2RF9A

Crystal structure of the complex between the egfr kinase domain and a mig6 peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
285
structure length
280
Chain Sequence
PNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inhibition of the EGF receptor by binding of MIG6 to an activating kinase domain interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Epidermal growth factor receptor
total genus 65
structure length 280
sequence length 285
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2rf9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2rf9A01
4WG4A 1WBVA 5ETAA 2XK4A 3TZ7A 4E6CA 3Q9YA 3COKA 5IU2A 5A4CA 4TYIA 4AT3A 4IC8A 1GIJA 5BVFA 2Y9QA 3VBTA 4AGWA 4AOIA 4AXAA 1XBCA 3DBDA 3R83A 3W2SA 4EBWA 2ITNA 3EKNA 3R8VA 4YTFA 2PMOX 3OY3A 1Q3DA 2JLDA 3DK6A 2ZV7A 3FE3A 3LJ2A 1CMKE 3SW4A 3WIGA 3D9VA 5HNBA 5T3QA 3R7EA 4MWIA 3U8WA 3ZFYA 2HY0A 3HMOA 3PIXA 4FSUA 5A46A 1W84A 5AP3A 5HTCA 4JG7A 3WBLA 4XV9A 4E4NA 2C3IB 4UB7A 5AJQA 3O2MA 2VV9A 4IJPA 5JSMA 4O0RA 3VS3A 4G6LA 1BYGA 4F7LA 3CCNA 1PMNA 2R3OA 3VBYA 4XNEA 3KCKA 3BYMA 1ATPE 5E9EA 2UZUE 2PK9A 3P9JA 5HIEA 3IW6A 4WUAA 3Q9XA 1H01A 3MFSA 4OT5A 3V5QA 3NNXA 3ZS5A 4ANOA 5J9YA 1G8AA 4DEHA 2P0CA 3C4FA 1U5RA 2PVKA 3MIAA 4MQ2A 4QYFA 4RIYB 5FRIA 3Q4CA 4IB0A 4ASXA 3KL8A 4GW8A 1SVHA 2B54A 3QLGA 3WYYA 4ALUA 5C4KA 2UZTA 3A8WA 5B0XA 4I4EA 5F20A 4X2KA 3BIZA 2IVUA 3BE9A 3E7OA 4PL5A 5AP0A 4F4PA 3JVSA 3OWKA 4GKHA 4C2WA 3HP2A 4IXPA 1ZOGA 3R7VA 4AF3A 1Y6BA 4RJ3A 4MXCA 3BHVA 3L8VA 5D7AA 3D5WA 3POZA 5CTPA 4PWNA 4GYGA 4OTRA 4QT1A 3HV3A 4GK2A 3GNIB 5HD4A 5DR6A 5EFQA 4J96A 4YHFA 3RAIA 4GKIA 1JOWB 4GG7A 4V05A 5HCXA 2G01A 3ZM4A 2WTCA 4J53A 3S4QA 4XEYA 4U40A 2B55A 4ZIMA 2I1MA 1SNUA 2OI4X 3ORPA 4ZY6A 2DWBA 1JSVA 5CVFA 4RA4A 3DXQA 3A62A 1GZNA 3VS6A 2ITPA 3ZSIA 3DXPA 2VZ6A 3WZJA 3SA0A 2A4LA 5M09A 1OIQA 4NU1A 2GHMA 1ZYDA 4J1RA 5CQWA 2CDZA 3GBZA 2QU6A 4WBBB 2C0OA 3ROYA 3I6UA 4DEGA 3QTIA 2R5TA 3CE3A 3NUAA 4AN2A 2BIKB 2YIYA 4S32A 4TWCA 4C35A 3L9MA 2YLFA 3E5AA 4MBJA 3KGAA 4AW2A 4HZRA 3V5JA 4IZ5A 4Y46A 4RA5A 1M17A 5GIPE 2BFXA 3AC5A 3MH1A 2VTAA 5CEQA 3HZTA 3NUXA 4NM0A 3MPTA 4AZTA 4DGOA 4FKUA 2Z8CA 5H9BA 4YSMA 3T3UA 2PVHA 4IX3A 2WB8A 3ZUUA 5DRDA 5D10A 4IX6A 3ZCLA 4E4MA 4NEUA 3HA8A 4RIYA 4H3PA 3F9NA 3WF6A 2JFLA 5HLNA 4LRJA 3BU5A 2WTVA 4ZSEA 3ZC5A 3H3CA 3MGYA 3EN6A 4BWKA 4K18A 2F7XE 2W5BA 2XIYA 3EQDA 3I6WA 5BMSA 2Z7SA 4C4FA 4GS6A 1PY5A 2QLQA 4MF0A 5HEZA 5BYYA 4JVGA 2Q0NA 5IA2A 3AC4A 3KMWA 3KXXA 5AV3A 2ITVA 1JBPE 3BHTA 4DFBA 3GU4A 3I0QA 1IA9A 3PWDA 2XF0A 3NUSA 3BELA 4N6YA 4DTKA 4JG8A 3RWPA 5IQHA 3S3IA 3P23A 5BVDA 4D4VA 4W4WA 2Y8OA 3TM0A 3V51A 3CC6A 3P1AA 5JH6A 5IA0A 5KHWA 2BAJA 2V55A 1G8SA 4WRSA 2VO6A 4JI9A 4YHTA 3R7UA 4WNMA 4FSQA 5EI6A 4XLIA 5CU3A 4CT1A 3LLAA 4CG8A 3ENMA 3ERKA 5HIBA 2E9VA 4WO5A 2RFEA 2G2FA 1I44A 3OWPA 4CFVA 3NEWA 5A9UA 3LFEA 4BCHA 1NVSA 4PDPA 4YBJA 4H1MA 5DEYA 5J87A 3UQFA 4NKAA 1OIUA 3ET7A 2LGCA 3QQGA 4FNYA 1OPLA 5KMNA 5CF6A 4O7VA 3FMMA 4AACA 3GQLA 2CMWA 2YN8A 3W55A 1JKKA 2BRGA 4O86A 1Y91A 3LJ1A 3QRKA 4I92A 4QMUA 1YWRA 3LZBA 2QOKA 4D0WA 3DOGA 5A4LA 2XP2A 4GCJA 3AOXA 5HGIA 4FKRA 5M4UA 2VO0A 2ITWA 3VRZA 2I40A 4NIFA 2YCFA 1MRYA 3OOMA 3WF8A 5CALA 5ANEA 3H9RA 3BBTB 5DPVA 4RWLA 4FTIA 5JKGA 5AUUA 4RBLA 4GFGA 4TWOA 3QYZA 3NCGA 5B2MA 3SV0A 5KBRA 2C47A 4I1ZA 3NZ0A 3A61A 2UZBA 2CKEA 5CY3A 4UN0C 5BVEA 4DITA 5BUIA 5HKMA 5EH0A 1WBNA 4FKIA 4LMUA 1TQIA 4WT6A 2CHLA 4USFA 4E5BA 3VS5A 3R9OA 3CBLA 5LCKA 4JOAA 4ACCA 5EG3A 5ANIA 4Y8DA 3ZEWA 4U45A 5I9XA 5E92A 4KRCA 4BYIA 3HRCA 1H1RA 3MIYA 1Q8WA 4DA5A 4PPAA 5HESA 1YXXA 2R4BA 3EYHA 1GAGA 3PXRA 4FV2A 4UY9A 5CU4A 5CXHA 4FTAA 3NYNA 4FTNA 5EK7A 4NFNA 3QCXA 2UW9A 5GINE 4NL0A 3OROA 1IR3A 3EOCA 1SM2A 2GTNA 3CPBA 5LVOA 1K2PA 3MTFA 3EQFA 1PXLA 3FKOA 3HMNA 5T68A 1IEPA 1KV2A 5KZIA 4LGHA 4ZY4A 5LVLA 4U97A 4JL9A 4JDIA 4KBCA 3TJDA 4D2TA 3LFCA 3UMXA 2YJSA 5M53A 2W1DA 4DEEA 3OY1A 4M12A 3SXRA 1PXOA 2VX1A 5K0XA 1L3RE 3ZLSA 2C5VA 2JKOA 3QKMA 4BZNA 3DV3A 3DBCA 2A0CX 2XK9A 2YM5A 2GMXA 4FV9A 3V5PA 4BKYA 