2RF0A

Crystal structure of human mixed lineage kinase map3k10 sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
b'AGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFPSNYVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 10
molecule tags Transferase
source organism Homo sapiens
publication title The crystal structure of human Mixed lineage kinase MAP3K10 SH3 domain.
rcsb
total genus 12
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rf0A00
2BZ8A 4OMNA 2D8JA 1SSHA 2EW3A 2DRKA 2J6FA 2SEMA 2LP5A 1TUDA 4LUDA 1RUWA 1AD5A 1YP5A 2LNHB 2LZ6B 2ED0A 4F17A 4HXJA 2VWFA 2EGEA 2EQIA 1QKWA 2DE0X 2BZYA 3EG0A 1SHGA 1VYTA 2GNCA 2L3PA 2RQWA 2AKLA 2DL7A 4J9DA 1W6XA 2B86A 4X1VA 4J9HA 2DL5A 2ROTA 3VS6A 4RUGA 3EG3A 1AVZC 1U06A 1U5SA 1PNJA 1Z9QA 2KE9A 4RTWA 1PRLC 1X2KA 1XOVA 1UE9A 3A98A 1TUCA 5IXFA 2OJ2A 3VRYA 2QDLA 4OMMA 2YUOA 1OPKA 1SRMA 1UGVA 3CQTA 1AWJA 2K2MA 3PVQA 1GCQA 1WXBA 4J9FA 1KSWA 2DRMA 1VA7A 2JTEA 4JPBW 2CDTA 1GFDA 2V1RA 2ED1A 2KXCA 1S1NA 5L23A 1BBZA 3TVTA 2GTOA 1ZUKA 3M0QA 4F16A 3UA7A 1GCPA 1W70A 1UHCA 2AKKA 3GBQA 1CSKA 1E6HA 1GBQA 3EHRA 4Z89A 4FSSA 2NUZA 1ABOA 3M0SA 4Y92A 5FW9A 2O9VA 2VKNA 2F2VA 4WCIA 4LUEA 2KGTA 1KJWA 1YWOA 3JV3A 4E6RA 1OV3A 2CSQA 3LH5A 2KEAA 2AZVA 2FPDA 2I0NA 4HVVA 2KYBA 2EKHA 2KR3A 4M4ZA 3M0UA 1GBRA 1LCKA 2HSPA 5IH2A 2PNIA 2EGCA 2HEQA 2KT8A 2KT1A 2F2WA 1NYGA 1GL5A 1GFCA 3U23A 2RQTA 2EYWA 2E5KA 1GRIA 1UG1A 2LCSA 1FYNA 2RPNA 2GQIA 4CC2A 3VS4A 1WYXA 4AG1C 2K7AA 2AZSA 3SEMA 3I5RA 1AZGB 3C0CA 1T0HA 1YNZA 2EVRA 2FPFA 4JJCA 2EYYA 4AFZC 1AEYA 2DJQA 2NWMA 2CH4A 2DA9A 2KXDA 2EGAA 1PKSA 3QWXX 4AG2C 2LJ0A 1UDLA 1UUEA 2G6FX 2CH4W 3SHWA 1X43A 5ECAA 2FG0A 3EG2A 2YUNA 1PWTA 4HVWA 1AWWA 4OMLA 1U3OA 1WIEA 4ZNXA 4AFUC 3FJ5A 2CREA 3H0FA 2DYBA 2K9GA 1YN8A 2DBMA 2KROA 4GLMA 2K6DA 1H92A 2EYZA 4JJDA 2FEIA 1N5ZA 1NLPC 1ABQA 1T3SA 1IO6A 1B3QA 2FRWA 4OMOA 2L2PA 2FRYA 3VS0A 4J9BA 5IXBA 3EG1A 5FWBA 3M0PA 1QWEA 4RTUA 3R6NA 2RF0A 2YT6A 2KBTA 4K11A 3H41A 3NHNA 1YWPA 4IIOA 3I9QA 1MUZA 4A63B 2LJ1A 1KIKA 1ZX6A 2A08A 2J05A 1WXTA 1X6BA 1QWFA 2KRMA 1MV0B 3REBB 1OPLA 3EHQA 3VS1A 1NM7A 4HCKA 3UF4A 1SHFA 1AWOA 2ABLA 1WXUA 4AFSC 2J7IA 4OMQA 2ROLA 3NPFA 1B07A 1JXMA 2DNUA 2HDAA 2YDLA 1M30A 1RI9A 2EPDA 3VS5A 1M3BA 1CKAA 1HSQA 3VS7A 3PE0A 2OI3A 1NYFA 1NEBA 5IHIA 1NG2A 1UECA 1RLPC 3H0IA 2C0OA 4KRTA 1PHTA 1T0JA 1X27A 2X3XD 2DVJA 2DL4A 3O5ZA 5IHNA 2O9SA 3TSZA 2JS2A 2H8HA 2DX1A 3RNJA 2PTKA 1AWXA 2PZ1A 1K76A 2JW4A 4RTXA 2GGRA 1EFNA 1TG0A 4D8DA 2DILA 4CC3A 1UJ0A 1A0NB 3UA6A 2DL3A 4DEYA 4LE9A 4LN2A 1KFZA 2K79A 2W0ZA 2W10A 2IIMA 3ZL7C 3IQLA 1W1FA 1VYUA 2F2XA 5IHKA 1SPKA 2V1QA 4F14A 2SRCA 4Z8AA 1SRLA 2JXBA 4IIMA 2RQUA 2M51A 3VRZA 2K3BA 1PKTA 1UFFA 1V1CA 2LQWA 1G83A 2YUQA 3UATA 2DBKA 4J9GA 3THKA 1Z9ZA 2J6KA 4RTVA 2M0YA 1OEBA 3I35A 1ZSGA 2XMFA 2ESWA 2JS0A 2X3WD 1JQQA 2C0TA 4J9IA 5I11A 2D8HA 2L3SA 1AZEA 1WDXA 2O31A 1PRMC 1WLPB 1Y0MA 2CT4A 2DLPA 4CC4B 2O88A 3VS3A 1AOJA 3VS2A 4RTYA 4JJBA 2HCKA 1SEMA 4JZ4A 1K1ZA 1ZLMA 1E7OA 4HVUA 1NEGA 2LMJA 2ECZA 3KFVA 1J3TA 2LJ3A 1WFWA 3QWYA 1ZBJA 2AK5A 5GJVB 1UTIA 1WA7A 1VYVA 1X6GA 1OOTA 2KNBB 1I1JA 1CKBA 1M8MA 2A37A 1FMKA 2HBWA 1X69A 3NGPA 5I22A 1M27C 1NLOC 4QT7A 1JO8A 1YCSB 2JMCA 2CSIA 4J9EA 2GBQA 1X2QA 2LX7A 2J06A 1H8KA 4DEXA 2A36A 1RLQC 2FPEA 3H0HA 1JEGA 3M0TA 1UHFA 1BU1A 2LQNA 5HCKA 2BTTA 2CUBA 2JM9A 2BZXA 2GTJA 4GBQA 4OMPA 1ZUUA 1QCFA 1H3HA 2JT4A 4R0KA 2D1XA 3NMZC 2MIOA 2RNAA 4EIKA 1G2BA 1BB9A 1M3CA 2OAWA 4JZ3A 2CUDA 5FWCA 3PVLA 2KRSA 1K4US 2RQRA 1Y57A 2D0NA 2VVKA 2KYMA 1JU5C 2MCNA 3EGUA 1I0CA 1K0SA 1M3AA 1QKXA 2RMOA 2FO0A 4Z88A 3RBBB 1I07A 2DMOA 1JXOA 4J9CA 4ESRA 3TSWA 1K0XA 4LNPA 2KRNA 3M0RA 2YUPA 4D8KA 1HJDA 2O2OA 1MV3A 3I5SA 1ARKA 1ZUYA 2L0AA 2MOXA 2CT3A 1WX6A 2EBPA 2J6OA 3REAB 2DF6A 2DL8A 2C0IA 4CC7A 2L3QA 5GJWB 2YSQA 1QLYA 1WI7A 2RQVA 4RTTA 1E6GA 2RN8A 3ULRB 2JMAA 4AFQC 2EYXA 2JM8A 2DM1A 4ORZA 1K9AA 1T3LA 4RTZA 1UJYA 2P4RA 2ENMA 1BK2A 2A28A 5EC7A 1HD3A 1GCQC
chains in the Genus database with same CATH superfamily
5FLXE 3OSVA 1EIFA 2D8JA 2EW3A 4HT9A 1M8VA 3EFRA 1BI1A 4PJOE 5KYUA 5GAMd 4LUDA 1RUWA 1AD5A 2LZ6B 2ED0A 3CD6Q 1ACMB 2VWFA 2HQEA 3EG9A 1U1TA 3PMTA 3EG0A 3EFOB 2XDDA 5KYYB 2RQWA 1YITA 4BE1A 2NLUA 1Q82C 1W6XA 3LH0A 5IN1A 4BDYA 3I56T 1YHQQ 1XNIA 3OBYA 2KE9A 1Z9QA 3LGLA 3QDFA 3V7CA 3RMQA 1YJ9Q 1X2KA 1UE9A 1YCYA 4E7KA 3JCMh 3A98A 4E7LA 4OMMA 2ZPHB 2BKDN 2H3EB 4F7UF 5EG2A 3PIOA 2FB7A 3CQTA 2CZ1B 2E1HA 3C95A 4EMKA 1QP2A 1GCQA 1WXBA 2DERA 3CPWA 4R56A 1VA7A 2CDTA 3A1PA 3OYFA 2V1RA 5HY6A 3SDZA 4A54A 4QKUA 2XIDA 3JRZA 3CCMQ 3TVTA 2LDMA 2GTOA 4F16A 4OB1B 1XQHA 1JJ2S 1GCPA 1UHCA 2AKKA 3GBQA 1KD1C 4E47A 1VQ6T 2O9VA 4M77A 2VKNA 8AT1B 2F2VA 1C1AA 3GLXA 1Q81U 4WCIA 2K5LA 2DTHA 3FDRA 4E6RA 1KHIA 3QKJA 2CSQA 4M77G 2AZVA 2CGHA 4HVVA 4M75A 4JRQA 2EKHA 3CCEQ 1Q86U 2NUTA 3M0UA 1LCKA 3HRSA 1QVFA 4HCCA 1K9MU 4M7DG 2EGCA 3OYMA 5GAOr 2YXYA 2Y4XA 3OYJA 1NYGA 3U23A 5CVIA 5LJ3d 2JVVA 3MEAA 1QP3A 4FT2A 5FU7B 1X01A 4C8QA 1WYXA 2LQ8A 3P8HA 4PJJA 4Y28E 1AZGB 2D9TA 1I5LA 3I55T 5CKFA 4JJCA 2EYYA 2DJQA 3CC2Q 2NWMA 1RADB 2CH4A 1N27A 2EGAA 3QWXX 4AG2C 1VQ6A 2EQUA 2VXEA 2G6FX 4XU3A 3G6EA 2QEXQ 4PKCC 4MMLA 2OTJT 1Y96A 3J7AF 3ER0A 3ZEHA 1WIEA 4RMOA 1WHKA 4BI3A 2DXBA 1KD1U 3H0FA 2B8AA 2PVOB 3CXCA 2DYBA 2K9GA 4LDVA 1D0XA 5KYYA 1K8AC 1N6AA 1VQMA 4JJDA 3TCJA 1D3BA 1JJ2A 3EGDB 4GY5A 3HRUA 1PSFA 5C0MA 4ZN3A 3TEEA 2LX9A 3E1SA 2RHZA 4FCYA 1NBEB 5LJ3j 2H3JA 3C12A 4IUQA 4RTUA 4J6XA 3R6NA 2RF0A 5CQXA 2YT6A 4DOWA 1KHCA 4K11A 4XTZA 4IIOA 2LJ1A 4BE2A 2A08A 2J05A 1JJ2P 3REBB 1QWFA 4J83A 1OPLA 3EHQA 1NM7A 5GAOn 3CCVT 4XTXA 4M78C 5A0DA 2ABLA 4OMQA 1M90R 3NPFA 4PJNA 4DBHA 1B07A 5D7UA 4ZGJB 1JXMA 1G3YA 1RAAB 5LL6S 1D1CA 1F1BB 3KBGA 3G71Q 2QQ9A 3VS5A 1N9SA 1QMCA 3M4GA 3FRNA 2GFUA 3VUZA 5IHIA 1NE8A 3KXTA 1RLPC 2ZPGB 2C0OA 1HK9A 2L8DA 3F70A 1X27A 1PHTA 1WHGA 1VUBA 2DVJA 2DL4A 2LTOA 3EGDA 3O5ZA 4Y91A 8ATCB 2C06A 2E65A 4KBMB 1Q82U 2H8HA 3CC7Q 3M53A 4FYXB 4B6MA 2MWPA 2MYSA 3QG1A 1YJ9A 2PZ1A 2JZ2A 1EFNA 1TG0A 2V26A 4XTVA 4D8DA 1MHNA 3ZFJA 3OS5A 1Q7YR 1Q82R 5GAOq 4BI8B 2EKOA 3TREA 2ZPEB 4PJOC 5GAOm 1KFZA 2W0ZA 1KQ2A 1NPPA 1IZ6A 3OS0A 1W1FA 3VYHB 1PD0A 3OY9A 3BDUA 4EMHA 4UC4A 1OI1A 4IIMA 2BE7D 3AT1B 3E9FA 2RQUA 4DBRA 1UFFA 2LQWA 2M16A 2YUQA 3UWNA 1IHVA 3VJPA 5HKCA 2XKOC 2J6KA 4DOVA 2QTVA 5KE2A 4ZN1A 3OQ5A 2DK3A 5KCHA 1G3TA 2XMFA 3JCMf 1JQQA 2C0TA 2Z0WA 4E7IA 2D8HA 1UGQB 1WDXA 3JB9G 2DLPA 3V7SA 4PJOG 3DLMA 2HCKA 1K73U 2DPPB 4JZ4A 1E7OA 2K3XA 2LT1A 2JOYA 3KFVA 2LJ3A 1WFWA 3QWYA 3AHUA 2OTJQ 1ZBJA 5GJVB 2RHYA 4PJOB 1OOTA 2KNBB 1I1JA 4PJLA 2K2VA 2PU9B 1JB0E 1X69A 1YBYA 3NGPA 1M27C 2FVUA 5D6WA 4ZTJA 2WSEE 5GAMg 4J9EA 1OZ3A 3CCJQ 2J06A 1VQ5Q 3JAME 1H8KA 3ASKA 4E7JA 3H0HA 3VYGA 1UHFA 5HCKA 1D3BB 2JJ9A 3LGFA 2JM9A 4XTYA 4NL3A 1Q7YC 2BZXA 4OVAA 5CK9A 1M1KC 2HD0A 2HQXA 1PSEA 4BI4A 1XTDA 1M2VB 3OMGA 1TH7A 2GCXA 1ZSZC 4EIKA 1G2BA 2OAWA 1NJIR 1VQMQ 3PVLA 2KRSA 1VQ9T 3CEYA 1Y57A 4YTLA 2VVKA 1I0CA 1K0SA 1M3AA 3QDRB 1QKXA 2RMOA 3EFOA 1I07A 2DMOA 3RDVA 5GAMh 1JXOA 4M77D 4C92A 1K0XA 4LNPA 4M7DE 3M0RA 3VUBA 4OP0A 2KMTA 1YJWQ 3CCMT 3E2UA 4D8KA 1W2BA 1ZUYA 2BIVA 2QXFA 3INZA 1OYXA 3OBWA 2CT3A 2EBPA 2J6OA 2F5TX 4M7AD 2C0IA 1YIJQ 3PMIA 3CCUA 2YSQA 2RH2A 1WI7A 4RTTA 1MMAA 4KT0E 4JS4A 3V7RA 1VQ8A 4C92C 5GANf 1KC8U 2P4RA 1VQKT 3RKWA 2CZ0B 2ENMA 1BK2A 3MKDA 3X26B 2DETA 2ZPIB 3FJPA 5DLQE 1GCQC 3HFNA 1IREB 4OMNA 3RKYA 2LP5A 5KYXA 3JCMW 1TUDA 2FZCB 3CMAA 1BI0A 4F17A 1SF9A 2VGNA 2EGEA 2EQIA 2BZYA 2DO3A 1VYTA 2L3PA 2EJGA 2VYTA 1B34B 3PNWC 5GMKi 4TVRA 3RR6A 4RUGA 3TQ7P 4KH0B 1U5SA 2DVEA 4FU6A 1PRLC 3NTHA 3A5ZB 1XOVA 3JB9D 1VQKQ 2OTLA 2VB6A 2M1HA 1TUCA 5IXFA 3VRYA 2QDLA 2M9UA 1PD1A 1SRMA 1B34A 2P4TA 3RMSA 1Q81R 2QQAA 4C8QB 5CIUA 1M2VA 2K2MA 1VQOT 4J9FA 1KSWA 1QCNA 1D09B 5GAN6 1GFDA 2XK0A 1QVPA 2KXCA 1S1NA 4IUUA 4AT1B 1ZUKA 3UA7A 1CSKA 1E6HA 2F69A 1C0MA 2QQRA 1ABOA 5FW9A 1ZA1B 1NZ9A 3CBMA 1OX9A 3EFSA 3I56Q 3SWNA 4LUEA 5LJ5d 1KJWA 3S3NA 3JV3A 3L2ZA 2FPDA 4ME7A 3G6ET 1VQ9Q 2KR3A 1VQMT 3J81E 2EJFA 1S72A 3CBOA 2PNIA 3SWNB 2HEQA 5HK0A 3JCMV 4C92F 4LDXA 1TS9A 1KC8R 2F2WA 4MDXA 2RQTA 2EYWA 1UG1A 3SWNC 1FYNA 2RJDA 5I21A 3CCJA 3MP8A 4ZGEB 5GANg 2AZSA 3CPWS 1YITQ 2MMPA 3C0CA 3CCQQ 4E2FB 2F5KA 3OYBA 1VQ4Q 1AEYA 1VQ5T 1YHQA 5D6XA 4C0DB 2X4WA 1UGPB 2KXDA 1PKSA 1UDLA 1D0YA 2X51A 2HMAA 4OGEA 4C8QE 2X9HA 1WJSA 4C8QF 5LJ3f 3V8LA 1IB8A 1W2BP 2X35A 4LDWA 3OS1A 3L2WA 4HVWA 1YI2A 5CKDA 1U3OA 4AFUC 4A53A 2AHJB 3CCMA 4J6YA 2EIFA 2EYZA 1H92A 3C94A 4NS5A 3JCMQ 2DZCA 1WHLA 1LNXA 1YJWA 4X9DA 4E7ZA 1N5ZA 1NLPC 3N5BB 4C0FA 4M77E 3VS0A 1VQPA 3EG1A 3NFCA 2R58A 4C92E 4KH1B 4M78A 1QVFP 4OGCA 3NHNA 2DYIA 1MUZA 3GNGA 4HKEA 4A63B 3EH1A 3A8LB 3T9NA 1ZX6A 2MPXC 2KRMA 2YRDA 1K8AR 1VQ8Q 3OYIA 2LRQA 4QW2A 3VS1A 1VQ7A 3EH2A 4HCKA 2XDBA 3M55A 1SHFA 1AWOA 4AFSC 1WXUA 2J7IA 1N8RR 4FYVB 2RA2A 2CP6A 3MJXA 2DNUA 2HDAA 2YDLA 4MZPA 3CCJT 2HL3A 1RI9A 3CMAQ 4JUVA 3OYEA 4M78B 1HSQA 4JRKA 4XTUA 3LWIA 2OI3A 3H6ZA 1NG2A 3CC2A 3A8GB 1UECA 2XU8A 5M9OA 4KRTA 2QYZA 1T0JA 2X3XD 3V8JA 4PJOD 4O6JA 2YRVA 1M1GA 2JS2A 2V8JA 3CC7T 4MDWA 1XJWB 2QI2A 3JCMc 2CYZB 3JSCA 1WQWA 4PJOF 4JRIA 1Y71A 5J26A 3D7SB 1OULA 2JW4A 5CO7A 2OTLQ 2QEXA 1RAEB 1MNEA 1G3SA 3QYGB 2DXUA 2DFUA 2P0KA 3MHXA 4DEYA 4V2SA 5KYXB 1IGUA 2BE9B 4LN2A 3FLGA 4M7AB 3CCSQ 1MMDA 1VYUA 2F2XA 4N0AA 2RI5A 3BDLA 4J7IA 1SPKA 4O5VA 4Z8AA 1SRLA 2JXBA 1VQPT 4FT4A 2QTXA 1RABB 4HCZA 2PQWA 2X4YA 2MF2A 3WXMB 1V1CA 1G83A 2DBKA 4BB7A 3THKA 4FSXA 3H8ZA 3JCMJ 5LJ5j 3JCMX 1ZSGA 4Z02A 2ESWA 1UEBA 3P8DA 1KD1R 3CCLT 4A4GA 4KGZB 1K9MC 1PRMC 1Y0MA 1JRIA 2YRCA 1S72Q 1K9MR 1AOJA 2YHTA 4MZTA 4D6WA 4A4KA 2VC8A 2MWOA 2DTOA 1ZLMA 3R6OA 4PFZA 2ZAEA 2E6NA 2Y4YA 2AK5A 1U8RA 3X25B 1WA7A 2WSFE 1CKBA 1M8MA 2A37A 4IKFA 3CCQA 4MZMA 2JMCA 3QZ9B 3CMAT 1NJIC 1LVKA 2L89A 4N4IA 3X24B 2FPEA 3OYHA 1JEGA 3FC3A 1LOJA 1M4ZA 2BTTA 2CUBA 3FEOA 4FL6A 3OYKA 1WQ7A 1RL2A 3PTAA 1YITT 1VQ8T 4GBQA 2EQMA 2RI2A 3L2VA 4QQ6A 3QJ6A 3DB4A 1YI2Q 1H3HA 3RERA 3MEUA 3MO8A 4RG8A 3E9GA 4R0KA 4FW2A 3NMZC 2MIOA 2EAYA 1U1SA 5GAN5 4PNOA 1M3CA 4R55A 4JZ3A 4KGXB 1M90C 5A2QE 3FIFA 2D0NA 1JU5C 2P0QA 4M7DD 2E41A 3MP6A 2LT4A 5KE3A 3LLRA 4LDYA 3LWHA 3L2UA 4ESRA 1OU8A 3TSWA 3JB9H 2VV5A 3QUIA 2YUPA 3MCAB 1SKUB 5CKHA 3EG9B 2RB6A 1D1AA 3VKIA 1KQSP 2NUTB 1VQ7Q 2L0AA 2EQKA 4FYWB 1WX6A 4M78E 5I2SA 3OA6A 2A0FB 1I8FA 2OTJA 4II1A 2DF6A 5LJ3e 3M58A 3OYAA 2P0PA 3JCMg 1N9RA 1QLYA 1E6GA 2HQHA 1LJOA 1ZBXA 3M5AA 3URGA 1VQLA 4ORZA 3OYCA 4RTZA 4QVCA 3JB9J 2FYKA 1ZSZB 2DAQA 4BDZA 1QVGA 1RI0A 2DRKA 2SEMA 2COWA 3HKSA 4L5GA 4C92B 4C5EA 1WNLA 1SG5A 5IT9E 1M2OA 1QKWA 2DE0X 1SHGA 5GMKe 4M75D 2QA4T 3QJYA 3WVEB 4X34A 3CD6T 3MEVA 1X6OA 1DJ7B 4A4FA 1QVGP 4J9HA 2DL5A 2QDYB 3G4SA 3VS6A 1M5Q1 2I2LA 3CCSA 3EG3A 1AVZC 1U06A 3CCRQ 3A8MB 2L5QA 1PNJA 2R57A 5KYNA 3HTRA 2RJEA 3OMCA 2OJ2A 5FU7C 1OPKA 2CZ6B 4N4GA 4PLLA 4CI0C 1YIJT 1AWJA 2PUKB 2K5IA 1FMWA 3PVQA 3LW5E 4XK8E 2JTEA 2AT1B 1QW1A 1VQOQ 4N0AC 3CCVA 4OB0B 2DJZA 2COYA 5L23A 1BBZA 2MAMA 1FMVA 3UDCA 1W70A 2M0OA 1I4K1 4Z89A 3QO3A 3GPLA 2NUZA 2R5MA 4IUVA 1QVFS 4Y92A 1YIJA 1YJ9T 3CCLA 3CCRT 2NUPB 2ATCB 2QAZA 3Q1JA 1YWOA 2F1LA 2K57A 3GNFB 3JCMP 3L2RA 4M75B 1OV3A 3LH5A 2KEAA 2LNVA 4JRPA 2I0NA 2HAXA 2KYBA 4M4ZA 3HSBA 2MK5A 5IH2A 2KT8A 5CQYA 4M75C 1LPLA 1GL5A 1GRIA 1HXDA 1EZZB 1OX8A 1FWZA 5GAOp 2GQIA 4CC2A 3VS4A 2K7AA 3I5RA 5LJ5f 3EGXB 2DD5A 1K8AU 1T0HA 1YNZA 4AFZC 3CMEQ 1IRXA 3P8BB 3SFMA 4FYYB 2CZ7B 3LX7A 2E70A 2PUOB 4RG2A 5GAMf 2CH4W 3OB9A 3EGXA 1X43A 5ECAA 2QASA 2FG0A 4JJNK 1I5OB 2O4XB 4JDSA 1D0ZA 2YWWA 4XU2A 4KUIA 4BY6C 1VQNA 1AWWA 3GF5A 4PL6A 1BYMA 3JCMd 1YN8A 2ZGWA 2KROA 5A0LA 4GLMA 3META 4BACA 1BI2A 1RAIB 3DB3A 2E64A 1VIFA 2RHUA 4NOYA 2FEIA 2G3RA 4X9CA 2VUBA 2QGFB 3M57A 4A4HA 4EMKC 1B3QA 2FRWA 2KK4A 4M78G 2MI6A 2FRYA 3I56A 5IXBA 5GANh 3L1AA 2YLBA 2Y90A 1AHJB 4WTOB 4JLIA 1VIEA 4XU1A 1YWPA 3SB2A 2HZYA 2RHXA 3I9QA 4IURA 3QZ5B 2D6FA 1R0CB 1WXTA 1X6BA 1VQLQ 3BE3A 3BY7A 4L59A 2KI7A 4BUGA 2XI9A 3UF4A 4L6V5 1Q81C 1UB4A 3L2QA 3H9NA 2EFIA 2XG8D 2DKGA 3GOXA 5C6SA 1BIAA 3MP1A 2EPDA 4BY6B 5GMKl 1M3BA 1CKAA 1SSFA 4J7FA 3PE0A 1VQ4A 5FRMA 4P5NA 5KYWA 4OB2B 3OYGA 4KULA 4E7SA 3G4SQ 3G4ST 2DX1A 4ELZC 1QVGS 1BKBA 5L8RE 3OS2A 1X75C 2GGRA 5J3BA 3S3MA 2DILA 4CC3A 2RK1A 3UA6A 2DL3A 4C0ZA 4LE9A 2K79A 2W10A 2IIMA 4EPCA 1TTHB 1KC8C 3JB9F 3IQLA 3OYLA 2ZZDA 1VQOA 3CBPA 3CCVQ 