  3CCE Q;  4C8Q A;  4M77 D;  4A4F A;  4XU0 A;  2RI5 A;  3SFM A;  3G6E A;  3JCM J;  1M1G A;  2DZC A;  4OMP A;  2RK2 A;  1WHM A;  4DA4 A;  4M7A C;  1KD1 U;  5KYU B;  1JJ2 P;  1WHJ A;  2JMC A;  4MDW A;  1OZ3 A;  1AWO A;  1KQS A;  2LP5 A;  2K5L A;  1IZ6 A;  3G71 T;  4PJL A;  3D7S B;  1QWE A;  4KUI A;  1Q81 U;  1UGR B;  5FU7 B;  1OZ2 A;  2YSQ A;  2CUD A;  1WPY A;  1AWW A;  2DIG A;  4M77 A;  2EYW A;  2DRK A;  1JXO A;  2E5Q A;  1BIB A;  1PHT A;  1PKT A;  2ENM A;  2YLB A;  1RL2 A;  1NYF A;  4GY5 A;  5GAN j;  2RH2 A;  4M7A F;  1AZG B;  3FRN A;  2KMT A;  3SWN B;  5GAN 7;  2J6O A;  1K8A U;  3G71 Q;  4HCZ A;  4QT7 A;  2B86 A;  2Y4X A;  1KQS P;  1U1S A;  4XU1 A;  4OB1 B;  3CD6 T;  3OYY A;  4DOV A;  2HAX A;  4JLG A;  2RK1 A;  4C0Z A;  3CCL A;  3X20 B;  4XTX A;  1EFN A;  4OGE A;  1GBQ A;  4AFS C;  1WFW A;  1ZQ1 A;  4ZN1 A;  4LUD A;  5D7U A;  3FLG A;  3FJP A;  4PJO A;  4O6J A;  1V1C A;  3QDF A;  3I5S A;  2IIM A;  2DXC A;  1O75 A;  1ZUY A;  2J06 A;  1M90 U;  1GL5 A;  2PVO B;  2DD4 A;  1IGU A;  2QGF B;  4C8Q G;  1FWZ A;  2QEX T;  2LT1 A;  2MMP A;  2V26 A;  2LDM A;  3M57 A;  1V29 B;  1GXI E;  3CD6 Q;  1W2B A;  3VS3 A;  1VQL A;  4BI3 A;  2ZZD A;  2I2L A;  8AT1 B;  1WJQ A;  2IG0 A;  4C0D B;  1OYX A;  2COY A;  3OYA A;  1LNX A;  1SSH A;  5HK3 A;  2KQW A;  1VYV A;  4JZ3 A;  2EGA A;  3DKM A;  3I55 T;  1M9S A;  2PVD B;  5GAO n;  2HSE B;  3BY7 A;  3L42 A;  2YHT A;  5IXB A;  2FEI A;  1BYM A;  4XTY A;  4M75 C;  3MO8 A;  1FYN A;  2AIR B;  2MWP A;  1Q7Y R;  2M0Y A;  2QEX Q;  2MCN A;  5A0G A;  2PZ1 A;  1X6O A;  2LQN A;  1K76 A;  2CSI A;  3M0U A;  1QVF P;  3PVL A;  1OEB A;  3G4S T;  2ROT A;  1Y7X A;  1HD3 A;  2ATC B;  1ZSG A;  2DKG A;  4BB7 A;  2YUQ A;  4A54 A;  3PMT A;  3CPW P;  1OU8 A;  1RAH B;  4ANJ A;  2YRC A;  2O31 A;  2ZPG B;  3I55 Q;  2BZY A;  1UJ0 A;  3F70 A;  1KHI A;  2LTO A;  3LGF A;  2EKO A;  1PM3 A;  1NBE B;  2M51 A;  2HL3 A;  4J6X A;  2VXE A;  2XU8 A;  1RAC B;  4M75 F;  4BD3 A;  1NE8 A;  5DLO A;  1T0J A;  2CT3 A;  1Y96 A;  5C0M A;  2JXB A;  1BI0 A;  3TVT A;  2JN0 A;  4HT9 A;  2QGG A;  1QMC A;  2R5M A;  2MI6 A;  3H9N A;  1ZUU A;  3L2Q A;  3G4S Q;  1VQO T;  4HT8 A;  5C6S A;  1ACM B;  1K9M C;  2DO3 A;  2AT1 B;  5CR2 A;  1R77 A;  4PJO G;  3VUZ A;  1I07 A;  3OYE A;  3EG2 A;  1Q82 U;  1KSW A;  1LOJ A;  5KYX B;  5FRO A;  2DZ9 A;  2EQJ A;  3HHT B;  3ZFJ A;  2BIV A;  1M8M A;  1YJW A;  3MEV A;  2DL4 A;  4QQD A;  3DLL A;  2AKK A;  2PNI A;  2X4X A;  2C0O A;  4KBM B;  4IIO A;  2RJF A;  5KE2 A;  1G83 A;  2K3X A;  2L3P A;  2BTT A;  4YTL A;  1WYX A;  3RKY A;  2LQK A;  4Z8A A;  2JT4 A;  3L2Z