4DBXA 2IW8A 5KHXA 3RHXA 3E8EA 4TYHB 1IA8A 3LQ5A 1YI6A 4OTHA 3Q4ZA 4CCUA 4D28A 3WI6A 3EIDA 1FINA 2R3NA 2BTSA 3M2WA 4NIFB 4EH3A 3I4BA 2OXYA 2YISA 1DAWA 4H3QA 3Q2JA 2PZRA 1YI4A 1OI9A 4J8MA 3ULIA 5HNIX 3FLWA 4B6LA 4F0FA 4LYNA 3GCPA 1JVPP 4I23A 3MVLA 4O0TA 3RNIA 5LVNA 4YJOA 3NX8A 4TY1A 4XLVA 4A7CA 5HNGA 2JITA 4APCA 2W96B 3PJ8A 3QA8A 4EOPA 4RIXB 4FKVA 3V5LA 3B8RA 3IO7A 5TO8A 1V0OA 3DLZA 3AD6A 1OL2A 3MDYA 4QQ5A 5I3RA 5JZNA 4M0YA 4RWIA 5D12A 5BMMA 4FKTA 4JR7A 4P7EA 4RJ8A 2FUMA 2PZPA 5T6KA 3QX2A 4EH5A 5IUGA 4QQTA 5E8ZA 2ZB1A 1OM1A 4JIKA 2V5QA 4U9AA 4ACDA 3IONA 4GG5A 5CAVA 5IQGA 2HZNA 2BDFA 3C13A 2HELA 2JDVA 4AS0A 3DY7A 4B0GA 1S9JA 4QYEA 4AU8A 4X6RA 4OAVB 1M7QA 3BHYA 5EW8A 4IZ7A 1T45A 3R73A 1Q5KA 1OVEA 5LVMA 5C26A 3F88A 2FSMX 5M57A 4ZSJA 4YO6A 4N70A 2B1PA 2FYSA 3RAHA 2QLUA 1F5QA 3G6GA 3UJGA 3VIDA 4M68A 5H8GA 4E26A 5IISA 4EYMA 3R22A 5IEYA 4GFOA 4FT9A 5HU3A 5JGDA 3N4UA 2UZLA 3C4WA 3Q96A 4GIHA 4IDTA 4HPTE 3REPA 4R7BA 3DAJA 4BZDA 3OXTA 3IW8A 3NW7A 3QGWA 3OT3A 3EH9A 1GIIA 3F7WA 4JQ8A 3RK7A 3UVQA 3ZZWA 1G5SA 1M2QA 4WA9A 1Q41A 3MWUA 4KBAA 3H9OA 4FIHA 2ETKA 4CFUA 1AD5A 5ANJA 2OF4A 2VWXA 4IZAA 4NKSA 4E6AA 2C6EA 4LV5A 3S95A 4X2GA 3NVMB 3F2AA 5DR9A 2R3LA 2QR7A 4O0SA 3DQXA 3VS0A 1Q62A 3GUBA 3AQVA 2WTWA 3UVRA 3LXLA 3UPXA 4QNYA 5LWMA 1YDTE 5CT7A 3DBEA 3PPKA 3W2RA 3HYHA 3RTPA 5EHYA 4LRMA 5BUEA 1GZ8A 2JDRA 4QMXA 4D2PA 4YURA 4HPUE 3UQCA 5LMAA 3P08A 3PWYA 4EZ7A 4J7BA 4MNEB 2WMBA 4YZMA 5FM3A 3UGCA 5IH4A 5AP2A 4EI4A 3KK9A 3VBVA 5A54A 4P5ZA 4RIXA 2P4IA 4OTPA 3R9HA 3U55A 2GNFA 2R3GA 2UZVA 3KXHA 5CF8A 3FZTA 5M4FA 4IWOA 4RRVA 1BMKA 5CENA 3BCEA 3O96A 1UWJA 3CEKA 3W2QA 5IEVA 5K5NA 4U43A 4FTTA 2IG7A 2ITQA 3ITZA 2W99B 5CAPA 1OKWA 1CKPA 2HWPA 4IB3A 2QHMA 4BGGA 5EYCA 2W1EA 4FT3A 4CTBA 2VWZA 5AUZA 4U7ZA 3R00A 5CF5A 2OW3A 3RI1A 5AIRA 3A99A 3ZRMA 5KZ0A 3QRIA 4D55A 4FL2A 5A3XA 3QXOA 4F6UA 2W7XA 1H0VA 2WPAA 1RQQA 3PG1A 4XRJA 2X7FA 5ICPA 4RQVA 4R1VA 4LG4A 3TTJA 4DFLA 4BCIA 4ZK5A 3MYGA 3NW6A 4CG9A 3I60A 3IOKA 4IADA 5EI2A 4HVGA 4PRJA 4KB8A 4S2ZA 1DAYA 4QP4A 1UWHA 5EOBA 3CP9A 3B2WA 4Q5EA 4O7NA 2C6IA 4BIEA 4IQ6A 5G1XA 4AZFA 4EK3A 4BYJA 5FUTA 5KNJA 2R7BA 2JIIA 4XHKB 4C36A 3VHKA 4U42A 3EQIA 4QTBA 4C4HA 1O6YA 4FSTA 5IKWA 3W18A 4D9TA 4FYOA 4N6ZA 1VYZA 3H0YA 4NH1A 4XCUA 5EDPA 5IEXA 3CGOA 2UZEA 2XB7A 4MEDA 1PKGA 4BCQA 4FSNA 2R3QA 3Q9WA 1R0EA 3RCJA 3QQJA 4ID7A 3FMHA 4JG6A 4F6WA 4HGLA 5EW9A 5GZ8A 5GZAA 4PTGA 5EYDA 2UW6A 1J7IA 3ALNA 3FV8A 1V1KA 4FTMA 3MS9A 3F5XA 2JBPA 4HCVA 3N9XA 4Y5QA 1KE9A 2X8IA 2FSOX 4DTAA 4AZVA 3TEIA 3DZOA 3CKXA 3GCQA 3QUDA 2PE2A 2WZJA 4MNEA 3WILA 1YHVA 4PF4A 1PMUA 1AQ1A 4FKSA 2O64A 2OF2A 4Y83A 2OH0E 2RFNA 3F3VA 4I21A 3R1QA 4QMNA 4JS8A 2W5AA 4O96A 4FZDB 3V6RA 3FSFA 2O3PA 5BQ0A 3TNIA 2B52A 4XX9A 2J90A 4IAAA 3QQKA 3RM6A 5FDPA 3KRJA 4I5MA 4XV3A 5JRQA 2C6OA 1ZRZA 2QG7A 2Z7QA 3AGMA 5I9VA 5BVKA 3G2FA 4M3QA 3OCBA 3DKGA 1BLXA 3R21A 5IQEA 3UOHA 4Y5HA 4M69A 2CGUA 2QURA 5JFVA 4IX4A 4O7TA 2QR8A 2VWWA 3Q53A 2BAQA 3S1HA 5CU0A 3W2CA 1CTPE 5M44A 4EKLA 3LCOA 2P3GX 5IH6A 3RKBA 2BILB 3FYJX 4B9DA 4GMYA 3BE2A 3QC4A 3HUCA 4YO4A 5HD7A 4RPVA 2UV2A 2QKWB 3NSZA 2UZDA 2ACXA 2GTMA 4EWHA 2J2IB 4GUBA 1X8BA 4C4GA 2ITOA 2ZOQA 2XA4A 4FEQA 4DEBA 4RSSA 1H0WA 3QD4A 5F95A 2XNBA 4O91A 5DEWA 3NS9A 4OBOA 4WNOA 3CXWA 3MN3A 3TV7A 3DZQA 1Y8GA 1VJYA 2UVYA 3O8PA 2CKOA 4A9TA 4BDAA 1ZWSA 3L1SA 2BKZA 1ND4A 1JLUE 3IW4A 3KRWA 4X7QA 3T9TA 1GNGA 2PMLX 5GJDA 4CVAA 2Y4IC 4G6OA 2CKQA 4BCJA 3ZH8A 3FLQA 4HOKA 4IAYA 4UV0A 3PLAE 3QTWA 2C6LA 3CIKA 4NJ3A 5DHJA 4FV8A 4G3FA 4TPTA 2B9JA 3ZEPA 4C3FA 5H3QA 1OL7A 4CEGA 4NUSA 4FC0A 4FICA 5FBOA 4UZHA 3FDNA 3FMDA 3KKVA 3R9DA 4D1SA 4XUFA 5DYJA 3R6XA 4C4IA 1JKTA 2VTPA 3FKLA 1KWPA 5FEQA 4KS8A 3KXGA 4NCTA 3SX9A 1KE6A 3F3UA 4HVDA 3FJQE 3OG7A 1U46A 2GNLA 3IGGA 4EL9A 5HORA 3G15A 3S2PA 1FVVA 3E64A 5EQYA 5DT3A 4CLIA 4E5AX 4M69B 3U9CA 2R2PA 4C62A 2J7TA 4ZTLA 4Z7HA 4JX7A 3UNZA 1CKIA 4G6NA 1XJDA 5CVGA 3S0OA 4M14A 3KA0A 5FEDA 3EYGA 4IB1A 3TL8A 2CCIA 3LOKA 4D9UA 3A7JA 3D5VA 2C3JA 4ANNA 1Q24A 3VAPA 4A06A 4K9YA 