1TU0B 3OSSC 4CRIA 4F14A 3BW1A 2XDPA 5FRNA 1VQPQ 4C8QC 2K3BA 4OF1A 1TXQA 4RTVA 4DQ2A 2CP2A 4EDUA 2JS0A 3PFSA 5GAOl 4M7DB 2RM4A 5I11A 2O31A 3HPWA 1FXXA 2CT4A 1Q86C 1YJNQ 1Y07A 4C0DC 4M7DA 2NYSA 3QSUA 1H641 4JJBA 1K1ZA 4PFPA 4HVUA 1NEGA 2ECZA 1QQJA 2HNIA 2EWNA 1QCOA 3RKXA 4M75G 1X6GA 3CXCP 1ZSZA 2HBWA 2ZPBB 1NJIU 3M59A 5LJ3g 3CMEA 1G8XA 4QT7A 1YCSB 2GBQA 5CKEA 3S6WA 2RK2A 1JBMA 2LX7A 2HKQB 4LD6A 4DEXA 2A36A 1RLQC 3I55Q 3TU4K 3RUXA 2QK0A 3CD6A 4EMKB 4F7UG 1VQLT 2GTJA 4F7UB 1VQNQ 4C8QD 4ZGDB 4WF2A 2KAFA 1M1KU 3CPWP 2RNAA 4QQDA 1G5VA 2LCLA 1Q7YU 1BB9A 2GFAA 1D1BA 5FWCA 1N8RC 3CCET 2RQRA 1BIBA 2K4YA 1H3ZA 2HKNA 2QGGA 3EGUA 4N4HA 4B9XA 2FO0A 3RBBB 3DLLA 4FM4B 5LJ5e 1ZHIA 2M02A 5KYUB 5GAN8 3NTKA 2KRNA 5GANj 2QEXT 4XU0A 4C92D 3M9QA 1HJDA 2CP3A 2O2OA 5CR2A 1MV3A 3I5SA 3V8KA 1ARKA 4XTWA 1BCMA 4AMCA 3M54A 3REAB 5GAMe 1M90U 2DXTA 1V76A 2RHIA 4XQ3A 2DL8A 1O75A 2R5AA 4CC7A 3JB9I 4FIBA 3JCMb 2RQVA 1WGSA 3CC2T 3CMET 2RN8A 3ULRB 3UT1A 5GMKm 1VQ4T 4QQGA 4AFQC 3GP8A 2EYXA 2JM8A 1OZ2A 1K9AA 3E19A 1P92A 1UJYA 2E12A 5FROA 2E3HA 2A28A 2BZ8A 4PJMA 1YHQT 4M7AF 1SSHA 3GIBA 2DIGA 1TSFA 2CP7A 2J6FA 1BI3A 1MGQA 1YP5A 2LNHB 4B9WA 2CKKA 4HXJA 3CC4A 1Y96B 2FZGB 1IHWA 3UPUA 3HHTB 2QA4Q 3L42A 2KDSA 2VXFA 2GNCA 3HFOA 4J6WA 2AKLA 2DL7A 4J9DA 3QPHA 2B86A 4X1VA 3NTIA 2ROTA 3ME9A 5DLOA 2WACA 5CKBA 2HBPA 4RTWA 4F7UE 3A8HB 1VQ6Q 2DXCA 2P84A 2VGMA 3QXEB 3C4SA 2XD0A 2YLCA 2YUOA 1UGVA 4M78F 1WHHA 2LVMA 2DRMA 2LC4A 2JNGA 4C5HA 1PC0A 4JPBW 1VQ7T 4M75F 3KUFA 2ED1A 1KQSA 4M7AE 4M78D 2CS7A 3MEWA 1YJWT 3M0QA 1GBQA 3EHRA 2E10A 2EYQA 4FSSA 1YJNA 4DBQA 2O01E 3OW2S 3M0SA 4HCBA 4BE0A 3M56A 4LDUA 3G1JA 4M77B 2KGTA 4RCCA 2E5QA 1K73R 7AT1B 3DKMA 3SD4A 4RKUE 2A7YA 3ZBDA 1GBRA 2HSPA 1RAHB 4EMGA 2DZ9A 1TOVA 4PJOA 2KT1A 1KG1A 4C5GA 1GFCA 2E5KA 1B7TA 2LCSA 1FX7A 2D0QB 1YI2T 4M77F 1RAFB 3G7ZA 2DEQA 2RPNA 3OYYA 4AG1C 4M7AC 3SEMA 3I55A 3G71A 2KY9A 1PM3A 2FHDA 5FU6B 3RESA 4C8QG 2EVRA 2FPFA 5GANd 2WSCE 5AT1B 3CCRA 2DA9A 4M7AG 4DBFA 2JN0A 2JUFA 2LJ0A 4HT8A 2E6ZA 1UUEA 2XICA 3CC7A 2K5FA 5J39A 3SHWA 4M7AA 2LQKA 3EG2A 4VUBA 4F04B 2LCCA 2AIRB 5LJ5h 2YUNA 1PWTA 3PIPA 4ZTFA 4ATOA 4OMLA 5GAN7 4ZNXA 2PVDB 3FJ5A 2CREA 4JLGA 1NPRA 2DBMA 5DY9A 2JTMA 4J5YA 2K6DA 4C92G 1M1KR 3CPFA 1ABQA 4J8OA 3CCLQ 1T3SA 1IO6A 2IG0A 4OMOA 2L2PA 2EJ9A 4J9BA 3HP9A 5FWBA 5IAYA 2IPOB 1QWEA 3M0PA 1I81A 1IGQA 5FU6C 2KBTA 4QVDA 3H41A 1VQNT 1PG5B 1KIKA 1MV0B 5GMKh 5GANe 1Y7XA 4BD3A 3O8VA 2ROLA 3CCST 2RJCA 1RACB 1IXDA 1KK7A 1M30A 5GAMj 4MMKA 1R8OB 3M4YA 3VS7A 3CC4Q 9ATCB 1NYFA 2QA4A 1NEBA 4ANJA 3J80E 2OAUA 4ELYC 1Q86R 2PVGB 1RAGB 1WPYA 2COZA 3H0IA 3CCUT 1UGSB 5IHNA 5GAN2 5GAN3 2O9SA 3TSZA 4DA4A 1MNDA 2E3IA 3VU3C 4M75E 5CCAA 3RNJA 1BCOA 5HK3A 2PTKA 1AWXA 1K76A 4LD9K 4RTXA 3OW2P 2XHCA 1VQ5A 2FZKB 2OX7A 2QQBA 1YJNT 1S72T 3FB9A 3CC4T 1UJ0A 2CP0A 1A0NB 3RIRA 1WJRA 4E7HA 4PK4A 2RO0A 3QBYA 4Q5WA 2ZCFB 4OMFB 1V29B 1WHJA 4KGVB 1MMNA 3ZL7C 2L3RA 3MPUB 5IHKA 4A4EA 2V1QA 2SRCA 2DEUA 1G3WA 3A8OB 2M51A 2KQWA 2E4HA 3VRZA 5KYWB 1PKTA 1R77A 3UATA 4J9GA 1Z9ZA 3HL8A 2M0YA 1OEBA 3BFMA 5I2MA 3QYHB 2FL7A 3I35A 2X3WD 2CP5A 3PGGA 4GLKA 2RJFA 3S3OA 4J9IA 2L3SA 1AZEA 4C5IA 1TWBA 1WLPB 3OW2A 4CC4B 3PT9A 2O88A 3VS3A 3VS2A 5DM7R 4XAXB 4RTYA 2OTLT 3HRTA 2DIQA 1SEMA 4M77C 1OQKA 2QQSA 2LMJA 3QIIA 1J3TA 1EX4A 1C6VX 1UTIA 3X20B 1TUGB 1M9SA 1VYVA 3CCEA 1FMKA 3CCUQ 1UGRB 1WJQA 5I22A 3JCMe 1NLOC 1JO8A 2CSIA 4M7DF 4C0GA 1X2QA 3G71T 1W2BS 2V8KA 4IUPA 2NUPA 6AT1B 2IVWA 4PLIA 4F7UA 2DTIA 4PFOA 3LYIA 2BUDA 3M0TA 4OB3B 1BU1A 2LQNA 2K3YA 1KQSS 2RD1A 2KSSA 3WVDB 2DD4A 2O4XA 2ZPFB 1HYOA 1KQ1A 1YFNA 3QHSA 4OMPA 1ZUUA 5LJ5g 1QCFA 4M7DC 1Q95G 1VOMA 5KCOA 2JT4A 4QVZA 2D1XA 2RI3A 1ZQ1A 1PCXA 2CUDA 2A3LA 5GAN4 3G6EQ 1K4US 2X4JA 1VQKA 5AYFA 1AT1B 3CXCS 1GXIE 1K73C 2KYMA 2MCNA 3VV0A 1M1FA 4JS5A 4Z88A 2JTFA 3EAEA 4HA8A 4J9CA 5CAIA 2QG9B 2V8IA 4NL2A 5LJ3h 4LXCA 5D6YA 2EQJA 1O9SA 1WHMA 1WZOA 4FW1A 4KUDK 2MOXA 1OU9A 2HSEB 1MMGA 1ZA2B 1N8RU 3OYNA 5GMKj 1R0BG 4RCBA 2L3QA 5GJWB 3OYDA 2GQVA 1W4SA 2HL5C 2GF7A 5KH6A 2JMAA 2X4XA 2DM1A 2KVQG 1T3LA 3X28B 3CCQT 1VQ9A 2VASA 5A0GA 5EC7A 1HD3A 4IUTA
chains in the Genus database with same CATH topology
2BZ8A 4OMNA 2D8JA 1SSHA 2EW3A 2DRKA 2J6FA 2SEMA 2LP5A 1TUDA 4LUDA 1RUWA 1AD5A 1YP5A 2LNHB 2LZ6B 2ED0A 4F17A 4HXJA 2VWFA 2EGEA 2EQIA 1QKWA 2DE0X 2BZYA 3EG0A 1SHGA 1VYTA 2GNCA 2L3PA 2RQWA 2AKLA 2DL7A 4J9DA 1W6XA 2B86A 4X1VA 4J9HA 2DL5A 2ROTA 3VS6A 4RUGA 3EG3A 1AVZC 1U06A 1U5SA 1PNJA 1Z9QA 2KE9A 4RTWA 1PRLC 1X2KA 1XOVA 1UE9A 3A98A 1TUCA 5IXFA 2OJ2A 3VRYA 2QDLA 4OMMA 2YUOA 1OPKA 1SRMA 1UGVA 3CQTA 1AWJA 2K2MA 3PVQA 1GCQA 1WXBA 4J9FA 1KSWA 2DRMA 1VA7A 2JTEA 4JPBW 2CDTA 1GFDA 2V1RA 2ED1A 2KXCA 1S1NA 5L23A 1BBZA 3TVTA 2GTOA 1ZUKA 3M0QA 4F16A 3UA7A 1GCPA 1W70A 1UHCA 2AKKA 3GBQA 1CSKA 1E6HA 1GBQA 3EHRA 4Z89A 4FSSA 2NUZA 1ABOA 3M0SA 4Y92A 5FW9A 2O9VA 2VKNA 2F2VA 4WCIA 4LUEA 2KGTA 1KJWA 1YWOA 3JV3A 4E6RA 1OV3A 2CSQA 3LH5A 2KEAA 2AZVA 2FPDA 2I0NA 4HVVA 2KYBA 2EKHA 2KR3A 4M4ZA 3M0UA 1GBRA 1LCKA 2HSPA 5IH2A 2PNIA 2EGCA 2HEQA 2KT8A 2KT1A 2F2WA 1NYGA 1GL5A 1GFCA 3U23A 2RQTA 2EYWA 2E5KA 1GRIA 1UG1A 2LCSA 1FYNA 2RPNA 2GQIA 4CC2A 3VS4A 1WYXA 4AG1C 2K7AA 2AZSA 3SEMA 3I5RA 1AZGB 3C0CA 1T0HA 1YNZA 2EVRA 2FPFA 4JJCA 2EYYA 4AFZC 1AEYA 2DJQA 2NWMA 2CH4A 2DA9A 2KXDA 2EGAA 1PKSA 3QWXX 4AG2C 2LJ0A 1UDLA 1UUEA 2G6FX 2CH4W 3SHWA 1X43A 5ECAA 2FG0A 3EG2A 2YUNA 1PWTA 4HVWA 1AWWA 4OMLA 1U3OA 1WIEA 4ZNXA 4AFUC 3FJ5A 2CREA 3H0FA 2DYBA 2K9GA 1YN8A 2DBMA 2KROA 4GLMA 2K6DA 1H92A 2EYZA 4JJDA 2FEIA 1N5ZA 1NLPC 1ABQA 1T3SA 1IO6A 1B3QA 2FRWA 4OMOA 2L2PA 2FRYA 3VS0A 4J9BA 5IXBA 3EG1A 5FWBA 3M0PA 1QWEA 4RTUA 3R6NA 2RF0A 2YT6A 2KBTA 4K11A 3H41A 3NHNA 1YWPA 4IIOA 3I9QA 1MUZA 4A63B 2LJ1A 1KIKA 1ZX6A 2A08A 2J05A 1WXTA 1X6BA 1QWFA 2KRMA 1MV0B 3REBB 1OPLA 3EHQA 3VS1A 1NM7A 4HCKA 3UF4A 1SHFA 1AWOA 2ABLA 1WXUA 4AFSC 2J7IA 4OMQA 2ROLA 3NPFA 1B07A 1JXMA 2DNUA 2HDAA 2YDLA 1M30A 1RI9A 2EPDA 3VS5A 1M3BA 1CKAA 1HSQA 3VS7A 3PE0A 2OI3A 1NYFA 1NEBA 5IHIA 1NG2A 1UECA 1RLPC 3H0IA 2C0OA 4KRTA 1PHTA 1T0JA 1X27A 2X3XD 2DVJA 2DL4A 3O5ZA 5IHNA 2O9SA 3TSZA 2JS2A 2H8HA 2DX1A 3RNJA 2PTKA 1AWXA 2PZ1A 