A;  2AHJ B;  1OUL A;  4WF2 A;  5CIU A;  2KVQ G;  3FDR A;  3C12 A;  1R8O B;  1VQ5 T;  2A7Y A;  3M59 A;  1M30 A;  1KD1 R;  1QVG A;  2YXY A;  4NOY A;  2HEQ A;  4OGC A;  2EBP A;  2DL7 A;  5LJ3 e;  2EAY A;  1O9S A;  4FU6 A;  3J7A F;  4J8O A;  5J39 A;  2E12 A;  3REB B;  5CKE A;  4LDY A;  1Q81 R;  3LX7 A;  1YBY A;  4OMO A;  5M9O A;  4JS5 A;  1B34 A;  2MAM A;  1JEG A;  1TOV A;  3UAT A;  2XID A;  3LH0 A;  1MND A;  4E7J A;  5I11 A;  2L2P A;  5GAM g;  2X3X D;  3PVQ A;  4F7U F;  3JCM c;  4N4I A;  3V7S A;  2QA4 T;  3OBW A;  2F2X A;  3HL8 A;  4M75 B;  2QQ9 A;  4DEX A;  2DF6 A;  1VQ5 Q;  1VA7 A;  1RAG B;  3JV3 A;  1KQS S;  2PTK A;  2AZV A;  4XTZ A;  5GAO l;  1YIT A;  1T3L A;  2PUK B;  3CCM T;  3QZ5 B;  4FL6 A;  5GAN 6;  4C92 E;  4DQ2 A;  3SWN A;  3GOX A;  1KG1 A;  2W0Z A;  1K8A R;  4BAC A;  3AT1 B;  4JZ4 A;  4LDV A;  4FIB A;  1QVG P;  2O2O A;  2GFU A;  4JDS A;  3TU4 K;  3A8G B;  1QP2 A;  3EFO B;  5KCO A;  5LJ5 g;  1YWP A;  4C5G A;  2HBW A;  1TU0 B;  1TUD A;  1YJ9 T;  4JRK A;  1W70 A;  1UE9 A;  2SEM A;  4J9I A;  1YIJ T;  4IUU A;  2QA4 Q;  3CC7 T;  4A4E A;  4KH0 B;  1VUB A;  1XOV A;  2JOY A;  3SD4 A;  1UGQ B;  4B9X A;  1VQ4 T;  2VWF A;  2CP6 A;  3OS5 A;  2DXB A;  3CCM Q;  4RTV A;  1YN8 A;  4LD6 A;  2NUT B;  4ZGE B;  4LDX A;  2HMA A;  5GAM j;  5EC7 A;  1M90 R;  2DMO A;  3I9Q A;  1H3H A;  1HXD A;  2RM4 A;  5FRM A;  5LJ3 h;  2A3L A;  1N5Z A;  3LGL A;  4M7A D;  1YJ9 Q;  2DEQ A;  1X2Q A;  3PFS A;  4NL2 A;  1PKS A;  2L89 A;  1YIJ Q;  1WQW A;  3WVE B;  3CC7 Q;  3CC4 A;  1M27 C;  4BDZ A;  1UHF A;  3JCM b;  1NJI U;  5GAN e;  1GCQ C;  3QJY A;  3NMZ C;  3BW1 A;  1LPL A;  1VQ4 Q;  1BK2 A;  1JXM A;  4AT1 B;  4F7U B;  4BE1 A;  4MZP A;  1QVF S;  5LJ5 j;  5FWC A;  3S3O A;  4E47 A;  2DLP A;  2D8J A;  1HYO A;  2HZY A;  2ECZ A;  3EG9 B;  3CPW S;  2BE7 D;  3CBM A;  4XU2 A;  1G3T A;  5GMK m;  3MP6 A;  5IXF A;  3BDL A;  4M7A A;  2OAU A;  2OTJ A;  4J9G A;  4N0A C;  2EPD A;  3GP8 A;  3MEA A;  5FW9 A;  2OTL A;  2RI3 A;  2XG8 D;  4E7L A;  1TG0 A;  1T0H A;  3JSC A;  4L5G A;  1QCO A;  3MEW A;  4KRT A;  3EHR A;  3I35 A;  5CKD A;  1BB9 A;  4EMH A;  2HQE A;  3QKJ A;  3V8L A;  3CC2 A;  4JS4 A;  1EZZ B;  1IHW A;  1UHC A;  3WVD B;  1FXX A;  4M78 E;  1AHJ B;  1BI2 A;  2ZPI B;  1QCF A;  3SEM A;  1WDX A;  2FPF A;  1XNI A;  1TTH B;  1Q86 C;  3SB2 A;  2F2V A;  1YCS B;  5KYW B;  3JCM Q;  3PGG A;  1WHG A;  1YI2 T;  3VU3 C;  1Q82 R;  1I5L A;  4HCC A;  2LNV A;  3JCM X;  5GAO q;  5KYX A;  1QP3 A;  5GAN h;  4BDY A;  1YFN A;  3EGD B;  2QG9 B;  3LH5 A;  3S3N A;  3QPH A;  5I21 A;  2IVW A;  2YDL A;  1FMK A;  1ZLM A;  1AOJ A;  2CT4 A;  2ZPE B;  3QWY A;  2CZ7 B;  5GAN 5;  2CP2 A;  4RKU E;  2MYS A;  1K73 U;  4II1 A;  3EAE A;  4ZTF A;  3QHS A;  2X51 A;  4M77 E;  4RMO A;  2F5T X;  3V8K A;  4MDX A;  2RB6 A;  1F1B B;  1YI2 Q;  5FLX E;  4EMG A;  4HVW A;  1WGS A;  2A36 A;  1VQP T;  2L3S A;  3L2V A;  1LJO A;  2VAS A;  2W10 A;  4KGX B;  4RTU A;  1MV0 B;  4JPB W;  3H0F A;  2XI9 A;  2VC8 A;  4GLK A;  2HQH A;  2YWW A;  3CCU T;  4C8Q D;  5FU6 B;  2YRV A;  4OMQ A;  3OS1 A;  2DTI A;  2LC4 A;  4OVA A;  5J3B A;  3EG3 A;  1XQH A;  4M7D C;  2EYQ A;  5IHN A;  3OYF A;  1M1K U;  2CP0 A;  4M75 A;  3H41 A;  2I0N A;  1TS9 A;  1VQP Q;  1C0M A;  2QQB A;  2JS2 A;  4K11 A;  4PLI A;  1HK9 A;  4PJO E;  4E7Z A;  1X43 A;  1I0C A;  1X27 A;  1K0S A;  3CMA A;  3OBY A;  5FWB A;  3CCU Q;  2AKL A;  3CME A;  1JQQ A;  1KC8 U;  1I4K 1;  3H0I A;  4CC7 A;  3MKD A;  3UA7 A;  1WHH A;  5AYF A;  2RQV A;  3OSS C;  2FZC B;  1U06 A;  2ZCF B;  4MZM A;  4J9F A;  2DNU A;  3HPW A;  5IHI A;  2LCS A;  4M7D F;  3BDU A;  3EGX B;  3I56 A;  2ED0 A;  2DL8 A;  2YUO A;  3MP1 A;  1PWT A;  4HCK A;  3TSW A;  2FG0 A;  1D1A A;  3FJ5 A;  4J9B A;  1YJN A;  2GQI A;  5I22 A;  2O01 E;  1OQK A;  3HKS A;  2NUT A;  3O8V A;  3DB3 A;  1M2V A;  2DEU A;  1G8X A;  4HCB A;  3SDZ A;  1MMN A;  1VQN A;  4QQG A;  2DTO A;  3G6E T;  4PKC C;  1P92 A;  1VQ8 A;  2L3R A;  4HA8 A;  5LJ3 f;  2K2M A;  1AEY A;  2F5K A;  3C4S A;  1JBM A;  1K9M U;  3GNG A;  3E2U A;  1QCN A;  3V7R A;  2XMF A;  3EH1 A;  2JUF A;  4IUR A;  1NJI R;  3HTR A;  1B07 A;  1FX7 A;  1YP5 A;  4EMK C;  4PJO D;  2CYZ B;  4DBQ A;  2RQW A;  1BI1 A;  1KQ1 A;  4F7U A;  1RI0 A;  3M54 A;  2DE0 X;  4IIM A;  4LDW A;  1B3Q A;  1ZSZ C;  2L0A A;  4PLL A;  3NFC A;  3QWX X;  5HKC A;  3G6E Q;  3URG A;  3HRU A;  3NTK A;  1W6X A;  2G3R A;  3JB9 J;  1QQJ A;  5GAO r;  1BBZ A;  2VKN A;  3QG1 A;  4M75 G;  2E64 A;  2DVE A;  1KK7 A;  4F04 B;  1Q7Y C;  3CQT A;  2E5K A;  4JJC A;  2NLU A;  4ME7 A;  4RTT A;  3CCJ A;  4CC2 A;  5HCK A;  1N6A A;  4J9C A;  1M3C A;  1G3W A;  3FB9 A;  3P8H A;  2A28 A;  2NWM A;  5GAM e;  1M3B A;  2K4Y A;  1QVF A;  4A4G A;  2EJF A;  4TVR A;  2DBM A;  4M7D B;  3JB9 F;  3CCL T;  1VQK A;  2EQK A;  2VUB A;  2KRN A;  3CPW A;  4J9H A;  1XTD A;  4ZTJ A;  1UB4 A;  3KBG A;  3L1A A;  3QBY A;  2KY9 A;  2DK3 A;  3OYJ A;  4J9D A;  1RAF B;  1U5S A;  2DAQ A;  2EKH A;  3M0S A;  5J26 A;  2FO0 A;  3CCV A;  4OML A;  4KH1 B;  5L23 A;  2O9S A;  5ECA A;  5KYW A;  2E65 A;  2JZ2 A;  5LJ5 e;  4LNP A;  3OMG A;  1G2B A;  2RD1 A;  4CI0 C;  5KH6 A;  1GCP A;  5GAN f;  3EGD A;  1TWB A;  1VQL T;  3CCL Q;  4IUT A;  1WHK A;  2YUP A;  3UT1 