4A9UA 2PVNA 3VS7A 4H05A 4UBAA 4ZEGA 4D2WA 4QMPA 5J5TA 3QXPA 2BZHB 2XJ0A 2EXCX 2DYLA 3DT1A 2W1ZA 5LMKC 1U59A 3KXNA 4FL1A 4EOQA 4ZTQA 1Q4LA 2WU6A 3NNVA 4FTQA 4R7IA 4PDYA 2XNMA 3BU3A 3AC2A 3PUPA 5K0KA 3L9NA 3CQWA 1XHAA 3MY1A 3MH0A 4BF2A 4FV0A 3V8TA 3F3ZA 3JPVA 4YTCA 4FTRA 1LEZA 3TKHA 5FWKK 3BLRA 3BQCA 4HGEA 1H1SA 3FI4A 3SOCA 2GQRA 3ZO1A 4E4LA 3U9NA 5A6OA 4DG2E 3IECA 5AX9A 3ZBFA 4K77A 2OXDA 2IZUA 4GT3A 3WZEA 4E4XA 4GH2A 4FIIA 4FTKA 5CSVA 4C8BA 3Q32A 2JKMA 5KMKA 3PG3A 5IQDA 2RKUA 3QTUA 2JC6A 5HIDA 5HO6A 2W1IA 3CSVA 5DH3A 2XEZA 3MPMA 3DJ7A 3IPHA 3P78A 5ANGA 1JQHA 2XKCA 4C7TA 3HV4A 5CU2A 3QBNA 4IANA 4S34A 4MXAA 3E3BX 3U87A 4TZRA 2V7AA 1H25A 1YHWA 3GP0A 3FI8A 1YW2A 2WO6A 2Y6OA 4LGDA 5E1EA 1KE7A 2H96A 3OMVA 3LM0A 3VS2A 4M97A 4ASZA 4AP7A 5IH5A 4PX6A 3OBJA 3MH3A 3NCZA 3VBXA 4QPAA 4ZSAA 3L8SA 3T8OA 1I09A 1V0BA 4J71A 3SRVB 5K4IA 3Q52A 5L6PA 3QYWA 5FBNC 3DJ6A 4EQCA 2GSFA 4KABA 4EOLA 2EWAA 2XKEA 3O8TA 5D7VA 3TT0A 4EWQA 2G15A 4RT7A 4E7WA 3DDQA 4L52A 4RVTA 4KRDA 3VBWA 3DXNA 4FZAB 3DJ5A 2P2HA 1TQMA 3SXFA 4U8ZA 4WSQA 5FEEA 4ENXA 3CPCA 4IVAA 3R71A 3AT2A 4L3PA 3QRJA 3OXIA 4HVIA 4Z55A 4DF3A 4NM3A 3RCDA 4FV6A 3QZFA 4GK4A 5DG5A 4DT9A 2OKRA 4BCFA 4EZ5A 3EQGA 3HAVA 4FKGA 3KMUA 4UWYA 4O83A 4BTKA 3U4UA 5ETFA 4XG8A 5DOSA 5CF4A 4GJ3A 2YIWA 5AADA 5L4QA 4QD6A 2V22A 3UPZA 3VBQA 3BV3A 4D0XA 2I0HA 4BHNA 4V01A 3LFQA 2WU7A 3ACKA 3PYYA 3OVVA 4DFZE 2J50A 4BFMA 4BDDA 3B2TA 4CFNA 1GY3A 5EOLA 1KV1A 5L2IA 3FC1X 1W83A 2V0DA 4ZAUA 3FI2A 1WBPA 3MSSA 5CNNA 4BB4A 5DT4A 3ZXZA 3DB8A 1QL6A 2CGXA 4YNOA 2QVSE 4NW6A 2OJ9A 3B8QA 3TDWA 4Q2AA 4MKCA 2OH4A 5J1WA 2OIBA 4BCPA 2YCSA 1FMKA 3W32A 4EOOA 2BUJA 4PDSA 2X8EA 4FV1A 3MI9A 4X2JA 3UG1A 2YWVA 5AUTA 3E93A 4QMTA 3NDMA 4BIBA 3W2OA 3SRVA 3VUKA 4M67A 4MD9E 3FZRA 3DTCA 3KXZA 3Q2MA 4FZFB 3FZPA 3UBDA 5C03A 4F0GA 3D5XA 4YHJA 1FBNA 4FNZA 4KUJA 2C3LA 2W5HA 4EZ3A 4KIKA 4YU2A 4FTLA 3VS4A 4F0IA 3PXQA 4RX5A 3R30A 3PE1A 4ZP5A 5IUIA 2ZMCA 2OXXA 3N51A 2GU8A 5FLFA 3FY2A 3THBA 3G0FA 3HMIA 3R2YA 2YIXA 2DUVA 4WUNA 4MCVA 3QKKA 3UQGA 3EN9A 4YR8A 2X7OA 3D83A 1ERKA 5DIAA 1NT2A 4S30A 4AAAA 2C1AA 4CNHA 2YAKA 2PVRA 5M4IA 3OZ6A 2YDJA 4JXFA 3BHUA 3VUDA 4NT4A 4CYJA 3ZO2A 4ZY5A 3H0ZA 4CMTA 2C6DA 2KULA 3OBGA 4FIGA 5IUHA 1YQJA 4I6FA 4DINA 5CXZA 4V0GA 4E6DA 5LVPA 3QQHA 3UODA 2P33A 2PE1A 3G33A 3C0IA 4FVRA 3TV4A 4O7ZA 4X3FC 1REKA 2PUPA 4FEWA 2X0GA 3DS6A 3VUGA 1UU8A 1ZYLA 3FHIA 3PJ1A 3KQ7A 2W9ZB 3HVCA 4W4XA 4X0MA 5J1VA 2VO7A 2WEIA 1P2AA 3PRFA 4PNKA 2WQMA 4RJ4A 4I6HA 4G3CA 4M0ZA 4ZZOA 4LQMA 1XR1A 2OJFE 2R3IA 3IDBA 3FQHA 4PP7A 3H30A 4RJ7A 3QD2B 4ACHA 4A07A 2XYUA 4L01A 1PF8A 4RVLA 4FKQA 4FE2A 3F61A 3T9IA 3AC8A 4K2RA 2JDOA 4NW5A 3JS2A 3C4ZA 2XIKA 4L44A 3PJ2A 4BDGA 5DVRA 4ENYA 1OL1A 2GQGA 2V7OA 2IVSA 3OCSA 3P5KA 4FT5A 3HL7A 4BCKA 1H1PA 3EWHA 4GFMA 4YJTA 1XH4A 2I0VA 4FG9A 1JNKA 4I5HA 5FP5A 3UOLA 3F69A 3GGFA 1PMVA 1ZYCA 5IA5A 3TIZA 2OWBA 4ITIA 4ANQA 3UO6A 2C4GA 4M8TA 5M56A 5DFPA 5AUVA 5DBXA 1ZYSA 2IZSA 3PIZA 4G31A 3DK3A 4PMPA 5KX8A 4Z7GA 5HG8A 3Q3BA 1YVJA 4YJVA 3QZHA 1OUKA 3HMMA 1M52A 4KKGA 4I5PA 3V8SA 1A06A 1UU7A 1T46A 3D7TA 3VC4A 4AN3A 1J91A 3PVGA 3PXKA 1OITA 2YAAA 4L8MA 3ZRKA 5E91A 4YJNA 2JKKA 3DDPA 2R3KA 4RFYA 4FOCA 4WKQA 5IA3A 5IPJA 4D4RA 5KMMA 4TTHB 3MA6A 4C34A 3O7LB 4C37A 3LHJA 1OZ1A 2PVYA 3CTQA 2ITUA 1Q8TA 2LAVA 3FXWA 3QQFA 3UE4A 3VJNA 4FEUA 1XH6A 2O5KA 5LARA 2YWPA 4I0RA 2C69A 4G5JA 4HNFA 5IMEA 4AZWA 5KMLA 4ACGA 4HNIA 3DKCA 1WBSA 2PVLA 2PL0A 3QTZA 4RX9A 3LPBA 4OLIA 4ZTHA 1YDRE 4G16A 4G3GA 3PSCA 3DFAA 1UVRA 3PLSA 4DCEA 4B8MA 2W9FB 4IZYA 2GNGA 1A9UA 5I9UA 3UG2A 4BDJA 3V5WA 5EKOA 2QO2A 4QMMA 4YLJA 4FV3A 1YWVA 3DAEA 1URCA 4NM7A 3SW7A 5M4CA 4CCBA 3TDVA 3E8CA 3Q6WA 4QMYA 4RFMA 4AN9A 1SVGA 2UW8A 1PXMA 3SG8A 2IW6A 4J97A 4R5SA 3QF9A 3EQHA 2WMQA 4FGRA 3DFCB 3F66A 4D1XA 5EQEA 1APME 4QTEA 1NY3A 2EUFB 1U54B 3F5GA 3FWQA 4HCTA 4YTIA 4J98A 1H1QA 2QOHA 3GC8A 3KK8A 3ANQA 3QFVA 1YI3A 4IM0A 3DBQA 4OTWA 3ZLXA 2XIXA 3PY0A 3LFFA 3PTGA 5AV4A 2GNJA 3TNPC 3VNTA 3R9RA 4BTMA 5ETCA 1QCFA 2X6EA 3SVVA 3TUBA 2YM4A 