1K76A 2JW4A 4RTXA 2GGRA 1EFNA 1TG0A 4D8DA 2DILA 4CC3A 1UJ0A 1A0NB 3UA6A 2DL3A 4DEYA 4LE9A 4LN2A 1KFZA 2K79A 2W0ZA 2W10A 2IIMA 3ZL7C 3IQLA 1W1FA 1VYUA 2F2XA 5IHKA 1SPKA 2V1QA 4F14A 2SRCA 4Z8AA 1SRLA 2JXBA 4IIMA 2RQUA 2M51A 3VRZA 2K3BA 1PKTA 1UFFA 1V1CA 2LQWA 1G83A 2YUQA 3UATA 2DBKA 4J9GA 3THKA 1Z9ZA 2J6KA 4RTVA 2M0YA 1OEBA 3I35A 1ZSGA 2XMFA 2ESWA 2JS0A 2X3WD 1JQQA 2C0TA 4J9IA 5I11A 2D8HA 2L3SA 1AZEA 1WDXA 2O31A 1PRMC 1WLPB 1Y0MA 2CT4A 2DLPA 4CC4B 2O88A 3VS3A 1AOJA 3VS2A 4RTYA 4JJBA 2HCKA 1SEMA 4JZ4A 1K1ZA 1ZLMA 1E7OA 4HVUA 1NEGA 2LMJA 2ECZA 3KFVA 1J3TA 2LJ3A 1WFWA 3QWYA 1ZBJA 2AK5A 5GJVB 1UTIA 1WA7A 1VYVA 1X6GA 1OOTA 2KNBB 1I1JA 1CKBA 1M8MA 2A37A 1FMKA 2HBWA 1X69A 3NGPA 5I22A 1M27C 1NLOC 4QT7A 1JO8A 1YCSB 2JMCA 2CSIA 4J9EA 2GBQA 1X2QA 2LX7A 2J06A 1H8KA 4DEXA 2A36A 1RLQC 2FPEA 3H0HA 1JEGA 3M0TA 1UHFA 1BU1A 2LQNA 5HCKA 2BTTA 2CUBA 2JM9A 2BZXA 2GTJA 4GBQA 4OMPA 1ZUUA 1QCFA 1H3HA 2JT4A 4R0KA 2D1XA 3NMZC 2MIOA 2RNAA 4EIKA 1G2BA 1BB9A 1M3CA 2OAWA 4JZ3A 2CUDA 5FWCA 3PVLA 2KRSA 1K4US 2RQRA 1Y57A 2D0NA 2VVKA 2KYMA 1JU5C 2MCNA 3EGUA 1I0CA 1K0SA 1M3AA 1QKXA 2RMOA 2FO0A 4Z88A 3RBBB 1I07A 2DMOA 1JXOA 4J9CA 4ESRA 3TSWA 1K0XA 4LNPA 2KRNA 3M0RA 2YUPA 4D8KA 1HJDA 2O2OA 1MV3A 3I5SA 1ARKA 1ZUYA 2L0AA 2MOXA 2CT3A 1WX6A 2EBPA 2J6OA 3REAB 2DF6A 2DL8A 2C0IA 4CC7A 2L3QA 5GJWB 2YSQA 1QLYA 1WI7A 2RQVA 4RTTA 1E6GA 2RN8A 3ULRB 2JMAA 4AFQC 2EYXA 2JM8A 2DM1A 4ORZA 1K9AA 1T3LA 4RTZA 1UJYA 2P4RA 2ENMA 1BK2A 2A28A 5EC7A 1HD3A 1GCQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZ8 A;  4OMN A;  2D8J A;  1SSH A;  2EW3 A;  2DRK A;  2J6F A;  2SEM A;  2LP5 A;  1TUD A;  4LUD A;  1RUW A;  1AD5 A;  1YP5 A;  2LNH B;  2LZ6 B;  2ED0 A;  4F17 A;  4HXJ A;  2VWF A;  2EGE A;  2EQI A;  1QKW A;  2DE0 X;  2BZY A;  3EG0 A;  1SHG A;  1VYT A;  2GNC A;  2L3P A;  2RQW A;  2AKL A;  2DL7 A;  4J9D A;  1W6X A;  2B86 A;  4X1V A;  4J9H A;  2DL5 A;  2ROT A;  3VS6 A;  4RUG A;  3EG3 A;  1AVZ C;  1U06 A;  1U5S A;  1PNJ A;  1Z9Q A;  2KE9 A;  4RTW A;  1PRL C;  1X2K A;  1XOV A;  1UE9 A;  3A98 A;  1TUC A;  5IXF A;  2OJ2 A;  3VRY A;  2QDL A;  4OMM A;  2YUO A;  1OPK A;  1SRM A;  1UGV A;  3CQT A;  1AWJ A;  2K2M A;  3PVQ A;  1GCQ A;  1WXB A;  4J9F A;  1KSW A;  2DRM A;  1VA7 A;  2JTE A;  4JPB W;  2CDT A;  1GFD A;  2V1R A;  2ED1 A;  2KXC A;  1S1N A;  5L23 A;  1BBZ A;  3TVT A;  2GTO A;  1ZUK A;  3M0Q A;  4F16 A;  3UA7 A;  1GCP A;  1W70 A;  1UHC A;  2AKK A;  3GBQ A;  1CSK A;  1E6H A;  1GBQ A;  3EHR A;  4Z89 A;  4FSS A;  2NUZ A;  1ABO A;  3M0S A;  4Y92 A;  5FW9 A;  2O9V A;  2VKN A;  2F2V A;  4WCI A;  4LUE A;  2KGT A;  1KJW A;  1YWO A;  3JV3 A;  4E6R A;  1OV3 A;  2CSQ A;  3LH5 A;  2KEA A;  2AZV A;  2FPD A;  2I0N A;  4HVV A;  2KYB A;  2EKH A;  2KR3 A;  4M4Z A;  3M0U A;  1GBR A;  1LCK A;  2HSP A;  5IH2 A;  2PNI A;  2EGC A;  2HEQ A;  2KT8 A;  2KT1 A;  2F2W A;  1NYG A;  1GL5 A;  1GFC A;  3U23 A;  2RQT A;  2EYW A;  2E5K A;  1GRI A;  1UG1 A;  2LCS A;  1FYN A;  2RPN A;  2GQI A;  4CC2 A;  3VS4 A;  1WYX A;  4AG1 C;  2K7A A;  2AZS A;  3SEM A;  3I5R A;  1AZG B;  3C0C A;  1T0H A;  1YNZ A;  2EVR A;  2FPF A;  4JJC A;  2EYY A;  4AFZ C;  1AEY A;  2DJQ A;  2NWM A;  2CH4 A;  2DA9 A;  2KXD A;  2EGA A;  1PKS A;  3QWX X;  4AG2 C;  2LJ0 A;  1UDL A;  1UUE A;  2G6F X;  2CH4 W;  3SHW A;  1X43 A;  5ECA A;  2FG0 A;  3EG2 A;  2YUN A;  1PWT A;  4HVW A;  1AWW A;  4OML A;  1U3O A;  1WIE A;  4ZNX A;  4AFU C;  3FJ5 A;  2CRE A;  3H0F A;  2DYB A;  2K9G A;  1YN8 A;  2DBM A;  2KRO A;  4GLM A;  2K6D A;  1H92 A;  2EYZ A;  4JJD A;  2FEI A;  1N5Z A;  1NLP C;  1ABQ A;  1T3S A;  1IO6 A;  1B3Q A;  2FRW A;  4OMO A;  2L2P A;  2FRY A;  3VS0 A;  4J9B A;  5IXB A;  3EG1 A;  5FWB A;  3M0P A;  1QWE A;  4RTU A;  3R6N A;  2RF0 A;  2YT6 A;  2KBT A;  4K11 A;  3H41 A;  3NHN A;  1YWP A;  4IIO A;  3I9Q A;  1MUZ A;  4A63 B;  2LJ1 A;  1KIK A;  1ZX6 A;  2A08 A;  2J05 A;  1WXT A;  1X6B A;  1QWF A;  2KRM A;  1MV0 B;  3REB B;  1OPL A;  3EHQ A;  3VS1 A;  1NM7 A;  4HCK A;  3UF4 A;  1SHF A;  1AWO A;  2ABL A;  1WXU A;  4AFS C;  2J7I A;  4OMQ A;  2ROL A;  3NPF A;  1B07 A;  1JXM A;  2DNU A;  2HDA A;  2YDL A;  1M30 A;  1RI9 A;  2EPD A;  3VS5 A;  1M3B A;  1CKA A;  1HSQ A;  3VS7 A;  3PE0 A;  2OI3 A;  1NYF A;  1NEB A;  5IHI A;  1NG2 A;  1UEC A;  1RLP C;  3H0I A;  2C0O A;  4KRT A;  1PHT A;  1T0J A;  1X27 A;  2X3X D;  2DVJ A;  2DL4 A;  3O5Z A;  5IHN A;  2O9S A;  3TSZ A;  2JS2 A;  2H8H A;  2DX1 A;  3RNJ A;  2PTK A;  1AWX A;  2PZ1 A;  1K76 A;  2JW4 A;  4RTX A;  2GGR A;  1EFN A;  1TG0 A;  4D8D A;  2DIL A;  4CC3 A;  1UJ0 A;  1A0N B;  3UA6 A;  2DL3 A;  4DEY A;  4LE9 A;  4LN2 A;  1KFZ A;  2K79 A;  2W0Z A;  2W10 A;  2IIM A;  3ZL7 C;  3IQL A;  1W1F A;  1VYU A;  2F2X A;  5IHK A;  1SPK A;  2V1Q A;  4F14 A;  2SRC A;  4Z8A A;  1SRL A;  2JXB A;  4IIM A;  2RQU A;  2M51 A;  3VRZ A;  2K3B A;  1PKT A;  1UFF A;  1V1C A;  2LQW A;  1G83 A;  2YUQ A;  3UAT A;  2DBK A;  4J9G A;  3THK A;  1Z9Z A;  2J6K A;  4RTV A;  2M0Y A;  1OEB A;  3I35 A;  1ZSG A;  2XMF A;  2ESW A;  2JS0 A;  2X3W D;  1JQQ A;  2C0T A;  4J9I A;  5I11 A;  2D8H A;  2L3S A;  1AZE A;  1WDX A;  2O31 A;  1PRM C;  1WLP B;  1Y0M A;  2CT4 A;  2DLP A;  4CC4 B;  2O88 A;  3VS3 A;  1AOJ A;  3VS2 A;  4RTY A;  4JJB A;  2HCK A;  1SEM A;  4JZ4 A;  1K1Z A;  1ZLM A;  1E7O A;  4HVU A;  1NEG A;  2LMJ A;  2ECZ A;  3KFV A;  1J3T A;  2LJ3 A;  1WFW A;  3QWY A;  1ZBJ A;  2AK5 A;  5GJV B;  1UTI A;  1WA7 A;  1VYV A;  1X6G A;  1OOT A;  2KNB B;  1I1J A;  1CKB A;  1M8M A;  2A37 A;  1FMK A;  2HBW A;  1X69 A;  3NGP A;  5I22 A;  1M27 C;  1NLO C;  4QT7 A;  1JO8 A;  1YCS B;  2JMC A;  2CSI A;  4J9E A;  2GBQ A;  1X2Q A;  2LX7 A;  2J06 A;  1H8K A;  4DEX A;  2A36 A;  1RLQ C;  2FPE A;  3H0H A;  1JEG A;  3M0T A;  1UHF A;  1BU1 A;  2LQN A;  5HCK A;  2BTT A;  2CUB A;  2JM9 A;  2BZX A;  2GTJ A;  4GBQ A;  4OMP A;  1ZUU A;  1QCF A;  1H3H A;  2JT4 A;  4R0K A;  2D1X A;  3NMZ C;  2MIO A;  2RNA A;  4EIK A;  1G2B A;  1BB9 A;  1M3C A;  2OAW A;  4JZ3 A;  2CUD A;  5FWC A;  3PVL A;  2KRS A;  1K4U S;  2RQR A;  1Y57 A;  2D0N A;  2VVK A;  2KYM A;  1JU5 C;  2MCN A;  3EGU A;  1I0C A;  1K0S A;  1M3A A;  1QKX A;  2RMO A;  2FO0 A;  4Z88 A;  3RBB B;  1I07 A;  2DMO A;  1JXO A;  4J9C A;  4ESR A;  3TSW A;  1K0X A;  4LNP A;  2KRN A;  3M0R A;  2YUP A;  4D8K A;  1HJD A;  2O2O A;  1MV3 A;  3I5S A;  1ARK A;  1ZUY A;  2L0A A;  2MOX A;  2CT3 A;  1WX6 A;  2EBP A;  2J6O A;  3REA B;  2DF6 A;  2DL8 A;  2C0I A;  4CC7 A;  2L3Q A;  5GJW B;  2YSQ A;  1QLY A;  1WI7 A;  2RQV A;  4RTT A;  1E6G A;  2RN8 A;  3ULR B;  2JMA A;  4AFQ C;  2EYX A;  2JM8 A;  2DM1 A;  4ORZ A;  1K9A A;  1T3L A;  4RTZ A;  1UJY A;  2P4R A;  2ENM A;  1BK2 A;  2A28 A;  5EC7 A;  1HD3 A;  1GCQ C; 