A;  2DYI A;  3OA6 A;  4L6V 5;  2A0F B;  5A0D A;  2K79 A;  1K73 R;  1NG2 A;  4AFQ C;  1JRI A;  3FC3 A;  2JTM A;  2HD0 A;  1U8R A;  2KEA A;  1Y71 A;  3UF4 A;  1NLO C;  5GAN 2;  3A8H B;  5LJ3 d;  2M16 A;  1N8R U;  2DVJ A;  2K5F A;  4F7U G;  1NLP C;  4X9C A;  2ESW A;  1KJW A;  1AZE A;  4ZNX A;  2E6Z A;  1M8V A;  1ZX6 A;  2LJ1 A;  4DOW A;  1K4U S;  4IKF A;  2HBP A;  4C92 B;  3H8Z A;  1UFF A;  1VQL Q;  5GAM h;  3CCR A;  2DBK A;  1IRX A;  3BE3 A;  1KD1 C;  4C5H A;  2X35 A;  2RF0 A;  2F69 A;  1GCQ A;  1BKB A;  4EMK B;  2F1L A;  2KYM A;  2FRY A;  2NUP B;  2NUZ A;  1Y0M A;  4HKE A;  3PE0 A;  3QSU A;  2E10 A;  1NYG A;  2KXD A;  2FYK A;  1Q81 C;  1G5V A;  1M1K R;  1ZSZ B;  3DLM A;  1PSE A;  1MV3 A;  3UWN A;  2XHC A;  1VIE A;  3KXT A;  1QKW A;  2X4Y A;  5GJV B;  1WLP B;  5LJ5 h;  2C06 A;  2E4H A;  4N0A A;  2A37 A;  3A8O B;  4JRP A;  3CCS A;  3QII A;  3S3M A;  2KR3 A;  2QDY B;  1VQ7 A;  3JCM V;  2M9U A;  1KC8 R;  4XAX B;  2MK5 A;  1K8A C;  4DBH A;  1SPK A;  3L2W A;  5GMK j;  4Z88 A;  4XU3 A;  2CZ6 B;  4UC4 A;  4FT4 A;  1YJW T;  5CKB A;  2E1H A;  1NPR A;  5KYU A;  1SRM A;  3OYI A;  2VGM A;  2DA9 A;  2P4R A;  3LWH A;  1SHG A;  4RTX A;  2ZPB B;  1SRL A;  1WQ7 A;  1RI9 A;  1RAE B;  4JJD A;  1GBR A;  4ORZ A;  1TXQ A;  1EIF A;  4F14 A;  4IUP A;  2L3Q A;  5FRN A;  5GAN d;  5A0L A;  2M02 A;  4OMF B;  2L5Q A;  3VKI A;  4PK4 A;  2VVK A;  4FYY B;  3JCM g;  2V8I A;  3VS6 A;  4MMK A;  4M7A E;  1YJW Q;  1I1J A;  2EW3 A;  4E7K A;  1RAI B;  2DL5 A;  4B6M A;  1GFC A;  2CH4 A;  2VGN A;  1D0X A;  4QKU A;  5I2M A;  2MF2 A;  3PMI A;  3CXC P;  3ER0 A;  3RR6 A;  4CC3 A;  4ELY C;  1K0X A;  5CKH A;  1B7T A;  2RQR A;  1Q95 G;  3M0R A;  4F16 A;  3E9F A;  2O4X B;  3QYH B;  4M78 B;  2QXF A;  3M55 A;  2KNB B;  2FL7 A;  4NS5 A;  2C0I A;  3OYC A;  1YIT T;  4C5I A;  3JAM E;  1C1A A;  1UUE A;  4E2F B;  2CRE A;  2GQV A;  1NEG A;  1D1C A;  1VQM A;  4E7I A;  1Y57 A;  2CGH A;  1MHN A;  2E6N A;  1X69 A;  3G7Z A;  2KT1 A;  1IGQ A;  4AG2 C;  5GMK l;  3PT9 A;  2RJE A;  3FIF A;  2GGR A;  2LQ8 A;  3NHN A;  4M7D A;  1BCM A;  1TH7 A;  2K2V A;  3CCQ A;  3IQL A;  2QYZ A;  3RNJ A;  2P84 A;  4LN2 A;  4E6R A;  2K7A A;  4BY6 C;  1YIT Q;  1SKU B;  5KCH A;  3INZ A;  1E6H A;  5FU6 C;  4M77 B;  3GLX A;  3JB9 H;  3KUF A;  5CQY A;  2EQM A;  2LRQ A;  1XJW B;  3QUI A;  4RTZ A;  3VS1 A;  2WSE E;  1YCY A;  3OYB A;  4PJN A;  4D8D A;  2LZ6 B;  3MJX A;  2PVG B;  1Q82 C;  1UG1 A;  3CC4 T;  2R5A A;  3H6Z A;  3VUB A;  5GAO p;  2HSP A;  3M0P A;  3OYG A;  4KGV B;  2AZS A;  2H3J A;  2DRM A;  2OX7 A;  3N5B B;  4J6W A;  1UEC A;  3VJP A;  1N8R