2QCSA 4R5YA 2VTTA 3CQEA 5I3OA 4A9SA 2HENA 3GC9A 4U0IA 1ZXEA 5DMZA 3LQ8A 3BGQA 2YCRA 1PXIA 2WTJA 4MXZA 3COIA 4JRNA 2XM8A 3ZDUA 3MTLA 2IW9A 5IMXA 3LMIA 2XBAA 3UOJA 2UUEA 5AM6A 4XH6A 3PA3A 4NFMA 2JDTA 4W9XA 5AP7A 3GOKA 3KRRA 3PVWA 4KWPA 4RGJA 4Y85A 4FV4A 4YZNA 3LFAA 4BTJA 3P7BA 2VAGA 4D4YA 4QP7A 4QP1A 4IDVA 3QZIA 2OJJA 2PY3A 2X4FA 4R3PA 4TYEA 4IWQA 4L9IA 2YLEA 4DEAA 5HVKA 5IQBA 3N4VA 3QUPA 4PPBA 2WMWA 4CZTA 3W1FA 4ZLOA 2AUHA 2BCJA 3LIJA 3HECA 5FQDC 2VGOA 2ZM3A 3DKOA 4MNFA 4BRXA 2PU8A 2OFVA 3LFBA 3O71A 4HYHA 1Q61A 3HV7A 2WAJA 4C0TA 2WMSA 4AE6A 2WKMA 2J0JA 3P7AA 3E63A 3MFRA 5FG8A 5TF9A 2AC5A 2I0YA 4YZDA 3LCKA 4MH7A 4FT0A 4E20A 3FPQA 1PXKA 2QO9A 4AG8A 3EB0A 5HVYA 2OFUA 1DS5A 3NUPA 5HE3A 2UW5A 2R64A 3EQRA 3QZGA 2JFMA 2X2MA 4G17A 2C5XA 1B38A 4EOIA 1H8FA 1YKRA 4LOPA 1XH9A 4FV5A 4OTFA 4O82A 4EQMA 4YZ9A 2ITYA 3IKAA 2R3PA 3E62A 3PXZA 4FV7A 4CSVA 3A60A 3QCQA 4BDBA 1R78A 2R9SA 4G5PA 3QQUA 3LMGA 4PQNA 3HP5A 5CLPA 3G5DA 4ZOGA 4FEVA 1BI8A 2HWOA 4K0YA 1ZMUA 2NP8A 1QPDA 4MYGA 2NNWB 2ZYBA 3FXXA 2R3RA 2FO0A 4L46A 4FKJA 4RMZA 2X2LA 3UNKA 4BI0A 5HBHA 3BU6A 4I0TA 4IEBA 1JSUA 5HCYA 2WOTA 2B0QA 4LM5A 3FLSA 4RX7A 4BCOA 5EYKA 4F9WA 3UIMA 2VTIA 3UC4A 1KE5A 2Y0AA 4M66A 3MA3A 3U51A 4R7HA 4LI5A 5C4LA 3OTUA 1IASA 2X4ZA 5TR6A 4MD8E 4AZEA 3C0HA 3BWFA 1ZOHA 3MV5A 5GHVA 3QTQA 4Y73A 5JQ5A 1Q8UA 2J0KA 1H1WA 2ETMA 4OTGA 4RIWB 2Z02A 2H34A 1JWHA 4NSTA 4QP8A 3EFJA 4QYYA 3EKKA 2X7GA 2RIOA 2GNIA 2YITA 3GC0A 3QWJA 5F9EA 3U6IA 4ORKA 1XH5A 3CKWA 2XJ1A 5A6NA 4YPDA 2XIRA 4KIQA 3MB7A 1SNXA 4H39A 2BIYA 2NO3A 2WTIA 4BI1A 5I5ZA 1OGUA 5ETIA 3W2PA 2WOUA 3COMA 4O7LA 1FQ1B 4DGLC 3VVHA 4P90A 3GU7A 2RF9A 3PVBA 4BL1A 3VUMA 4IMYA 2BFYA 3OW4A 5CI6A 4WNKA 1UKIA 5AX3A 3HMPA 3MFTA 4LUDA 3KULA 2C1BA 2NRYA 4O81A 3ODZX 3W33A 4DH5A 5J79A 1QPEA 2HAKA 4QPSA 5HG9A 3OUKA 4UEUA 3KF4A 4IE9A 4C02A 5LOHA 2VTHA 4EBVA 4E93A 4Y95A 5DR2A 1XWSA 3DKFA 4QMLA 4IM2A 1XH7A 4HYSA 4BDCA 4ERKA 2CLXA 1O6LA 4DH1A 4EH8A 2QOBA 3IDPA 3A7IA 4L43A 2PUIA 2EU9A 3A7FA 3R8MA 5L6OA 4MQ1A 3V04A 3OP5A 4WRGA 3OW3A 5J95A 4MHAA 2QOFA 3DQWA 5AM7A 4EHEA 4D2RA 5E90A 4JBQA 2VRXA 1Y8YA 3C9WA 5FXQA 5LCJA 2BVAA 4RC3A 5HBJA 4KKEA 3DNDA 2J4ZA 2DS1A 4RZVA 3BRBA 5JFWA 1JPAA 3E92A 3NUUA 3WZDA 2QOOA 4Z3VA 2CN8A 4I5CA 2OJIA 2YABA 3EFKA 3GQIA 5C8KA 1RDQE 4LGGA 4AOTA 4FVQA 4YUQA 5E8UA 5L3AA 3SGCA 3QAME 4M84A 2J0LA 1XH8A 1LPUA 3BGZA 4FK6A 2GPHA 4CGAA 5GNKA 3UP7A 4C3PA 4C2VA 2A1AB 4GUEA 4F9YA 2XNOA 5LMKA 4O84A 2E2BA 3L8PA 4HYIA 5JN2A 3ZMMA 4BBFA 2J51A 3VN9A 3VUHA 1J7LA 5KBQA 5E7RA 3IW5A 2HIWA 4DFYA 4C4JA 2W1HA 4ALWA 2QQ7A 3A8XA 2X2KA 3M11A 5H2UA 3UTOA 5EM6A 4KD1A 5ITAA 1ZY4A 3P7CA 3LAUA 3BWJA 3QA0A 4FNWA 4AQCA 4ANSA 4UXLA 1KUTA 4N57A 2XVDA 2EVAA 2I7QA 1YWNA 3QTXA 3D4QA 3MH2A 5JQ8A 4H3BA 1W0XC 2HOGA 3KULB 3OFMA 4XP2A 3ROCA 2ONLC 4PTCA 4RC2A 3RZFA 5ANDA 2UZNA 3C4EA 4AWIA 4ZXTA 2PZIA 5A14A 4QMVA 2X9FA 1CKJA 2XK6A 3LFNA 4E3CA 4MAOA 5CSPA 3BBWA 5AV0A 4WBOA 4IFCA 4KS7A 2VTRA 3O51A 4QQCA 4JLCA 4CZUA 4O7WA 4L3JA 3I1AA 3CR0A 2XMYA 5BVNA 1ZAOA 1PYEA 3KEXA 4O0VA 3EL7A 2HW7A 2F2CB 3I5ZA 4EOKA 3QU0A 4CZYB 1IRKA 3LCTA 2Y7JA 4FX3A 4ZTRA 4IH8A 3QCYA 2YHVA 2XNNA 3BKBA 3A4OX 1GJOA 3QKLA 4CKIA 4O21A 4H58A 1KOAA 4GL9A 4UALA 4A4LA 2BDJA 3FZ1A 2JAMA 3FZSA 5E1SA 3RP9A 4C57A 4EC8A 1NVRA 1W98A 2QC6A 2VD5A 3HV6A 3OEFX 4R1YA 1FMOE 3U6HA 4NZWB 2BZIB 4NK9A 5C27A 2XNGA 4BZOA 5CEPA 3EN7A 4D1ZA 4XG4A 5DLSA 3C4XA 3GENA 4PMTA 5HCZA 4J52A 1OB3A 4FUXA 3FZOA 1GOLA 3R04A 4OTQA 5EYMA 3ZDIA 4FMQA 4MTAA 3WF7A 3DA6A 4BR3A 3FMNA 3BI6A 3DCVA 5GJFA 3TWJA 4FNXA 1G3NA 3CTHA 3LFDA 1NXKA 3HNGA 4O0WA 1K9AA 4AUAA 2YCQA 5CSXA 2VN9A 4F99A 2B9FA 3R7YA 2IJMA 3RWQA 2ZAZA 4BCGA 4JBVA 2W06A 4JBPA 5AA8A 4H1JA 2A19B 2X81A 4CFMA 3UNJA 1HOWA 5D1JA 4DGMA 2ITTA 1OL6A 3PSDA 4FF8A 4WOVA 4DGGA 2OZAB 3ETAA 3BZ3A 3R1SA 5AP6A 4QP3A 1DI8A 4TYJA 4FA2A 3NW5A 5TT7A 3NAYA 4IACA 4YJSA 3ORMA 2ZJWA 4O6LA 1ZYJA 3DGKA 4MXYA 4BN1A 4HVSA 1BL6A 4H36A 1XBBA 1OMWA 2BRMA 4J8NA 2BHHA 5F94A 5HO8A 4UWCA 3VWAA 5J7HA 3GFWA 4B99A 1WBWA 3KN5A 4UYAA 3ZFMA 