#chains in the Genus database with same CATH topology
 5FLX E;  3OSV A;  1EIF A;  2D8J A;  2EW3 A;  4HT9 A;  1M8V A;  3EFR A;  1BI1 A;  4PJO E;  5KYU A;  5GAM d;  4LUD A;  1RUW A;  1AD5 A;  2LZ6 B;  2ED0 A;  3CD6 Q;  1ACM B;  2VWF A;  2HQE A;  3EG9 A;  1U1T A;  3PMT A;  3EG0 A;  3EFO B;  2XDD A;  5KYY B;  2RQW A;  1YIT A;  4BE1 A;  2NLU A;  1Q82 C;  1W6X A;  3LH0 A;  5IN1 A;  4BDY A;  3I56 T;  1YHQ Q;  1XNI A;  3OBY A;  2KE9 A;  1Z9Q A;  3LGL A;  3QDF A;  3V7C A;  3RMQ A;  1YJ9 Q;  1X2K A;  1UE9 A;  1YCY A;  4E7K A;  3JCM h;  3A98 A;  4E7L A;  4OMM A;  2ZPH B;  2BKD N;  2H3E B;  4F7U F;  5EG2 A;  3PIO A;  2FB7 A;  3CQT A;  2CZ1 B;  2E1H A;  3C95 A;  4EMK A;  1QP2 A;  1GCQ A;  1WXB A;  2DER A;  3CPW A;  4R56 A;  1VA7 A;  2CDT A;  3A1P A;  3OYF A;  2V1R A;  5HY6 A;  3SDZ A;  4A54 A;  4QKU A;  2XID A;  3JRZ A;  3CCM Q;  3TVT A;  2LDM A;  2GTO A;  4F16 A;  4OB1 B;  1XQH A;  1JJ2 S;  1GCP A;  1UHC A;  2AKK A;  3GBQ A;  1KD1 C;  4E47 A;  1VQ6 T;  2O9V A;  4M77 A;  2VKN A;  8AT1 B;  2F2V A;  1C1A A;  3GLX A;  1Q81 U;  4WCI A;  2K5L A;  2DTH A;  3FDR A;  4E6R A;  1KHI A;  3QKJ A;  2CSQ A;  4M77 G;  2AZV A;  2CGH A;  4HVV A;  4M75 A;  4JRQ A;  2EKH A;  3CCE Q;  1Q86 U;  2NUT A;  3M0U A;  1LCK A;  3HRS A;  1QVF A;  4HCC A;  1K9M U;  4M7D G;  2EGC A;  3OYM A;  5GAO r;  2YXY A;  2Y4X A;  3OYJ A;  1NYG A;  3U23 A;  5CVI A;  5LJ3 d;  2JVV A;  3MEA A;  1QP3 A;  4FT2 A;  5FU7 B;  1X01 A;  4C8Q A;  1WYX A;  2LQ8 A;  3P8H A;  4PJJ A;  4Y28 E;  1AZG B;  2D9T A;  1I5L A;  3I55 T;  5CKF A;  4JJC A;  2EYY A;  2DJQ A;  3CC2 Q;  2NWM A;  1RAD B;  2CH4 A;  1N27 A;  2EGA A;  3QWX X;  4AG2 C;  1VQ6 A;  2EQU A;  2VXE A;  2G6F X;  4XU3 A;  3G6E A;  2QEX Q;  4PKC C;  4MML A;  2OTJ T;  1Y96 A;  3J7A F;  3ER0 A;  3ZEH A;  1WIE A;  4RMO A;  1WHK A;  4BI3 A;  2DXB A;  1KD1 U;  3H0F A;  2B8A A;  2PVO B;  3CXC A;  2DYB A;  2K9G A;  4LDV A;  1D0X A;  5KYY A;  1K8A C;  1N6A A;  1VQM A;  4JJD A;  3TCJ A;  1D3B A;  1JJ2 A;  3EGD B;  4GY5 A;  3HRU A;  1PSF A;  5C0M A;  4ZN3 A;  3TEE A;  2LX9 A;  3E1S A;  2RHZ A;  4FCY A;  1NBE B;  5LJ3 j;  2H3J A;  3C12 A;  4IUQ A;  4RTU A;  4J6X A;  3R6N A;  2RF0 A;  5CQX A;  2YT6 A;  4DOW A;  1KHC A;  4K11 A;  4XTZ A;  4IIO A;  2LJ1 A;  4BE2 A;  2A08 A;  2J05 A;  1JJ2 P;  3REB B;  1QWF A;  4J83 A;  1OPL A;  3EHQ A;  1NM7 A;  5GAO n;  3CCV T;  4XTX A;  4M78 C;  5A0D A;  2ABL A;  4OMQ A;  1M90 R;  3NPF A;  4PJN A;  4DBH A;  1B07 A;  5D7U A;  4ZGJ B;  1JXM A;  1G3Y A;  1RAA B;  5LL6 S;  1D1C A;  1F1B B;  3KBG A;  3G71 Q;  2QQ9 A;  3VS5 A;  1N9S A;  1QMC A;  3M4G A;  3FRN A;  2GFU A;  3VUZ A;  5IHI A;  1NE8 A;  3KXT A;  1RLP C;  2ZPG B;  2C0O A;  1HK9 A;  2L8D A;  3F70 A;  1X27 A;  1PHT A;  1WHG A;  1VUB A;  2DVJ A;  2DL4 A;  2LTO A;  3EGD A;  3O5Z A;  4Y91 A;  8ATC B;  2C06 A;  2E65 A;  4KBM B;  1Q82 U;  2H8H A;  3CC7 Q;  3M53 A;  4FYX B;  4B6M A;  2MWP A;  2MYS A;  3QG1 A;  1YJ9 A;  2PZ1 A;  2JZ2 A;  1EFN A;  1TG0 A;  2V26 A;  4XTV A;  4D8D A;  1MHN A;  3ZFJ A;  3OS5 A;  1Q7Y R;  1Q82 R;  5GAO q;  4BI8 B;  2EKO A;  3TRE A;  2ZPE B;  4PJO C;  5GAO m;  1KFZ A;  2W0Z A;  1KQ2 A;  1NPP A;  1IZ6 A;  3OS0 A;  1W1F A;  3VYH B;  1PD0 A;  3OY9 A;  3BDU A;  4EMH A;  4UC4 A;  1OI1 A;  4IIM A;  2BE7 D;  3AT1 B;  3E9F A;  2RQU A;  4DBR A;  1UFF A;  2LQW A;  2M16 A;  2YUQ A;  3UWN A;  1IHV A;  3VJP A;  5HKC A;  2XKO C;  2J6K A;  4DOV A;  2QTV A;  5KE2 A;  4ZN1 A;  3OQ5 A;  2DK3 A;  5KCH A;  1G3T A;  2XMF A;  3JCM f;  1JQQ A;  2C0T A;  2Z0W A;  4E7I A;  2D8H A;  1UGQ B;  1WDX A;  3JB9 G;  2DLP A;  3V7S A;  4PJO G;  3DLM A;  2HCK A;  1K73 U;  2DPP B;  4JZ4 A;  1E7O A;  2K3X A;  2LT1 A;  2JOY A;  3KFV A;  2LJ3 A;  1WFW A;  3QWY A;  3AHU A;  2OTJ Q;  1ZBJ A;  5GJV B;  2RHY A;  4PJO B;  1OOT A;  2KNB B;  1I1J A;  4PJL A;  2K2V A;  2PU9 B;  1JB0 E;  1X69 A;  1YBY A;  3NGP A;  1M27 C;  2FVU A;  5D6W A;  4ZTJ A;  2WSE E;  5GAM g;  4J9E A;  1OZ3 A;  3CCJ Q;  2J06 A;  1VQ5 Q;  3JAM E;  1H8K A;  3ASK A;  4E7J A;  3H0H A;  3VYG A;  1UHF A;  5HCK A;  1D3B B;  2JJ9 A;  3LGF A;  2JM9 A;  4XTY A;  4NL3 A;  1Q7Y C;  2BZX A;  4OVA A;  5CK9 A;  1M1K C;  2HD0 A;  2HQX A;  1PSE A;  4BI4 A;  1XTD A;  1M2V B;  3OMG A;  1TH7 A;  2GCX A;  1ZSZ C;  4EIK A;  1G2B A;  2OAW A;  1NJI R;  1VQM Q;  3PVL A;  2KRS A;  1VQ9 T;  3CEY A;  1Y57 A;  4YTL A;  2VVK A;  1I0C A;  1K0S A;  1M3A A;  3QDR B;  1QKX A;  2RMO A;  3EFO A;  1I07 A;  2DMO A;  3RDV A;  5GAM h;  1JXO A;  4M77 D;  4C92 A;  1K0X A;  4LNP A;  4M7D E;  3M0R A;  3VUB A;  4OP0 A;  2KMT A;  1YJW Q;  3CCM T;  3E2U A;  4D8K A;  1W2B A;  1ZUY A;  2BIV A;  2QXF A;  3INZ A;  1OYX A;  3OBW A;  2CT3 A;  2EBP A;  2J6O A;  2F5T X;  4M7A D;  2C0I A;  1YIJ Q;  3PMI A;  3CCU A;  2YSQ A;  2RH2 A;  1WI7 A;  4RTT A;  1MMA A;  4KT0 E;  4JS4 A;  3V7R A;  1VQ8 A;  4C92 C;  5GAN f;  1KC8 U;  2P4R A;  1VQK T;  3RKW A;  2CZ0 B;  2ENM A;  1BK2 A;  3MKD A;  3X26 B;  2DET A;  2ZPI B;  3FJP A;  5DLQ E;  1GCQ C;  3HFN A;  1IRE B;  4OMN A;  3RKY A;  2LP5 A;  5KYX A;  3JCM W;  1TUD A;  2FZC B;  3CMA A;  1BI0 A;  4F17 A;  1SF9 A;  2VGN A;  2EGE A;  2EQI A;  2BZY A;  2DO3 A;  1VYT A;  2L3P A;  2EJG A;  2VYT A;  1B34 B;  3PNW C;  5GMK i;  4TVR A;  3RR6 A;  4RUG A;  3TQ7 P;  4KH0 B;  1U5S A;  2DVE A;  4FU6 A;  1PRL C;  3NTH A;  3A5Z B;  1XOV A;  3JB9 D;  1VQK Q;  2OTL A;  2VB6 A;  2M1H A;  1TUC A;  5IXF A;  3VRY A;  2QDL A;  2M9U A;  1PD1 A;  1SRM A;  1B34 