R;  2LQW A;  3X26 B;  1Z9Q A;  2KSS A;  2E3I A;  4M75 E;  1QW1 A;  2O88 A;  2P4T A;  2KBT A;  4J6Y A;  2ZAE A;  4PFP A;  3MHX A;  3UDC A;  2D6F A;  2OTJ T;  2EWN A;  1M4Z A;  2DXU A;  2V8J A;  3CC4 Q;  2FZG B;  4X34 A;  1VYT A;  5GAM f;  4EMK A;  4N4H A;  2ZPH B;  2OTL T;  2LJ0 A;  1S72 A;  4J7F A;  3JCM f;  4C8Q E;  1VQ9 A;  4MML A;  3A1P A;  4PNO A;  1WIE A;  1OPK A;  1PRL C;  3OSV A;  2H3E B;  5IH2 A;  2E70 A;  1ZSZ A;  2LX7 A;  1UJY A;  3CC2 T;  3MCA B;  3ME9 A;  2CH4 W;  1AWJ A;  2K9G A;  3HSB A;  3ULR B;  2EFI A;  1CKB A;  4OF1 A;  1ZBJ A;  3KFV A;  4M7D G;  4Y92 A;  2XIC A;  2OTJ Q;  1YNZ A;  1RLP C;  1OX8 A;  2QAS A;  1ZA2 B;  5LJ5 f;  2D1X A;  1A0N B;  2YRD A;  2VV5 A;  4BE0 A;  3P8D A;  3HP9 A;  3EH2 A;  3RMQ A;  2OTL Q;  4R56 A;  3MEU A;  2K5I A;  5KE3 A;  2JS0 A;  3M58 A;  1SF9 A;  4V2S A;  4XQ3 A;  4M75 D;  3HRS A;  4ZN3 A;  3CC2 Q;  1PC0 A;  4PL6 A;  2QQS A;  1VQ6 A;  4Q5W A;  2KAF A;  4C0G A;  2CUB A;  1WX6 A;  3CCE A;  2OAW A;  4OP0 A;  5GAN 8;  4BY6 B;  1PNJ A;  1SHF A;  3X24 B;  2GF7 A;  1D0Z A;  4F7U E;  4OMM A;  2DL3 A;  3LW5 E;  4A63 B;  3EG0 A;  3VS4 A;  5HY6 A;  5CO7 A;  1C6V X;  1BCO A;  4ZGJ B;  1MMG A;  2RHI A;  3CXC S;  2EQU A;  1IO6 A;  1H3Z A;  3OMC A;  2MWO A;  1ZA1 B;  1X6B A;  4LUE A;  5D6Y A;  2R57 A;  1Y96 B;  3TEE A;  5LL6 S;  1UTI A;  4IUV A;  4L59 A;  1IHV A;  3EHQ A;  4C92 G;  3QJ6 A;  1JU5 C;  4ATO A;  3FEO A;  1X2K A;  1IRE B;  4AFZ C;  1NJI C;  2JTE A;  1J3T A;  2LVM A;  3NGP A;  3OYN A;  4LD9 K;  4D8K A;  3RES A;  4BI4 A;  1TSF A;  2L8D A;  3EFO A;  3OYL A;  1I81 A;  2O4X A;  2FVU A;  5GMK e;  3JB9 G;  3OYM A;  3M9Q A;  5GAN 4;  2MIO A;  2RHX A;  5GAM d;  2KRM A;  3VYG A;  3O5Z A;  3G71 A;  3EG1 A;  2DTH A;  3JCM d;  4KUD K;  3TRE A;  1QVP A;  1X01 A;  2GNC A;  3CMA T;  2XDB A;  3VS5 A;  3C0C A;  3CME T;  4FYX B;  2VYT A;  2ZPF B;  4R55 A;  3C94 A;  1H92 A;  4ELZ C;  3LWI A;  4JJN K;  3PIO A;  4RTY A;  4QQ6 A;  3M5A A;  2E3H A;  5IAY A;  3L2R A;  3NTI A;  5IT9 E;  5LJ5 d;  2V1R A;  4C92 C;  5KYY B;  3I56 T;  1M1F A;  1WXT A;  2QQR A;  1B34 B;  3CEY A;  1PG5 B;  5IHK A;  1TUG B;  3E19 A;  4FW2 A;  1YJN T;  1T3S A;  3M4G A;  3VV0 A;  1NM7 A;  1QLY A;  1LCK A;  3CMA Q;  4E7S A;  2KGT A;  2QI2 A;  3RKW A;  4WTO B;  1VQN T;  3G1J A;  3QZ9 B;  3EGU A;  3CME Q;  3CD6 A;  2F2W A;  1ABQ A;  1VQ8 T;  5A2Q E;  3TQ7 P;  4Z89 A;  1AT1 B;  3EG9 A;  2HDA A;  5CCA A;  3RER A;  1AWX A;  3OYH A;  1MMD A;  2PU9 B;  1G3Y A;  2WSF E;  2EGE A;  1N9S A;  2IPO B;  1KHC A;  3HRT A;  2OJ2 A;  3I56 Q;  2D8H A;  2LX9 A;  2V1Q A;  4C92 F;  5GMK