5CZIA 4FYNA 2F7EE 3MFUA 3NIZA 3UDBA 2WIHA 4FL3A 4O1OA 4FIJA 1VR2A 4C38A 3MBLA 2ERZE 2JDSA 3HA6A 4K6ZA 4YPSA 1P4OA 1STCE 5CI7A 1V0PA 1Z57A 1RE8A 2ERKA 3OT8A 1ZMVA 3TZ9A 3VF8A 4ZTMA 4II5A 2JIUA 4FG8A 2QO7A 2JEDA 5CT0A 4AOJA 1J1CA 2E9UA 2XS0A 5CANA 3TN8A 2O2UA 4RX8A 3HDNA 4XP3A 4HJOA 1J1BA 2F7ZE 5FTGA 5DA3A 5J7BA 3R02A 4GK3A 4APPA 3BYVA 4TT7A 5K9IA 3O0GA 1PW2A 3FMLA 3WF5A 3Q04A 2GS7A 2CN5A 5HOAA 2W4OA 1PRYA 5K3YA 3AD4A 5J5SA 3C4CA 4ZS0A 3VW6A 3S00A 3ORTA 4XG7A 2H9VA 3UVPA 4AGUA 3HX4A 2FH9A 2HZIA 3NGAA 2DQ7X 4C4EA 4CKRA 4QQJA 3TKUA 4RJ5A 3KU2A 2SRCA 3F82A 3EQPA 2G1TA 5TE0A 2O0UA 4AW0A 2JBOA 1OPKA 5CZHA 5JFSA 4TYGA 5L2QA 1UU9A 4AA0A 1L8TA 3ANRA 4CTCA 4U41A 4TRLA 1OBGA 2OZAA 1PMEA 4MF1A 3BPRA 3RAKA 3W8LA 4N0SA 4FT7A 4NJDA 3RPVA 3PRIA 4BGQA 5IQFA 3GCSA 2OZOA 3ATSA 4USDA 4G1WA 3I7CA 5JGBA 3EN4A 4DAWA 4GSBA 3TZMA 2XRUA 4CMOA 1OIRA 3G90X 1FPUA 2WTKB 4BBEA 4XBRA 1H27A 1LP4A 2C0TA 3POOA 4RWJA 3JY9A 3KN6A 1XBAA 3TXOA 3OS3A 1R39A 3UO5A 3ZTXA 3KXMA 4B7TA 5KCVA 5CSHA 4DEIA 3O50A 4PTEA 4P5QA 5I9WA 4FSRA 3UZPA 4IWPA 5HICA 4KAOA 4O7SA 1SVEA 3AXWA 3D5UA 4XRLA 4FBXA 5ANOA 3ZO3A 5K5XA 1HCKA 3NWWA 4RWKA 4EHVA 2RG6A 1QMZA 3PXYA 4YBKA 4AT5A 4ERWA 3QD0A 3QCSA 1O6KA 3C7QA 3D94A 2ZDTA 4GJ2A 4RVMA 3DU8A 2J5FA 2IVVA 1B39A 2B4SB 3Q6UA 1OL5A 4PMMA 4G9CA 4IVBA 1WVWA 3PJCA 4TWPA 4DC2A 5IQAA 2BZJA 3ZO4A 2XM9A 3F2RA 2F2UA 3IQ7A 3P86A 4ZJVA 3HDMA 1BX6A 2J9MA 4GU9A 5CVHA 4DH3A 1IAHA 2VUWA 2E9OA 4CMUA 2XBJA 5EQPA 4HCUA 2FA2A 2PZ5A 4BDEA 5IA1A 2ZM1A 3O23A 2C5YA 3PXFA 4O1PA 4MWHA 3RHKA 2OG8A 4HW7A 1H08A 4KINA 1WZYA 3FMJA 1Z9XA 3IS5A 4DEDA 2ONLA 4F65A 3RNYA 4TWNA 2YFXA 5ANKA 4C58A 2I6LA 2FGIA 3ENHA 1DI9A 5M51A 3U6JA 1Q3WA 2HK5A 3IGOA 4XG6A 3NYXA 5DNRA 2RSVA 3ZFXA 3QLFA 5CEMA 3F5UA 1PXPA 2GHLA 2HY81 3UOKA 3LE6A 3MVJA 3ZUTA 4XJ0A 5AAGA 3VHEA 3BYSA 3KMMA 3P79A 3TTIA 4UYNA 4Q9ZA 4QPMA 2R3MA 5LJJA 3MPAA 4DG3E 1KE8A 2WFYA 5C8NA 5CAUA 3JXWA 5E8WA 4A9YA 4QP9A 4QP6A 4TYHA 5I0BA 2WMVA 2V62A 3H10A 1OIYA 4F7JA 4TXCA 1REJA 1GIHA 2F9GA 5IF1A 4HZSA 2UVZA 4AT4A 1F0QA 1XQZA 2FSTX 2VGPA 3GI3A 1ZZLA 2WMRA 4QYHA 3ORKA 1WAKA 3QUEA 4OBQA 2Z7LA 3R8PA 5IQIA 3AMYA 5FM2A 1YOMA 3F3TA 3RPOA 3IK3A 2OLCA 3FY0A 4CV8A 2WQOA 3Q60A 5FGKA 4AA5A 4QMQA 3UIUA 2QOIA 3EMGA 2WMTA 4R77A 4S31A 2VWBA 2CNUA 3FSKA 1WVXA 3FL4A 3ZZEA 2ZV8A 3JR1A 3BYUA 1BL7A 3LMHA 5AR2A 3QL8A 1AGWA 1BUHA 3C50A 4ZJIA 3R8LA 3Q9ZA 5IDPA 1E9HA 2X6DA 2QOQA 4YNEA 4L7FA 4UZDA 3OXZA 5EKNA 2WIPA 4FTJA 3DAKA 1UKHA 3PJ3A 2I0EA 3CS9A 3OCTA 4BHZA 5D9HA 5CAOA 1J3HA 2CNQA 5JRSA 4WNPA 2C6TA 2IN6A 4CV9A 3SD0A 3D2IA 2Z60A 3ELJA 2W4JA 3RAWA 3Q5ZA 1Q8YA 4GT4A 5HX8A 3LXKA 3BLQA 3II5A 4RVKA 2GFCA 4EK6A 2VTJA 3HLLA 3QRTA 4BCMA 4YMJA 3K5VA 5EM7A 5L8KA 2GQSA 4JQEA 3F3WA 5L6WL 3LJ0A 4TL0A 3RK5A 4F1MA 1ZOEA 1H24A 4GU6A 4JAJA 5J9ZA 2NPQA 2GNHA 2VTSA 3HGKA 3I5NA 3LXPA 5E8VA 1F3MC 4XBUA 4EJ7A 3AGLA 4EH7A 2QONA 5EM8A 4FVPA 4UMQA 5IZFA 2VO3A 5CYIA 3ZSGA 5HX6A 3NIEA 3PA5A 2VWVA 5CNOA 4EHGA 4FTUA 5H8BA 1YOLA 4FSWA 4W4VA 2CPKE 3LW0A 3COHA 3ZBXA 4EK5A 3PVUA 4EUUA 2XH5A 3OTVA 5JGAA 4BY9E 4ASEA 1Q97A 4LL0A 2WQNA 3FLZA 5C01A 2PSQA 2QODA 4W9WA 5C8MA 5KKRC 5HO7A 3OOGA 5DN3A 2FB8A 4M7IA 3QHWA 3VUIA 4BIDA 3MJ1A 1R3CA 5AAEA 2UZWE 2O8YA 4L42A 4FIFA 4RFZA 2HW6A 1K3AA 4XOYA 4AE9A 5AV2A 4ZZNA 5HG7A 2VTQA 2BRBA 2CJMA 2WNTA 5E8YA 3MVMA 3IG7A 4NM5A 3PDTA 4O0YA 4NWMA 5I9ZA 2XK3A 3V6SA 5HBEA 5AV1A 2GS6A 2VTNA 3GCVA 3E8DA 3CD3A 1YRPA 3LM5A 4U79A 3EJ1A 4NTTA 5AFVA 3ZXTA 3LCDA 4TN6A 4EQUA 2RG5A 3TUCA 1PJKA 3TV6A 2YJRA 4KSPA 3EZRA 3O7LD 4YJRA 2IPXA 3LQ3A 1OECA 3SXSA 2R0UA 5AIKA 4F08A 4JIAA 2BAKA 4U6RA 3UIBA 1QPJA 3WYXA 4F64A 3A2CA 3HUBA 1LR4A 3PFQA 3MW1A 3TKIA 3LFSA 1U4DA 4JDJA 4GEOA 4O0UA 1EH4A 3H4JA 4JRVA 3WOWA 3ULZA 4A4XA 4ZS4A 2WQBA 3KVWA 4TW9A 3WZKA 4ANMA 4EH2A 1IAJA 4FKOA 3RINA 4CRLA 5BUJA 3DLSA 5AP4A 4DFUA 4ITHA 5CU6A 1B6CB 4K33A 2WD1A 3R9NA 4E1ZA 4WHZA 1UNLA 2FVDA 5BYLA 5KUPA 3F5PA 5GZ9A 1FGKA 4O22A 2OJGA 1M14A 2YM6A 3GXLA 4IBMA 3W8QA 2P2IA 4FSZA 1OKYA 3HV5A 5M55A 4CRSA 1J7UA 2YACA 4HVHA 2Z2WA 