A;  2P4T A;  3RMS A;  1Q81 R;  2QQA A;  4C8Q B;  5CIU A;  1M2V A;  2K2M A;  1VQO T;  4J9F A;  1KSW A;  1QCN A;  1D09 B;  5GAN 6;  1GFD A;  2XK0 A;  1QVP A;  2KXC A;  1S1N A;  4IUU A;  4AT1 B;  1ZUK A;  3UA7 A;  1CSK A;  1E6H A;  2F69 A;  1C0M A;  2QQR A;  1ABO A;  5FW9 A;  1ZA1 B;  1NZ9 A;  3CBM A;  1OX9 A;  3EFS A;  3I56 Q;  3SWN A;  4LUE A;  5LJ5 d;  1KJW A;  3S3N A;  3JV3 A;  3L2Z A;  2FPD A;  4ME7 A;  3G6E T;  1VQ9 Q;  2KR3 A;  1VQM T;  3J81 E;  2EJF A;  1S72 A;  3CBO A;  2PNI A;  3SWN B;  2HEQ A;  5HK0 A;  3JCM V;  4C92 F;  4LDX A;  1TS9 A;  1KC8 R;  2F2W A;  4MDX A;  2RQT A;  2EYW A;  1UG1 A;  3SWN C;  1FYN A;  2RJD A;  5I21 A;  3CCJ A;  3MP8 A;  4ZGE B;  5GAN g;  2AZS A;  3CPW S;  1YIT Q;  2MMP A;  3C0C A;  3CCQ Q;  4E2F B;  2F5K A;  3OYB A;  1VQ4 Q;  1AEY A;  1VQ5 T;  1YHQ A;  5D6X A;  4C0D B;  2X4W A;  1UGP B;  2KXD A;  1PKS A;  1UDL A;  1D0Y A;  2X51 A;  2HMA A;  4OGE A;  4C8Q E;  2X9H A;  1WJS A;  4C8Q F;  5LJ3 f;  3V8L A;  1IB8 A;  1W2B P;  2X35 A;  4LDW A;  3OS1 A;  3L2W A;  4HVW A;  1YI2 A;  5CKD A;  1U3O A;  4AFU C;  4A53 A;  2AHJ B;  3CCM A;  4J6Y A;  2EIF A;  2EYZ A;  1H92 A;  3C94 A;  4NS5 A;  3JCM Q;  2DZC A;  1WHL A;  1LNX A;  1YJW A;  4X9D A;  4E7Z A;  1N5Z A;  1NLP C;  3N5B B;  4C0F A;  4M77 E;  3VS0 A;  1VQP A;  3EG1 A;  3NFC A;  2R58 A;  4C92 E;  4KH1 B;  4M78 A;  1QVF P;  4OGC A;  3NHN A;  2DYI A;  1MUZ A;  3GNG A;  4HKE A;  4A63 B;  3EH1 A;  3A8L B;  3T9N A;  1ZX6 A;  2MPX C;  2KRM A;  2YRD A;  1K8A R;  1VQ8 Q;  3OYI A;  2LRQ A;  4QW2 A;  3VS1 A;  1VQ7 A;  3EH2 A;  4HCK A;  2XDB A;  3M55 A;  1SHF A;  1AWO A;  4AFS C;  1WXU A;  2J7I A;  1N8R R;  4FYV B;  2RA2 A;  2CP6 A;  3MJX A;  2DNU A;  2HDA A;  2YDL A;  4MZP A;  3CCJ T;  2HL3 A;  1RI9 A;  3CMA Q;  4JUV A;  3OYE A;  4M78 B;  1HSQ A;  4JRK A;  4XTU A;  3LWI A;  2OI3 A;  3H6Z A;  1NG2 A;  3CC2 A;  3A8G B;  1UEC A;  2XU8 A;  5M9O A;  4KRT A;  2QYZ A;  1T0J A;  2X3X D;  3V8J A;  4PJO D;  4O6J A;  2YRV A;  1M1G A;  2JS2 A;  2V8J A;  3CC7 T;  4MDW A;  1XJW B;  2QI2 A;  3JCM c;  2CYZ B;  3JSC A;  1WQW A;  4PJO F;  4JRI A;  1Y71 A;  5J26 A;  3D7S B;  1OUL A;  2JW4 A;  5CO7 A;  2OTL Q;  2QEX A;  1RAE B;  1MNE A;  1G3S A;  3QYG B;  2DXU A;  2DFU A;  2P0K A;  3MHX A;  4DEY A;  4V2S A;  5KYX B;  1IGU A;  2BE9 B;  4LN2 A;  3FLG A;  4M7A B;  3CCS Q;  1MMD A;  1VYU A;  2F2X A;  4N0A A;  2RI5 A;  3BDL A;  4J7I A;  1SPK A;  4O5V A;  4Z8A A;  1SRL A;  2JXB A;  1VQP T;  4FT4 A;  2QTX A;  1RAB B;  4HCZ A;  2PQW A;  2X4Y A;  2MF2 A;  3WXM B;  1V1C A;  1G83 A;  2DBK A;  4BB7 A;  3THK A;  4FSX A;  3H8Z A;  3JCM J;  5LJ5 j;  3JCM X;  1ZSG A;  4Z02 A;  2ESW A;  1UEB A;  3P8D A;  1KD1 R;  3CCL T;  4A4G A;  4KGZ B;  1K9M C;  1PRM C;  1Y0M A;  1JRI A;  2YRC A;  1S72 Q;  1K9M R;  1AOJ A;  2YHT A;  4MZT A;  4D6W A;  4A4K A;  2VC8 A;  2MWO A;  2DTO A;  1ZLM A;  3R6O A;  4PFZ A;  2ZAE A;  2E6N A;  2Y4Y A;  2AK5 A;  1U8R A;  3X25 B;  1WA7 A;  2WSF E;  1CKB A;  1M8M A;  2A37 A;  4IKF A;  3CCQ A;  4MZM A;  2JMC A;  3QZ9 B;  3CMA T;  1NJI C;  1LVK A;  2L89 A;  4N4I A;  3X24 B;  2FPE A;  3OYH A;  1JEG A;  3FC3 A;  1LOJ A;  1M4Z A;  2BTT A;  2CUB A;  3FEO A;  4FL6 A;  3OYK A;  1WQ7 A;  1RL2 A;  3PTA A;  1YIT T;  1VQ8 T;  4GBQ A;  2EQM A;  2RI2 A;  3L2V A;  4QQ6 A;  3QJ6 A;  3DB4 A;  1YI2 Q;  1H3H A;  3RER A;  3MEU A;  3MO8 A;  4RG8 A;  3E9G A;  4R0K A;  4FW2 A;  3NMZ C;  2MIO A;  2EAY A;  1U1S A;  5GAN 5;  4PNO A;  1M3C A;  4R55 A;  4JZ3 A;  4KGX B;  1M90 C;  5A2Q E;  3FIF A;  2D0N A;  1JU5 C;  2P0Q A;  4M7D D;  2E41 A;  3MP6 A;  2LT4 A;  5KE3 A;  3LLR A;  4LDY A;  3LWH A;  3L2U A;  4ESR A;  1OU8 A;  3TSW A;  3JB9 H;  2VV5 A;  3QUI A;  2YUP A;  3MCA B;  1SKU B;  5CKH A;  3EG9 B;  2RB6 A;  1D1A A;  3VKI A;  1KQS P;  2NUT B;  1VQ7 Q;  2L0A A;  2EQK A;  4FYW B;  1WX6 A;  4M78 E;  5I2S A;  3OA6 A;  2A0F B;  1I8F A;  2OTJ A;  4II1 A;  2DF6 A;  5LJ3 e;  3M58 A;  3OYA A;  2P0P A;  3JCM g;  1N9R A;  1QLY A;  1E6G A;  2HQH A;  1LJO A;  1ZBX A;  3M5A A;  3URG A;  1VQL A;  4ORZ A;  3OYC A;  4RTZ A;  4QVC A;  3JB9 J;  2FYK A;  1ZSZ B;  2DAQ A;  4BDZ A;  1QVG A;  1RI0 A;  2DRK A;  2SEM A;  2COW A;  3HKS A;  4L5G A;  4C92 B;  4C5E A;  1WNL A;  1SG5 A;  5IT9 E;  1M2O A;  1QKW A;  2DE0 X;  1SHG A;  5GMK e;  4M75 D;  2QA4 T;  3QJY A;  3WVE B;  4X34 A;  3CD6 T;  3MEV A;  1X6O A;  1DJ7 B;  4A4F A;  1QVG P;  4J9H A;  2DL5 A;  2QDY B;  3G4S A;  3VS6 A;  1M5Q 1;  2I2L A;  3CCS A;  3EG3 A;  1AVZ C;  1U06 A;  3CCR Q;  3A8M B;  2L5Q A;  1PNJ A;  2R57 A;  5KYN A;  3HTR A;  2RJE A;  3OMC A;  2OJ2 A;  5FU7 C;  1OPK A;  2CZ6 B;  4N4G A;  4PLL A;  4CI0 C;  1YIJ T;  1AWJ A;  2PUK B;  2K5I A;  1FMW A;  3PVQ A;  3LW5 E;  4XK8 E;  2JTE A;  2AT1 B;  1QW1 A;  1VQO Q;  4N0A C;  3CCV A;  4OB0 B;  2DJZ A;  2COY A;  5L23 A;  1BBZ A;  2MAM A;  1FMV A;  3UDC A;  1W70 A;  2M0O A;  1I4K 1;  4Z89 A;  3QO3 A;  3GPL A;  2NUZ A;  2R5M A;  4IUV A;  1QVF S;  4Y92 A;  1YIJ A;  1YJ9 T;  3CCL A;  3CCR T;  2NUP B;  2ATC B;  2QAZ A;  3Q1J A;  1YWO A;  2F1L A;  2K57 A;  3GNF B;  3JCM P;  3L2R A;  4M75 B;  1OV3 A;  3LH5 A;  2KEA A;  2LNV A;  4JRP A;  2I0N A;  2HAX A;  2KYB A;  4M4Z A;  3HSB A;  2MK5 A;  5IH2 A;  2KT8 A;  5CQY A;  4M75 C;  1LPL A;  1GL5 A;  1GRI A;  1HXD A;  1EZZ B;  1OX8 A;  1FWZ A;  5GAO p;  2GQI A;  4CC2 A;  3VS4 A;  2K7A A;  3I5R A;  5LJ5 f;  3EGX B;  2DD5 A;  1K8A U;  1T0H A;  1YNZ A;  4AFZ C;  3CME Q;  1IRX A;  3P8B B;  3SFM A;  4FYY B;  2CZ7 B;  3LX7 A;  2E70 A;  2PUO B;  4RG2 A;  5GAM f;  2CH4 W;  3OB9 A;  3EGX A;  1X43 A;  5ECA A;  2QAS A;  2FG0 A;  4JJN K;  1I5O B;  2O4X B;  4JDS A;  1D0Z A;  2YWW A;  4XU2 A;  4KUI A;  4BY6 C;  1VQN A;  1AWW A;  3GF5 A;  4PL6 A;  1BYM A;  3JCM d;  1YN8 A;  2ZGW A;  2KRO A;  5A0L A;  4GLM A;  3MET A;  4BAC A;  1BI2 A;  1RAI B;  3DB3 A;  2E64 A;  1VIF A;  2RHU A;  4NOY A;  2FEI A;  2G3R A;  4X9C A;  2VUB A;  2QGF B;  3M57 A;  4A4H A;  4EMK C;  1B3Q A;  2FRW A;  2KK4 A;  4M78 G;  2MI6 A;  2FRY A;  3I56 A;  5IXB A;  5GAN h;  3L1A A;  2YLB A;  2Y90 A;  1AHJ B;  4WTO B;  4JLI A;  1VIE A;  4XU1 A;  1YWP A;  3SB2 A;  2HZY A;  2RHX A;  3I9Q A;  4IUR A;  3QZ5 B;  2D6F A;  1R0C B;  1WXT A;  1X6B A;  1VQL Q;  3BE3 A;  3BY7 A;  4L59 A;  2KI7 A;  4BUG A;  2XI9 A;  3UF4 A;  4L6V 5;  1Q81 C;  1UB4 A;  3L2Q A;  3H9N A;  2EFI A;  2XG8 D;  2DKG A;  3GOX A;  5C6S A;  1BIA A;  3MP1 A;  2EPD A;  4BY6 B;  5GMK l;  1M3B A;  1CKA A;  1SSF A;  4J7F A;  3PE0 A;  1VQ4 A;  5FRM A;  4P5N A;  5KYW A;  4OB2 B;  3OYG A;  4KUL A;  4E7S A;  3G4S Q;  3G4S T;  2DX1 A;  4ELZ C;  1QVG S;  1BKB A;  5L8R E;  3OS2 A;  1X75 C;  2GGR A;  5J3B A;  3S3M A;  2DIL A;  4CC3 A;  2RK1 A;  3UA6 A;  2DL3 A;  4C0Z A;  4LE9 A;  2K79 A;  2W10 A;  2IIM A;  4EPC A;  1TTH B;  1KC8 C;  3JB9 F;  3IQL A;  3OYL A;  2ZZD A;  1VQO A;  3CBP A;  3CCV Q;  1TU0 B;  3OSS C;  4CRI A;  4F14 A;  3BW1 A;  2XDP A;  5FRN A;  1VQP Q;  4C8Q C;  2K3B A;  4OF1 A;  1TXQ A;  4RTV A;  4DQ2 A;  2CP2 A;  4EDU A;  2JS0 A;  3PFS A;  5GAO l;  4M7D B;  2RM4 A;  5I11 A;  2O31 A;  3HPW A;  1FXX A;  2CT4 A;  1Q86 C;  1YJN Q;  1Y07 A;  4C0D C;  4M7D A;  2NYS A;  3QSU A;  1H64 1;  4JJB A;  1K1Z A;  4PFP A;  4HVU A;  1NEG A;  2ECZ A;  1QQJ A;  2HNI A;  2EWN A;  1QCO A;  3RKX A;  4M75 G;  1X6G A;  3CXC P;  1ZSZ A;  2HBW A;  2ZPB B;  1NJI U;  3M59 A;  5LJ3 g;  3CME A;  1G8X A;  4QT7 A;  1YCS B;  2GBQ A;  5CKE A;  3S6W A;  2RK2 A;  1JBM A;  2LX7 A;  2HKQ B;  4LD6 A;  4DEX A;  2A36 A;  1RLQ C;  3I55 Q;  3TU4 K;  3RUX A;  2QK0 A;  3CD6 A;  4EMK B;  4F7U G;  1VQL T;  2GTJ A;  4F7U B;  1VQN Q;  4C8Q D;  4ZGD B;  4WF2 A;  2KAF A;  1M1K U;  3CPW P;  2RNA A;  4QQD A;  1G5V A;  2LCL A;  1Q7Y U;  1BB9 A;  2GFA A;  1D1B A;  5FWC A;  1N8R C;  3CCE T;  2RQR A;  1BIB A;  2K4Y A;  1H3Z A;  2HKN A;  2QGG A;  3EGU A;  4N4H A;  4B9X A;  2FO0 A;  3RBB B;  3DLL A;  4FM4 B;  5LJ5 e;  1ZHI A;  2M02 A;  5KYU B;  5GAN 8;  3NTK A;  2KRN A;  5GAN j;  2QEX T;  4XU0 A;  4C92 D;  3M9Q A;  1HJD A;  2CP3 A;  2O2O A;  5CR2 A;  1MV3 A;  3I5S A;  3V8K A;  1ARK A;  4XTW A;  1BCM A;  4AMC A;  3M54 A;  3REA B;  5GAM e;  1M90 U;  2DXT A;  1V76 A;  2RHI A;  4XQ3 A;  2DL8 A;  1O75 A;  2R5A A;  4CC7 A;  3JB9 I;  4FIB A;  3JCM b;  2RQV A;  1WGS A;  3CC2 T;  3CME T;  2RN8 A;  3ULR B;  3UT1 A;  5GMK m;  1VQ4 T;  4QQG A;  4AFQ C;  3GP8 A;  2EYX A;  2JM8 A;  1OZ2 A;  1K9A A;  3E19 A;  1P92 A;  1UJY A;  2E12 A;  5FRO A;  2E3H A;  2A28 A;  2BZ8 A;  4PJM A;  1YHQ T;  4M7A F;  1SSH A;  3GIB A;  2DIG A;  1TSF A;  2CP7 A;  2J6F A;  1BI3 A;  1MGQ A;  1YP5 A;  2LNH B;  4B9W A;  2CKK A;  4HXJ A;  3CC4 A;  1Y96 B;  2FZG B;  1IHW A;  3UPU A;  3HHT B;  2QA4 Q;  3L42 A;  2KDS A;  2VXF A;  2GNC A;  3HFO A;  4J6W A;  2AKL A;  2DL7 A;  4J9D A;  3QPH A;  2B86 A;  4X1V A;  3NTI A;  2ROT A;  3ME9 A;  5DLO A;  2WAC A;  5CKB A;  2HBP A;  4RTW A;  4F7U E;  3A8H B;  1VQ6 Q;  2DXC A;  2P84 A;  2VGM A;  3QXE B;  3C4S A;  2XD0 A;  2YLC A;  2YUO A;  1UGV A;  4M78 F;  1WHH A;  2LVM A;  2DRM A;  2LC4 A;  2JNG A;  4C5H A;  1PC0 A;  4JPB W;  1VQ7 T;  4M75 F;  3KUF A;  2ED1 A;  1KQS A;  4M7A E;  4M78 D;  2CS7 A;  3MEW A;  1YJW T;  3M0Q A;  1GBQ A;  3EHR A;  2E10 A;  2EYQ A;  4FSS A;  1YJN A;  4DBQ A;  2O01 E;  3OW2 S;  3M0S A;  4HCB A;  4BE0 A;  3M56 A;  4LDU A;  3G1J A;  4M77 B;  2KGT A;  4RCC A;  2E5Q A;  1K73 R;  7AT1 B;  3DKM A;  3SD4 A;  4RKU E;  2A7Y A;  3ZBD A;  1GBR A;  2HSP A;  1RAH B;  4EMG A;  2DZ9 A;  1TOV A;  4PJO A;  2KT1 A;  1KG1 A;  4C5G A;  1GFC A;  2E5K A;  1B7T A;  2LCS A;  1FX7 A;  2D0Q B;  1YI2 T;  4M77 F;  1RAF B;  3G7Z A;  2DEQ A;  2RPN A;  3OYY A;  4AG1 C;  4M7A C;  3SEM A;  3I55 A;  3G71 A;  2KY9 A;  1PM3 A;  2FHD A;  5FU6 B;  3RES A;  4C8Q G;  2EVR A;  2FPF A;  5GAN d;  2WSC E;  5AT1 B;  3CCR A;  2DA9 A;  4M7A G;  4DBF A;  2JN0 A;  2JUF A;  2LJ0 A;  4HT8 A;  2E6Z A;  1UUE A;  2XIC A;  3CC7 A;  2K5F A;  5J39 A;  3SHW A;  4M7A A;  2LQK A;  3EG2 A;  4VUB A;  4F04 B;  2LCC A;  2AIR B;  5LJ5 h;  2YUN A;  1PWT A;  3PIP A;  4ZTF A;  4ATO A;  4OML A;  5GAN 7;  4ZNX A;  2PVD B;  3FJ5 A;  2CRE A;  4JLG A;  1NPR A;  2DBM A;  5DY9 A;  2JTM A;  4J5Y A;  2K6D A;  4C92 G;  1M1K R;  3CPF A;  1ABQ A;  4J8O A;  3CCL Q;  1T3S A;  1IO6 A;  2IG0 A;  4OMO A;  2L2P A;  2EJ9 A;  4J9B A;  3HP9 A;  5FWB A;  5IAY A;  2IPO B;  1QWE A;  3M0P A;  1I81 A;  1IGQ A;  5FU6 C;  2KBT A;  4QVD A;  3H41 A;  1VQN T;  1PG5 B;  1KIK A;  1MV0 B;  5GMK h;  5GAN e;  1Y7X A;  4BD3 A;  3O8V A;  2ROL A;  3CCS T;  2RJC A;  1RAC B;  1IXD A;  1KK7 A;  1M30 A;  5GAM j;  4MMK A;  1R8O B;  3M4Y A;  3VS7 A;  3CC4 Q;  9ATC B;  1NYF A;  2QA4 A;  1NEB A;  4ANJ A;  3J80 E;  2OAU A;  4ELY C;  1Q86 R;  2PVG B;  1RAG B;  1WPY A;  2COZ A;  3H0I A;  3CCU T;  1UGS B;  5IHN A;  5GAN 2;  5GAN 3;  2O9S A;  3TSZ A;  4DA4 A;  1MND A;  2E3I A;  3VU3 C;  4M75 E;  5CCA A;  3RNJ A;  1BCO A;  5HK3 A;  2PTK A;  1AWX A;  1K76 A;  4LD9 K;  4RTX A;  3OW2 P;  2XHC A;  1VQ5 A;  2FZK B;  2OX7 A;  2QQB A;  1YJN T;  1S72 T;  3FB9 A;  3CC4 T;  1UJ0 A;  2CP0 A;  1A0N B;  3RIR A;  1WJR A;  4E7H A;  4PK4 A;  2RO0 A;  3QBY A;  4Q5W A;  2ZCF B;  4OMF B;  1V29 B;  1WHJ A;  4KGV B;  1MMN A;  3ZL7 C;  2L3R A;  3MPU B;  5IHK A;  4A4E A;  2V1Q A;  2SRC A;  2DEU A;  1G3W A;  3A8O B;  2M51 A;  2KQW A;  2E4H A;  3VRZ A;  5KYW B;  1PKT A;  1R77 A;  3UAT A;  4J9G A;  1Z9Z A;  3HL8 A;  2M0Y A;  1OEB A;  3BFM A;  5I2M A;  3QYH B;  2FL7 A;  3I35 A;  2X3W D;  2CP5 A;  3PGG A;  4GLK A;  2RJF A;  3S3O A;  4J9I A;  2L3S A;  1AZE A;  4C5I A;  1TWB A;  1WLP B;  3OW2 A;  4CC4 B;  3PT9 A;  2O88 A;  3VS3 A;  3VS2 A;  5DM7 R;  4XAX B;  4RTY A;  2OTL T;  3HRT A;  2DIQ A;  1SEM A;  4M77 C;  1OQK A;  2QQS A;  2LMJ A;  3QII A;  1J3T A;  1EX4 A;  1C6V X;  1UTI A;  3X20 B;  1TUG B;  1M9S A;  1VYV A;  3CCE A;  1FMK A;  3CCU Q;  1UGR B;  1WJQ A;  5I22 A;  3JCM e;  1NLO C;  1JO8 A;  2CSI A;  4M7D F;  4C0G A;  1X2Q A;  3G71 T;  1W2B S;  2V8K A;  4IUP A;  2NUP A;  6AT1 B;  2IVW A;  4PLI A;  4F7U A;  2DTI A;  4PFO A;  3LYI A;  2BUD A;  3M0T A;  4OB3 B;  1BU1 A;  2LQN A;  2K3Y A;  1KQS S;  2RD1 A;  2KSS A;  3WVD B;  2DD4 A;  2O4X A;  2ZPF B;  1HYO A;  1KQ1 A;  1YFN A;  3QHS A;  4OMP A;  1ZUU A;  5LJ5 g;  1QCF A;  4M7D C;  1Q95 G;  1VOM A;  5KCO A;  2JT4 A;  4QVZ A;  2D1X A;  2RI3 A;  1ZQ1 A;  1PCX A;  2CUD A;  2A3L A;  5GAN 4;  3G6E Q;  1K4U S;  2X4J A;  1VQK A;  5AYF A;  1AT1 B;  3CXC S;  1GXI E;  1K73 C;  2KYM A;  2MCN A;  3VV0 A;  1M1F A;  4JS5 A;  4Z88 A;  2JTF A;  3EAE A;  4HA8 A;  4J9C A;  5CAI A;  2QG9 B;  2V8I A;  4NL2 A;  5LJ3 h;  4LXC A;  5D6Y A;  2EQJ A;  1O9S A;  1WHM A;  1WZO A;  4FW1 A;  4KUD K;  2MOX A;  1OU9 A;  2HSE B;  1MMG A;  1ZA2 B;  1N8R U;  3OYN A;  5GMK j;  1R0B G;  4RCB A;  2L3Q A;  5GJW B;  3OYD A;  2GQV A;  1W4S A;  2HL5 C;  2GF7 A;  5KH6 A;  2JMA A;  2X4X A;  2DM1 A;  2KVQ G;  1T3L A;  3X28 B;  3CCQ T;  1VQ9 A;  2VAS A;  5A0G A;  5EC7 A;  1HD3 A;  4IUT A; 