h;  5CK9 A;  2RQT A;  4Y28 E;  1M3A A;  1YJN Q;  2JJ9 A;  3OB9 A;  4J9E A;  1K73 C;  2EIF A;  1BI3 A;  1OPL A;  2VB6 A;  4JLI A;  2QEX A;  3VS2 A;  1VQN Q;  2BUD A;  3ASK A;  4JJB A;  3H0H A;  3R6O A;  3JCM e;  1VQ8 Q;  1WZO A;  1UGS B;  1WXB A;  4E7H A;  2P0K A;  3TSZ A;  1RLQ C;  1PCX A;  4M78 G;  2H8H A;  2QDL A;  2YT6 A;  4RG8 A;  2J7I A;  2OI3 A;  3RMS A;  1KQ2 A;  3CCJ T;  2XKO C;  3RIR A;  3I55 A;  3ZBD A;  2LT4 A;  5DM7 R;  2D0N A;  2EYX A;  2AK5 A;  4LXC A;  1MNE A;  3UPU A;  4PFZ A;  4Z02 A;  4RTW A;  4JRI A;  3PTA A;  3OQ5 A;  3A98 A;  1X75 C;  2FB7 A;  2SRC A;  2BKD N;  4RCC A;  2KRO A;  1VOM A;  3VS0 A;  2WSC E;  4FSX A;  3M4Y A;  1RAB B;  2CZ0 B;  4J7I A;  1VQK T;  1U3O A;  4DEY A;  3J80 E;  5D6W A;  4JRQ A;  1ZBX A;  3G4S A;  4BUG A;  2GTO A;  1M1K C;  2Z0W A;  3U23 A;  3REA B;  2DJQ A;  2GTJ A;  1WHL A;  3CCV T;  3CCJ Q;  2JW4 A;  3OS2 A;  1NEB A;  2EGC A;  2M0O A;  4KT0 E;  4RCB A;  1IB8 A;  2LMJ A;  1D0Y A;  2QK0 A;  4M77 G;  3VRZ A;  4M7A B;  3MPU B;  4HXJ A;  1DJ7 B;  2J6K A;  2KYB A;  4CRI A;  3JB9 I;  4M78 C;  2RI2 A;  1KC8 C;  4N4G A;  2CZ1 B;  3CBO A;  3JRZ A;  1VQK Q;  2JM8 A;  4GLM A;  1N9R A;  4C5E A;  3QYG B;  1RAA B;  3GBQ A;  2K57 A;  1VQO A;  4C8Q C;  2JTF A;  1W2B P;  2MPX C;  2RPN A;  2G6F X;  3JCM h;  1MGQ A;  2DX1 A;  3OYD A;  3CPF A;  3CCV Q;  3RKX A;  2KT8 A;  4NL3 A;  5CKF A;  1ABO A;  3GNF B;  2JM9 A;  4RUG A;  1OOT A;  4HVU A;  3V7C A;  1R0B G;  1NPP A;  2YUN A;  3CCR T;  2HL5 C;  4M78 F;  1WNL A;  8ATC B;  2QTX A;  4X1V A;  2LJ3 A;  2PUO B;  4M77 C;  1YHQ A;  4C8Q F;  3M53 A;  1VQ5 A;  2KRS A;  2HKN A;  2K3Y A;  4VUB A;  3P8B B;  2DET A;  1OU9 A;  1D3B B;  2FPD A;  4M7D E;  2E41 A;  3A5Z B;  4J5Y A;  3UA6 A;  2CDT A;  2KXC A;  3WXM B;  3CXC A;  2DJZ A;  2LNH B;  2DFU A;  1Y07 A;  2EJ9 A;  3OW2 A;  1JJ2 S;  2COW A;  3EGX A;  3M0Q A;  1V76 A;  1WXU A;  2O9V A;  1VQO Q;  3CCR Q;  3CCS T;  2DYB A;  2HKQ B;  2VXF A;  3I5R A;  4MZT A;  1YHQ T;  4FYV B;  1FMW A;  1VQ7 T;  3NPF A;  1W1F A;  2LCL A;  2XDP A;  2FZK B;  2QA4 A;  4EIK A;  2Y90 A;  2DIQ A;  4M77 F;  1PD0 A;  2RHY A;  3VS7 A;  3X28 B;  2WAC A;  2ROL A;  1Q86 U;  2A08 A;  1K9M R;  1M90 C;  4R0K A;  4Y91 A;  5GJW B;  2FHD A;  3CCM A;  5KYY A;  2V8K A;  4PJO C;  2ED1 A;  1PSF A;  1IXD A;  1E7O A;  1QKX A;  1PRM C;  4OB3 B;  5D6X A;  3VYH B;  2DD5 A;  1AD5 A;  1D09 B;  3HFN A;  4B9W A;  3E9G A;  3CCS Q;  3OY9 A;  3R6N A;  1S1N A;  1YHQ Q;  1YJ9 A;  3OW2 P;  1VQ7 Q;  2Y4Y A;  1YIJ A;  3OS0 A;  3CC7 A;  4M7D D;  1OX9 A;  5GAN 3;  3M56 A;  2X4J A; 