1O9UA 2HCKA 4O0XA 3PP0A 5AEPA 3UZTA 2VWUA 5HTBA 1XKKA 1PYXA 4I94A 3VO3A 4ONAA 1YDSE 4R78A 4W8DA 5DRBA 3Q4UA 5L2SA 4IJ9A 5EHOA 3KCFA 4K1BA 5F4NA 1UNHA 4QOXA 1W7HA 2JD5A 3LLTA 3O8UA 2ZDUA 4JJRA 3BHHA 2ZB0A 2J0MB 3HRBA 4QRCA 2UVXA 5DE2A 2C5NA 3TNQB 2YDKA 3QALE 4AFJA 3AC3A 3FC2A 4EH6A 3RGFA 3NNWA 3R8UA 5HQ0A 3K2LA 4BVUA 2HYYA 1Y57A 2A2AA 4I6QA 4FOBA 2JKQA 2W0JA 1UA2A 3E7VA 3NAXA 4W4YA 4DYMA 5LWNA 3EFWA 3ATTA 3C5IA 1FVRA 1OKZA 3FMKA 4QYGA 3OD6X 3PPZA 4J99A 4YC6A 3UIXA 2UW4A 4F7SA 5CAQA 4G9RA 5A4EA 4N4SA 4QTCA 4QMZA 5HE1A 4FEXA 5BYZA 5HE0A 2AC3A 4TNBA 4XS2A 4L00A 3AD5A 1NVQA 5BNJA 2PUNA 1WBTA 3CY2A 4IC7A 1JKSA 3EQBA 4GV1A 4IVCA 4PP9A 3C1XA 2PVFA 3OEZA 5JMSA 2J6MA 1S9IA 4KKHA 2W05A 2EB2A 1E1VA 3L9PA 5B2LA 4EYJA 2F57A 1R0PA 5E8SA 1GZOA 1UV5A 3SDJA 3WIKA 3W10A 3NVKI 2WELA 3JYAA 2PUUA 3R0TA 4RIOA 2VNWA 2EXEA 2F49A 3TCPA 2YM8A 3RK9A 3FQEA 2UW3A 5EM5A 3SG9A 3Q4TA 1H4LA 3BQRA 3OUNB 4I22A 4KIOA 5CSWA 3VW8A 2PZYA 3W16A 3FL5A 4HGSA 3LVPA 2GFSA 3MVHA 5CEIA 5L8LA 4RC4A 3UP2A 4BWPA 2WMXA 4I20A 2HXQA 3GVUA 3ZHPC 4DLIA 4YJUA 3FUPA 2QNJA 3TUDA 1ZMWA 4MD7E 2QD9A 4FZ6A 3EL8A 4WSYA 2IWIA 5KO1A 1WCCA 3FQSA 3L8XA 1WBOA 4FKPA 3KC3A 3FYKX 4BTFA 4D58A 1CM8A 3FAAA 2HZ0A 2UW7A 1HCLA 3PZHA 4JQ7A 4KSQA 4O2ZA 3FLNC 5AUXA 3R7IA 2JGZA 4BDKA 4CD0A 4EOMA 4BCNA 5JZJA 3TG1A 3MESA 2BDWA 2XRWA 2C0IA 2RFDA 3PIYA 4EC9A 1SZMA 4IAFA 3EFLA 3FXZA 2W17A 4XG3A 3V8WA 1CSNA 2B7AA 3K3IA 3OWJA 4C61A 3MB6A 4B8LA 4JAIA 3AMBA 4OT6A 4X3FB 4R6VA 2GDOA 4S33A 4UXQA 3SLSA 2C68A 2OSCA 3CD8A 3E8NA 4FKLA 3I7BA 2R0IA 5ACKA 5C9CA 3VUTA 4UMRA 3LKMA 3VF9A 4P2KA 2X1NA 3QGYA 5DI1A 3DK7A 3EQCA 4DHFA 2XYNA 4LFIA 4NYEA 4F6SA 4ZMFA 2XKDA 2OU7A 4GT5A 3K54A 4OBPA 1Y6AA 3D2KA 5B2KA 3KREA 3BEAA 4L45A 3UYTA 2Y4IB 4EONA 3FPMA 2PHKA 4DN5A 4EORA 1QPCA 2J0IA 1H26A 4X2FA 4R3RA 4AGDA 2CSNA 1WMKA 3ZRLA 4E8AA 1PXNA 4MX9A 3RJCA 3ZU7A 1MP8A 3FMEA 1GZKA 4BI2A 3QQLA 2EB3A 2BTRA 2BPMA 3KB7A 3NUNA 4XOZA 4OAUC 4FUYA 5IQCA 4X21A 4PV0A 5HLWA 2ESMA 2WMAA 1NW1A 3NPCA 5L2TA 3PPJA 4KIKB 3C51A 4FKWA 4IAIA 4M13A 4U44A 5FTOA 3GEQA 3TNWA 3ZC6A 5FXRA 4AA4A 3SHEA 1ZZ2A 2W4KA 3F7ZA 4DE4A 5EI8A 2XUUA 4YLKA 5L2WA 4MVFA 3CGFA 2ETRA 3R28A 4OTDA 4LMNA 3LCSA 4X3JA 5HE2A 3SOAA 3TACA 3TIYA 1H07A 3ZONA 2YEXA 2HZ4A 3M42A 4MXOA 1FOTA 1SYKA 4UWBA 2HXLA 5EHLA 4EJNA 4I3ZA 1DM2A 3GU8A 5CEKA 3ID6C 3GU5A 3NMUF 3RVGA 5EW3A 4FODA 3IDCA 3NLBA 4CQEA 2VWYA 3PSBA 4AW1A 4MBIA 3D0EA 4LUEA 3G9NA 5HU9A 4AW5A 4DG0E 3ZSHA 2XNEA 2X39A 2C5OA 5HLPA 3A7HA 2JAVA 4FG7A 4FSMA 3PA4A 4JX3A 2WHBA 5FD2A 2YM3A 4X3FA 3JUHA 2REIA 3ZLWA 5L8JA 2P55A 1CDKA 2XNPA 1IG1A 4AX8A 1TVOA 4RZWA 4J95A 2AYPA 3E87A 4E6QA 1A48A 5AUWA 1W82A 3P0MA 4BDIA 1M2RA 1ZLTA 4EH9A 4L68A 1PXJA 4UMTA 2XK8A 1H00A 4TKSA 2WXVA 2XZSA 2ZVAA 2VWIA 3C5UA 2PYWA 5EDQA 3L9LA 2VTMA 4D2VA 2E9NA 4EKKA 4FGBA 2QI8A 4BKJA 3QHRA 2IZRA 2O65A 3RALA 4WG5A 2CNVA 3GOPA 2BR1A 4E5WA 1MUOA 3E88A 3PY3A 1R1WA 4D2SA 4B4LA 3D15A 5KMJA 1TKIA 3KVXA 4D5HA 4DCAA 4I41A 3QTRA 4LOQA 4USEA 4G3EA 4I4FA 3R63A 5KMIA 2BALA 3R7OA 1MQBA 3A7GA 4L6QA 4L67A 4UX9A 3QD3A 3A4PA 4I93A 1ZARA 3WE4A 2UZOA 4R8QA 1KSWA 5G6VA 2BMCA 1YXUA 3MY5A 3ORXA 4ANLA 4F09A 3GC7A 4OR5A 2ITZA 5ACBC 1RJBA 3DB6A 5I9YA 3V5TA 4FTCA 3C0GA 3QC9A 4L7SA 4YJQA 3K5UA 4GRBA 3TI1A 3WZUA 3R01A 3QX4A 3TZ8A 4OGRA 4TNDA 3V3VA 2VU3A 4QO9A 2OBJA 5TKDA 4CXAA 3D7TB 4U80A 3H9FA 5KE0A 4O27B 3GFEA 5DGZA 3ACJA 4OUCA 4YZBA 3VULA 5K4JA 3JY0A 1M2PA 1VYWA 4GIIA 3RPYA 5AP1A 5AAFA 3UO4A 3TNHA 2FSLX 3NUYA 4YSJA 4IIRA 4MXXA 4W8EA 5JFXA 4FK3A 2F4JA 1YHSA 2Q0BA 3NR9A 5HVJA 4IB5A 3QTSA 4UMPA 5IG1A 2GHGA 4ARKA 4ZMEA 4CT2A 4OTIA 4D4SA 4EK4A 1Q99A 2H6DA 2YM7A 2XK7A 3GB2A 3V01A 1U5QA 2W1GA 4GYIA 4D5KA 5C1QB 1WVYA 3AMAA 4OW8A 4IAZA 4XV1A 2YA9A 2XEYA 3U4WA 4DFNA 4CFXA 4QTDA 2OO8X 3JVRA 4BICA 4LOOA 3CTJA 3NYVA 4F1OA 5LQFA 4O7RA 3UZRA 3DNEA 2Y6MA 4AGCA 4XYFA 4F63A 1MRUA 2BROA 1XO2B 4ZJJA 3F2NA 4IFGA 4ASDA 5CASA 2VTOA 5A4QA 4QMOA 3G51A 2WQEA 5I4NA 4LV8A 5AR8A 3R7GA 3M1SA 3N4TA 2B9IA 2XKFA 5AWMA 2C3KA 3FEGA 3KRLA 4YC3A 4DTBA 2IVTA 