#chains in the Genus database with same CATH homology
 2BZ8 A;  4OMN A;  2D8J A;  1SSH A;  2EW3 A;  2DRK A;  2J6F A;  2SEM A;  2LP5 A;  1TUD A;  4LUD A;  1RUW A;  1AD5 A;  1YP5 A;  2LNH B;  2LZ6 B;  2ED0 A;  4F17 A;  4HXJ A;  2VWF A;  2EGE A;  2EQI A;  1QKW A;  2DE0 X;  2BZY A;  3EG0 A;  1SHG A;  1VYT A;  2GNC A;  2L3P A;  2RQW A;  2AKL A;  2DL7 A;  4J9D A;  1W6X A;  2B86 A;  4X1V A;  4J9H A;  2DL5 A;  2ROT A;  3VS6 A;  4RUG A;  3EG3 A;  1AVZ C;  1U06 A;  1U5S A;  1PNJ A;  1Z9Q A;  2KE9 A;  4RTW A;  1PRL C;  1X2K A;  1XOV A;  1UE9 A;  3A98 A;  1TUC A;  5IXF A;  2OJ2 A;  3VRY A;  2QDL A;  4OMM A;  2YUO A;  1OPK A;  1SRM A;  1UGV A;  3CQT A;  1AWJ A;  2K2M A;  3PVQ A;  1GCQ A;  1WXB A;  4J9F A;  1KSW A;  2DRM A;  1VA7 A;  2JTE A;  4JPB W;  2CDT A;  1GFD A;  2V1R A;  2ED1 A;  2KXC A;  1S1N A;  5L23 A;  1BBZ A;  3TVT A;  2GTO A;  1ZUK A;  3M0Q A;  4F16 A;  3UA7 A;  1GCP A;  1W70 A;  1UHC A;  2AKK A;  3GBQ A;  1CSK A;  1E6H A;  1GBQ A;  3EHR A;  4Z89 A;  4FSS A;  2NUZ A;  1ABO A;  3M0S A;  4Y92 A;  5FW9 A;  2O9V A;  2VKN A;  2F2V A;  4WCI A;  4LUE A;  2KGT A;  1KJW A;  1YWO A;  3JV3 A;  4E6R A;  1OV3 A;  2CSQ A;  3LH5 A;  2KEA A;  2AZV A;  2FPD A;  2I0N A;  4HVV A;  2KYB A;  2EKH A;  2KR3 A;  4M4Z A;  3M0U A;  1GBR A;  1LCK A;  2HSP A;  5IH2 A;  2PNI A;  2EGC A;  2HEQ A;  2KT8 A;  2KT1 A;  2F2W A;  1NYG A;  1GL5 A;  1GFC A;  3U23 A;  2RQT A;  2EYW A;  2E5K A;  1GRI A;  1UG1 A;  2LCS A;  1FYN A;  2RPN A;  2GQI A;  4CC2 A;  3VS4 A;  1WYX A;  4AG1 C;  2K7A A;  2AZS A;  3SEM A;  3I5R A;  1AZG B;  3C0C A;  1T0H A;  1YNZ A;  2EVR A;  2FPF A;  4JJC A;  2EYY A;  4AFZ C;  1AEY A;  2DJQ A;  2NWM A;  2CH4 A;  2DA9 A;  2KXD A;  2EGA A;  1PKS A;  3QWX X;  4AG2 C;  2LJ0 A;  1UDL A;  1UUE A;  2G6F X;  2CH4 W;  3SHW A;  1X43 A;  5ECA A;  2FG0 A;  3EG2 A;  2YUN A;  1PWT A;  4HVW A;  1AWW A;  4OML A;  1U3O A;  1WIE A;  4ZNX A;  4AFU C;  3FJ5 A;  2CRE A;  3H0F A;  2DYB A;  2K9G A;  1YN8 A;  2DBM A;  2KRO A;  4GLM A;  2K6D A;  1H92 A;  2EYZ A;  4JJD A;  2FEI A;  1N5Z A;  1NLP C;  1ABQ A;  1T3S A;  1IO6 A;  1B3Q A;  2FRW A;  4OMO A;  2L2P A;  2FRY A;  3VS0 A;  4J9B A;  5IXB A;  3EG1 A;  5FWB A;  3M0P A;  1QWE A;  4RTU A;  3R6N A;  2RF0 A;  2YT6 A;  2KBT A;  4K11 A;  3H41 A;  3NHN A;  1YWP A;  4IIO A;  3I9Q A;  1MUZ A;  4A63 B;  2LJ1 A;  1KIK A;  1ZX6 A;  2A08 A;  2J05 A;  1WXT A;  1X6B A;  1QWF A;  2KRM A;  1MV0 B;  3REB B;  1OPL A;  3EHQ A;  3VS1 A;  1NM7 A;  4HCK A;  3UF4 A;  1SHF A;  1AWO A;  2ABL A;  1WXU A;  4AFS C;  2J7I A;  4OMQ A;  2ROL A;  3NPF A;  1B07 A;  1JXM A;  2DNU A;  2HDA A;  2YDL A;  1M30 A;  1RI9 A;  2EPD A;  3VS5 A;  1M3B A;  1CKA A;  1HSQ A;  3VS7 A;  3PE0 A;  2OI3 A;  1NYF A;  1NEB A;  5IHI A;  1NG2 A;  1UEC A;  1RLP C;  3H0I A;  2C0O A;  4KRT A;  1PHT A;  1T0J A;  1X27 A;  2X3X D;  2DVJ A;  2DL4 A;  3O5Z A;  5IHN A;  2O9S A;  3TSZ A;  2JS2 A;  2H8H A;  2DX1 A;  3RNJ A;  2PTK A;  1AWX A;  2PZ1 A;  1K76 A;  2JW4 A;  4RTX A;  2GGR A;  1EFN A;  1TG0 A;  4D8D A;  2DIL A;  4CC3 A;  1UJ0 A;  1A0N B;  3UA6 A;  2DL3 A;  4DEY A;  4LE9 A;  4LN2 A;  1KFZ A;  2K79 A;  2W0Z A;  2W10 A;  2IIM A;  3ZL7 C;  3IQL A;  1W1F A;  1VYU A;  2F2X A;  5IHK A;  1SPK A;  2V1Q A;  4F14 A;  2SRC A;  4Z8A A;  1SRL A;  2JXB A;  4IIM A;  2RQU A;  2M51 A;  3VRZ A;  2K3B A;  1PKT A;  1UFF A;  1V1C A;  2LQW A;  1G83 A;  2YUQ A;  3UAT A;  2DBK A;  4J9G A;  3THK A;  1Z9Z A;  2J6K A;  4RTV A;  2M0Y A;  1OEB A;  3I35 A;  1ZSG A;  2XMF A;  2ESW A;  2JS0 A;  2X3W D;  1JQQ A;  2C0T A;  4J9I A;  5I11 A;  2D8H A;  2L3S A;  1AZE A;  1WDX A;  2O31 A;  1PRM C;  1WLP B;  1Y0M A;  2CT4 A;  2DLP A;  4CC4 B;  2O88 A;  3VS3 A;  1AOJ A;  3VS2 A;  4RTY A;  4JJB A;  2HCK A;  1SEM A;  4JZ4 A;  1K1Z A;  1ZLM A;  1E7O A;  4HVU A;  1NEG A;  2LMJ A;  2ECZ A;  3KFV A;  1J3T A;  2LJ3 A;  1WFW A;  3QWY A;  1ZBJ A;  2AK5 A;  5GJV B;  1UTI A;  1WA7 A;  1VYV A;  1X6G A;  1OOT A;  2KNB B;  1I1J A;  1CKB A;  1M8M A;  2A37 A;  1FMK A;  2HBW A;  1X69 A;  3NGP A;  5I22 A;  1M27 C;  1NLO C;  4QT7 A;  1JO8 A;  1YCS B;  2JMC A;  2CSI A;  4J9E A;  2GBQ A;  1X2Q A;  2LX7 A;  2J06 A;  1H8K A;  4DEX A;  2A36 A;  1RLQ C;  2FPE A;  3H0H A;  1JEG A;  3M0T A;  1UHF A;  1BU1 A;  2LQN A;  5HCK A;  2BTT A;  2CUB A;  2JM9 A;  2BZX A;  2GTJ A;  4GBQ A;  4OMP A;  1ZUU A;  1QCF A;  1H3H A;  2JT4 A;  4R0K A;  2D1X A;  3NMZ C;  2MIO A;  2RNA A;  4EIK A;  1G2B A;  1BB9 A;  1M3C A;  2OAW A;  4JZ3 A;  2CUD A;  5FWC A;  3PVL A;  2KRS A;  1K4U S;  2RQR A;  1Y57 A;  2D0N A;  2VVK A;  2KYM A;  1JU5 C;  2MCN A;  3EGU A;  1I0C A;  1K0S A;  1M3A A;  1QKX A;  2RMO A;  2FO0 A;  4Z88 A;  3RBB B;  1I07 A;  2DMO A;  1JXO A;  4J9C A;  4ESR A;  3TSW A;  1K0X A;  4LNP A;  2KRN A;  3M0R A;  2YUP A;  4D8K A;  1HJD A;  2O2O A;  1MV3 A;  3I5S A;  1ARK A;  1ZUY A;  2L0A A;  2MOX A;  2CT3 A;  1WX6 A;  2EBP A;  2J6O A;  3REA B;  2DF6 A;  2DL8 A;  2C0I A;  4CC7 A;  2L3Q A;  5GJW B;  2YSQ A;  1QLY A;  1WI7 A;  2RQV A;  4RTT A;  1E6G A;  2RN8 A;  3ULR B;  2JMA A;  4AFQ C;  2EYX A;  2JM8 A;  2DM1 A;  4ORZ A;  1K9A A;  1T3L A;  4RTZ A;  1UJY A;  2P4R A;  2ENM A;  1BK2 A;  2A28 A;  5EC7 A;  1HD3 A;  1GCQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...