#chains in the Genus database with same CATH homology
 2LX7 A;  1UJY A;  2YUQ A;  1JO8 A;  2CH4 W;  1AWJ A;  2K9G A;  1UGV A;  3ULR B;  2O31 A;  1CKB A;  2BZY A;  1UJ0 A;  2K2M A;  1AEY A;  1ZBJ A;  3KFV A;  4Y92 A;  1BU1 A;  1YNZ A;  1RLP C;  2XMF A;  2D1X A;  2X3W D;  1A0N B;  2HCK A;  1VYU A;  2M51 A;  1B07 A;  1YP5 A;  1K1Z A;  2EVR A;  1T0J A;  2CT3 A;  2JXB A;  3TVT A;  2RQW A;  2JS0 A;  2DE0 X;  1ZUU A;  4IIM A;  1B3Q A;  1UDL A;  2L0A A;  2MOX A;  2ABL A;  4HVV A;  3QWX X;  1I07 A;  2C0T A;  3EG2 A;  4AG1 C;  1KSW A;  2DIL A;  1HJD A;  2CUB A;  2BZ8 A;  1WX6 A;  2OAW A;  1W6X A;  1BBZ A;  2VKN A;  1M8M A;  2EYZ A;  1PNJ A;  1SHF A;  1X6G A;  2DL4 A;  3CQT A;  4OMM A;  2E5K A;  2DL3 A;  4JJC A;  4RTT A;  4A63 B;  2AKK A;  2PNI A;  3EG0 A;  2C0O A;  3VS4 A;  4CC2 A;  4IIO A;  5HCK A;  4J9C A;  1M3C A;  2FPE A;  1G83 A;  2EYY A;  2A28 A;  2NWM A;  1IO6 A;  2BTT A;  2L3P A;  1M3B A;  1WYX A;  4Z8A A;  2K3B A;  1X6B A;  2CSQ A;  2JT4 A;  4LUE A;  2DBM A;  1UTI A;  3THK A;  2RMO A;  2KRN A;  4F17 A;  4J9H A;  3EHQ A;  1M30 A;  1JU5 C;  1GFD A;  1X2K A;  4AFZ C;  2HEQ A;  2JTE A;  4J9D A;  1J3T A;  4FSS A;  3NGP A;  1U5S A;  2EKH A;  4D8K A;  2EBP A;  2DM1 A;  2DL7 A;  3M0S A;  1YWO A;  2FO0 A;  4OML A;  5L23 A;  2O9S A;  1OV3 A;  3REB B;  5ECA A;  1SEM A;  4LNP A;  4OMO A;  1G2B A;  3M0T A;  1JEG A;  3UAT A;  5I11 A;  2MIO A;  2L2P A;  2X3X D;  1GCP A;  3PVQ A;  1WA7 A;  2KRM A;  3O5Z A;  3EG1 A;  2F2X A;  4DEX A;  2DF6 A;  1VA7 A;  2YUP A;  2JMA A;  2GNC A;  2RN8 A;  2BZX A;  3JV3 A;  2PTK A;  1GRI A;  2K79 A;  1NG2 A;  2AZV A;  3VS5 A;  4AFQ C;  3C0C A;  1T3L A;  2KEA A;  4CC4 B;  3UF4 A;  1NLO C;  2W0Z A;  1H92 A;  1K9A A;  1WI7 A;  1HSQ A;  4JZ4 A;  2RQU A;  4RTY A;  2DVJ A;  2O2O A;  1ZUK A;  1NLP C;  2ESW A;  1KJW A;  1AZE A;  4ZNX A;  1YWP A;  2V1R A;  1ZX6 A;  2HBW A;  2LJ1 A;  1TUD A;  1K4U S;  1WXT A;  1W70 A;  1QWF A;  1UE9 A;  2SEM A;  4J9I A;  4OMN A;  5IHK A;  1UFF A;  4LE9 A;  1T3S A;  2DBK A;  1NM7 A;  1QLY A;  1LCK A;  2RF0 A;  4M4Z A;  1GCQ A;  1XOV A;  4WCI A;  2KYM A;  2KGT A;  4AFU C;  2FRY A;  1CKA A;  2VWF A;  3EGU A;  2NUZ A;  2F2W A;  3VRY A;  1Z9Z A;  1ABQ A;  1Y0M A;  1TUC A;  3PE0 A;  4RTV A;  1YN8 A;  4Z89 A;  1KIK A;  1NYG A;  2HDA A;  2KXD A;  1AWX A;  5EC7 A;  1RUW A;  2DMO A;  3I9Q A;  1H3H A;  1MV3 A;  2FRW A;  2EGE A;  2RNA A;  4ESR A;  1AVZ C;  1N5Z A;  2OJ2 A;  1QKW A;  2D8H A;  2J6F A;  1X2Q A;  5GJV B;  2V1Q A;  1WLP B;  1PKS A;  2J05 A;  2RQT A;  2A37 A;  1M27 C;  1M3A A;  1UHF A;  4J9E A;  1GCQ C;  2KR3 A;  1OPL A;  3NMZ C;  3VS2 A;  1KFZ A;  1BK2 A;  1JXM A;  4JJB A;  3H0H A;  3SHW A;  3ZL7 C;  1SPK A;  1WXB A;  5FWC A;  4Z88 A;  3TSZ A;  2DLP A;  2D8J A;  1RLQ C;  2ECZ A;  2H8H A;  2QDL A;  2YT6 A;  2J7I A;  2GBQ A;  2OI3 A;  1SRM A;  3RBB B;  1ARK A;  2DA9 A;  2D0N A;  2EYX A;  2AK5 A;  2P4R A;  5IXF A;  1SHG A;  1MUZ A;  4RTX A;  4J9G A;  2K6D A;  4RTW A;  1SRL A;  2EPD A;  3A98 A;  1RI9 A;  2SRC A;  4JJD A;  4GBQ A;  1GBR A;  2KRO A;  2KE9 A;  4ORZ A;  5FW9 A;  4F14 A;  3VS0 A;  2L3Q A;  1E6G A;  1CSK A;  1TG0 A;  1T0H A;  1U3O A;  4DEY A;  1H8K A;  2VVK A;  4KRT A;  2EQI A;  3EHR A;  3I35 A;  1BB9 A;  2GTO A;  3VS6 A;  3U23 A;  1I1J A;  2EW3 A;  3REA B;  2DJQ A;  2DL5 A;  2GTJ A;  1UHC A;  4OMP A;  2JW4 A;  1GFC A;  1NEB A;  2EGC A;  2CH4 A;  1QCF A;  2LMJ A;  2JMC A;  3SEM A;  1WDX A;  2FPF A;  4CC3 A;  3VRZ A;  1K0X A;  4HXJ A;  2F2V A;  1AWO A;  2J6K A;  2KYB A;  2LP5 A;  2RQR A;  1YCS B;  3M0R A;  4F16 A;  1QWE A;  2JM8 A;  4GLM A;  3GBQ A;  2KNB B;  2YSQ A;  2CUD A;  3LH5 A;  1AWW A;  2C0I A;  2EYW A;  2DRK A;  2RPN A;  1JXO A;  1PHT A;  1PKT A;  2ENM A;  2G6F X;  2YDL A;  2DX1 A;  1FMK A;  1UUE A;  1ZLM A;  1AOJ A;  2CRE A;  2CT4 A;  1NEG A;  1NYF A;  3QWY A;  2KT8 A;  1Y57 A;  1ABO A;  2JM9 A;  1X69 A;  4RUG A;  1AZG B;  1OOT A;  2KT1 A;  4HVU A;  4AG2 C;  2J6O A;  2GGR A;  3NHN A;  4QT7 A;  2YUN A;  2B86 A;  4HVW A;  3IQL A;  3RNJ A;  2A36 A;  4X1V A;  2LJ3 A;  2L3S A;  4LN2 A;  4E6R A;  2K7A A;  2W10 A;  4RTU A;  1MV0 B;  4JPB W;  3H0F A;  1EFN A;  1E6H A;  1GBQ A;  2KRS A;  4AFS C;  2FPD A;  1WFW A;  4OMQ A;  4LUD A;  3UA6 A;  2CDT A;  4RTZ A;  3VS1 A;  2KXC A;  2LNH B;  3EG3 A;  1V1C A;  4D8D A;  3I5S A;  2LZ6 B;  2IIM A;  1ZUY A;  1UG1 A;  3M0Q A;  2J06 A;  1WXU A;  5IHN A;  2O9V A;  1GL5 A;  2DYB A;  3H41 A;  2I0N A;  2HSP A;  3I5R A;  3M0P A;  3NPF A;  1W1F A;  2JS2 A;  4EIK A;  3VS3 A;  2AZS A;  2DRM A;  4K11 A;  1UEC A;  1X43 A;  2LQW A;  1I0C A;  1X27 A;  3VS7 A;  1K0S A;  1Z9Q A;  2ROL A;  5FWB A;  2A08 A;  1SSH A;  4R0K A;  2AKL A;  5GJW B;  1VYV A;  1JQQ A;  2O88 A;  4JZ3 A;  2KBT A;  2EGA A;  3H0I A;  4CC7 A;  2ED1 A;  3UA7 A;  1E7O A;  1QKX A;  1PRM C;  2RQV A;  5IXB A;  1U06 A;  1AD5 A;  2FEI A;  4J9F A;  2DNU A;  1FYN A;  5IHI A;  1VYT A;  3R6N A;  1S1N A;  2LCS A;  2M0Y A;  2ED0 A;  2MCN A;  2LJ0 A;  2DL8 A;  2YUO A;  2PZ1 A;  1PWT A;  4HCK A;  3TSW A;  2LQN A;  1K76 A;  2CSI A;  1WIE A;  2FG0 A;  3FJ5 A;  3M0U A;  4J9B A;  3PVL A;  1OPK A;  1OEB A;  2GQI A;  2ROT A;  1PRL C;  5I22 A;  5IH2 A;  1HD3 A;  1ZSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...