3KY2A 1OKVA 1E1XA 1U54A 2QOCA 4G3DA 4XP0A 3UYSA 3WE8A 5D11A 3BEGA 2BRHA 5E8TA 3VJOA 4IM3A 5FTQA 4DLJA 5KKRB 3HEGA 1OUYA 1MQ4A 1SMHA 2PMIA 2Y4PA 2UW0A 1JKLA 3RZBA 3O17A 2R3JA 2RL5A 4WG3A 3T3VA 1PHKA 5HHWA 5A4TA 3KRXA 4BDFA 2RGPA 4FZ7A 4FSYA 5AA9A 4BKZA 1VZOA 4DH8A 3G6HA 2VNYA 3R1NA 4EEVA 5AR7A 1OBDA 5DT0A 4C33A 4PY1A 1LUFA 2X9EA 2ITXA 2RFSA 5CEOA 1KOBA 4JDKA 1ZY5A 4O38A 5F1ZA 5HI2A 4CFFA 4UMUA 2CGWA 3BYOA 2PMNX 3OHTA 4F1TA 3RMFA 3CJGA 2J5EA 3CY3A 4IVDA 5AUYA 4YP8A 2C30A 4WD5A 4YJPA 5E4HA 4DBNA 3DBFA 4U3ZA 4DH7A 2IO6A 3SKCA 4V0GB 4FI1A 2WTDA 2YDIA 3LXNA 2VX0A 3AT4A 4ZSGA 4JNWA 4QTAA 3R2BA 4X6QC 1MRVA 3K3JA 4YTHA 4CLJA 4YC8A 3G9LX 3FLYA 3QRUA 5AR5A 5CWZA 2ZV9A 5BVWA 1YOJA 3RPRA 3QWKA 2YIQA 5FXSA 1LEWA 4IHPA 3ALOA 4L3LA 4YLLA 4O6EA 3I81A 4FR4A 2ZMDA 4U81A 4AZSA 2R3HA 4IX5A 4KBKA 3ORNA 4ZLZA 2ZM4A 5E8XA 4EOSA 5CX9A 5J8IA 4PNIA 5B7VA 4A4OA 4Q9SA 3RBWA 2YIRA 4FIEA 3FI3A 3ZM9A 3RM7A 5BPYA 1UU3A 2XCHA 4HGTA 4HYUA 4EHZA 5KMOA 2PWLA 3P4KA 2PPQA 3I0OA 3IW7A 4K8AA 4PL3A 5CS6A 4O7YA 3DTWA 4BWXA 1BI7A 2IZTA 2CGVA 2B53A 2QKRA 1NA7A 3EN5A 3ZOSA 2BHEA 3BV2A 1YXVA 4JR3A 2Q83A 4RLKA 2CKPA 4F7NA 3SAYA 2EXMA 4XV2A 3UMWA 4BGHA 1BKXA 4I24A 2XCKA 2O63A 2XIZA 3VS1A 4F70A 1Z5MA 3MY0A 2VTLA 4IWDA 2QOLA 4ALVA 5JT2A 5LMBA 1FGIA 1WFCA 1OPJA 2GS2A 3GT8A 4ZTSA 3KFAA 2QG5A 4G34A 3EHAA 4I6BA 2PVJA 4M15A 4U5JA 3U54A 4NCTC 2G2HA 4PMSA 1H28A 2YZLA 4WIHA 4F9AA 4PL4A 4JT3A 5M08A 4Q5HA 2QU5A 3GCUA 1RW8A 4XG9A 5D41A 3AC1A 2H8HA 4PDOA 5TOZA 3VRYA 3AT3A 4ACMA 4ZSLA 5DWRA 4BDHA 2OK1A 4RG0A 4LL5A 2WTKC 3BGPA 4KA3A 4ZLYA 3F6XA 5JEBA 4EH4A 5M06A 4FTOA 2X8DA 3PZEA 4L53A 3OF0A 3HAMA 2WEVA 3CLYA 2KTYA 4K11A 3ZYAA 1YXTA 4EK8A 2BRNA 1TQPA 3RPSA 3ORLA 4EOJA 4EUTA 1URWA 4Y72A 4JBOA 4F9BA 5JK3A 4ZTNA 4BC6A 4DGNA 4QNAA 4MK0A 5M07A 3OC1A 4RIWA 5AP5A 4DT8A 2W1FA 2QHNA 4U3YA 2YZAA 4GVJA 2R3FA 4JDHA 3BX5A 4PPCA 4C59A 3FKNA 3ORIA 1W8CA 3HRFA 4QMWA 3PY1A 4DFXE 5HZNA 4GVAA 1M7NA 3ORZA 3Q5IA 1JSTA 4YGAA 5FP6A 3UC3A 3WARA 4IAKA 4R3CA 3R1YA 5J9LA 2BZKB 5GIOE 2PE0A 1Q8ZA 1UNGA 2CLQA 3FHRA 4ITJA 2OGVA 3D14A 2PULA 2GCDA 3IOPA 5LXMA 1JAMA 4XG2A 3TJCA 4LRKA 2A27A 3R8ZA 1VEBA 2W1CA 5BVOA 2XJ2A 1FVTA 4G2FA 2B9HA 2E9PA 3E3PA 4V04A 5HG5A 2WMUA 4A9RA 3MJ2A 4F9CA 3ZLYA 1PKDA 4ZZMA 4IW0A 4NTSA 4BBMA 2OICA 4CQGA 3DPKA 5GJGA 3FBVA 2JIVA 3VQUA 1P5EA 1P4FA 3SC1A 5CQUA 4CYIA 5H8EA 4P4CA 5AMNA 3OWLA 2C6MA 4KNBA 2CCHA 4XMOA 3KF7A 4I0SA 5EDRA 3SQQA 4Z9LA 3NYOA 3CJFA 2PTKA 4O2PA 3VQHA 3GU6A 5AR3A 1YXSA 5IA4A 4RLLA 4X2NA 4C3RA 5BX0A 4YZCA 3EZVA 4AFEA 2BKKA 4CFWA 2G2IA 3G0EA 4KIPA 4MBLA 3PP1A 4E73A 3I79A 2G9XA 2NRUA 2PVMA 3D7ZA 3OCGA 4RQKA 3NRMA 4RJ6A 3BLHA 3ZUVA 2C6KA 4ANBA 4QP2A 3ODYX 2OIDA 3PE2A 4CKJA 5IDNA 2OIQA 4QMSA 3WF9A 2ZV2A 3NNUA 1P14A 5AR4A 4PUZA 2R7IA 3AG9A 2Z7RA 5HTIA 2VX3A 5FDXA 3HKOA 2WGJA 4Z16A 2YERA 3CQUA
chains in the Genus database with same CATH superfamily
4WG4A 1WBVA 5ETAA 2XK4A 3TZ7A 4E6CA 3Q9YA 3COKA 5IU2A 5A4CA 4TYIA 4AT3A 4IC8A 1GIJA 5BVFA 2Y9QA 3VBTA 4AGWA 4AOIA 4AXAA 1XBCA 3DBDA 3R83A 3W2SA 4EBWA 2ITNA 3EKNA 3BLAA 3R8VA 4YTFA 2PMOX 3OY3A 1Q3DA 2JLDA 3DK6A 2ZV7A 3FE3A 3LJ2A 1CMKE 3SW4A 3WIGA 3D9VA 5HNBA 5T3QA 3R7EA 4MWIA 3U8WA 3ZFYA 2HY0A 3HMOA 3PIXA 4FSUA 5A46A 1W84A 5AP3A 5HTCA 4JG7A 3WBLA 4XV9A 4E4NA 3NFFB 2XAOA 2C3IB 4UB7A 5AJQA 3O2MA 2VV9A 4IJPA 5JSMA 4O0RA 3VS3A 4G6LA 1BYGA 4F7LA 3CCNA 1PMNA 2R3OA 3VBYA 4XNEA 3KCKA 3BYMA 1ATPE 5E9EA 2UZUE 2PK9A 3P9JA 5HIEA 3IW6A 4WUAA 3Q9XA 1H01A 3MFSA 4OT5A 3V5QA 3NNXA 3ZS5A 4ANOA 5J9YA 1G8AA 4DEHA 2P0CA 3C4FA 1U5RA 2PVKA 3MIAA 4MQ2A 4QYFA 4RIYB 5FRIA 3Q4CA 4IB0A 4ASXA 3KL8A 4GW8A 1SVHA 2B54A 3QLGA 3WYYA 4ALUA 5C4KA 2UZTA 3A8WA 5B0XA 4I4EA 5F20A 4X2KA 3BIZA 2IVUA 3BE9A 3E7OA 4PL5A 5AP0A 4F4PA 3JVSA 3ML1A 3OWKA 4GKHA 4C2WA 3HP2A 4IXPA 1ZOGA 3R7VA 4AF3A 1Y6BA 4RJ3A 4MXCA 3BHVA 3L8VA 5D7AA 3D5WA 3POZA 5CTPA 4PWNA 4GYGA 4OTRA 4QT1A 2NYAA 3HV3A 4GK2A 3GNIB 5HD4A 5DR6A 5EFQA 4J96A 4YHFA 3RAIA 4GKIA 1JOWB 4GG7A 4V05A 5HCXA 2G01A 3ZM4A 2WTCA 4J53A 3S4QA 4XEYA 4U40A 2B55A 4ZIMA 2I1MA 1SNUA 2OI4X 3ORPA 4ZY6A 2DWBA 1JSVA 5CVFA 4RA4A 3DXQA 3A62A 1GZNA 3VS6A 2ITPA 3ZSIA 3DXPA 2VZ6A 3WZJA 3SA0A 2A4LA 5M09A 1OIQA 4NU1A 2GHMA 1ZYDA 4J1RA 5CQWA 2CDZA 3GBZA 2QU6A 4WBBB 2C0OA 3ROYA 3I6UA 4DEGA 3QTIA 2R5TA 3CE3A 3NUAA 4AN2A 2BIKB 2YIYA 4S32A 4TWCA 4C35A 3L9MA 2YLFA 3E5AA 4MBJA 3KGAA 4AW2A 4HZRA 3V5JA 4IZ5A 4Y46A 4RA5A 1M17A 5GIPE 2BFXA 3AC5A 3MH1A 2VTAA 5CEQA 3HZTA 3NUXA 4NM0A 3MPTA 4AZTA 4DGOA 4FKUA 2Z8CA 5H9BA 4YSMA 3T3UA 2PVHA 4IX3A 2WB8A 3ZUUA 5DRDA 5D10A 4IX6A 3ZCLA 4E4MA 4NEUA 3HA8A 4RIYA 4H3PA 3F9NA 3WF6A 2JFLA 5HLNA 4LRJA 3BU5A 2WTVA 4ZSEA 3ZC5A 3H3CA 3MGYA 3EN6A 4BWKA 4K18A 2F7XE 2W5BA 2XIYA 3EQDA 3I6WA 5BMSA 2Z7SA 2AEGA 4C4FA 4GS6A 1PY5A 2QLQA 4MF0A 5HEZA 5BYYA 1W2DA 4JVGA 2Q0NA 5IA2A 3AC4A 3KMWA 3KXXA 5AV3A 2ITVA 1JBPE 3BHTA 4DFBA 3GU4A 3I0QA 1IA9A 3PWDA 2XF0A 3NUSA 3BELA 4N6YA 4DTKA 4JG8A 3RWPA 5IQHA 2XANA 3S3IA 3P23A 5BVDA 4D4VA 4W4WA 2Y8OA 3TM0A 3V51A 3CC6A 3P1AA 5JH6A 4FRFA 5IA0A 5KHWA 2BAJA 2V55A 1G8SA 4WRSA 2VO6A 4JI9A 4YHTA 3R7UA 4WNMA 4FSQA 5EI6A 4XLIA 5CU3A 4CT1A 3LLAA 4CG8A 3ENMA 3ERKA 5HIBA 2E9VA 4WO5A 2RFEA 2G2FA 1I44A 3OWPA 4CFVA 3NEWA 5A9UA 3LFEA 4BCHA 1NVSA 4PDPA 4YBJA 3UDZA 4H1MA 5DEYA 5J87A 3UQFA 4NKAA 1OIUA 3ET7A 2LGCA 3QQGA 4FNYA 1OPLA 5KMNA 5CF6A 4O7VA 3FMMA 4AACA 3GQLA 2CMWA 2YN8A 3W55A 1JKKA 2BRGA 4O86A 1Y91A 3LJ1A 3QRKA 4I92A 4QMUA 1YWRA 3LZBA 2QOKA 4D0WA 3DOGA 5A4LA 2XP2A 4GCJA 3AOXA 5HGIA 4FKRA 5M4UA 2VO0A 2ITWA 3VRZA 2I40A 4NIFA 2YCFA 1MRYA 3OOMA 3WF8A 5CALA 5ANEA 3H9RA 3BBTB 5DPVA 4RWLA 4FTIA 5JKGA 5AUUA 4RBLA 4GFGA 4TWOA 3QYZA 3NCGA 5B2MA 3SV0A 5KBRA 2C47A 4I1ZA 3NZ0A 3A61A 2UZBA 2CKEA 5CY3A 4UN0C 5BVEA 4DITA 5BUIA 5HKMA 5EH0A 1WBNA 4FKIA 4LMUA 1TQIA 4WT6A 2CHLA 4USFA 4E5BA 3VS5A 3R9OA 3CBLA 5LCKA 4JOAA 4ACCA 5EG3A 5ANIA 4Y8DA 3ZEWA 4U45A 5I9XA 5E92A 4KRCA 4BYIA 3HRCA 1H1RA 3MIYA 1Q8WA 4DA5A 4PPAA 5HESA 1YXXA 2R4BA 3EYHA 1GAGA 3PXRA 4FV2A 4UY9A 5CU4A 5CXHA 4FTAA 3NYNA 4FTNA 5EK7A 4NFNA 3QCXA 2UW9A 5GINE 4NL0A 3OROA 1IR3A 3EOCA 1SM2A 2GTNA 3CPBA 5LVOA 1K2PA 3MTFA 3EQFA 1PXLA 3FKOA 3HMNA 5T68A 1IEPA 1KV2A 5KZIA 4LGHA 4ZY4A 5LVLA 4U97A 4JL9A 4JDIA 4KBCA 3TJDA 4D2TA 3LFCA 3UMXA 2YJSA 5M53A 2W1DA 4DEEA 3OY1A 4M12A 3SXRA 1PXOA 2VX1A 5K0XA 1L3RE 3ZLSA 2C5VA 2JKOA 3QKMA 4BZNA 3DV3A 3DBCA 2A0CX 2XK9A 2YM5A 2GMXA 4FV9A 3V5PA 4BKYA 4DBXA 2IW8A 5KHXA 3RHXA 3E8EA 4TYHB 1IA8A 3LQ5A 2ZFYA 1YI6A 4OTHA 3Q4ZA 4CCUA 4D28A 3WI6A 3EIDA 1FINA 2R3NA 2BTSA 3M2WA 4NIFB 4EH3A 3I4BA 2OXYA 2YISA 1DAWA 4H3QA 3Q2JA 2PZRA 1YI4A 1OI9A 4J8MA 3ULIA 5HNIX 3FLWA 4B6LA 4F0FA 4LYNA 3GCPA 1JVPP 4I23A 3MVLA 4O0TA 3RNIA 5LVNA 4YJOA 3NX8A 4TY1A 4XLVA 4A7CA 5HNGA 2JITA 4APCA 2W96B 3PJ8A 3QA8A 4EOPA 4RIXB 4FKVA 3V5LA 3B8RA 3IO7A 5TO8A 1V0OA 3DLZA 3AD6A 1OL2A 3MDYA 4QQ5A 5I3RA 5JZNA 2XAMA 4M0YA 4RWIA 5D12A 5BMMA 4FKTA 4JR7A 4P7EA 4RJ8A 3W0SA 2FUMA 2PZPA 5T6KA 3QX2A 4EH5A 5IUGA 4QQTA 5E8ZA 2ZB1A 1OM1A 4JIKA 2V5QA 4U9AA 4ACDA 3IONA 4GG5A 5CAVA 5IQGA 2HZNA 2BDFA 3C13A 2HELA 2JDVA 4AS0A 3DY7A 4B0GA 1S9JA 4QYEA 4AU8A 4X6RA 4OAVB 1M7QA 3BHYA 5EW8A 4IZ7A 1T45A 3R73A 1Q5KA 1OVEA 5LVMA 5C26A 3F88A 2FSMX 5M57A 4AXFA 4ZSJA 4YO6A 4N70A 2B1PA 2FYSA 3RAHA 2QLUA 1F5QA 3G6GA 3UJGA 3VIDA 4M68A 5H8GA 4E26A 5IISA 4EYMA 3R22A 5IEYA 4GFOA 4FT9A 5HU3A 5JGDA 3N4UA 2UZLA 3C4WA 3Q96A 4GIHA 4IDTA 4HPTE 3REPA 4R7BA 3DAJA 4BZDA 3OXTA 3IW8A 3NW7A 3QGWA 3OT3A 3EH9A 1GIIA 3F7WA 4JQ8A 3RK7A 3UVQA 3ZZWA 1G5SA 1M2QA 4WA9A 1Q41A 3MWUA 4KBAA 3H9OA 4FIHA 2ETKA 4CFUA 1AD5A 5ANJA 2OF4A 2VWXA 4IZAA 4NKSA 4E6AA 2C6EA 4LV5A 3S95A 4X2GA 3NVMB 3F2AA 5DR9A 2R3LA 2QR7A 4O0SA 3DQXA 3VS0A 1Q62A 3GUBA 3AQVA 2WTWA 3UVRA 3LXLA 3UPXA 4QNYA 5LWMA 1YDTE 5CT7A 3DBEA 3PPKA 3W2RA 3HYHA 3RTPA 5EHYA 4LRMA 5BUEA 1GZ8A 3W0OA 2JDRA 4QMXA 4D2PA 4YURA 4HPUE 3UQCA 5LMAA 3P08A 3PWYA 4EZ7A 4J7BA 4MNEB 2WMBA 4YZMA 5FM3A 3UGCA 5IH4A 5AP2A 4JMQA 4EI4A 3KK9A 3VBVA 5A54A 4P5ZA 4RIXA 2P4IA 4OTPA 3R9HA 3U55A 2GNFA 2R3GA 2UZVA 3KXHA 5CF8A 3FZTA 5M4FA 4IWOA 4RRVA 1BMKA 5CENA 3BCEA 3O96A 1UWJA 3CEKA 3W2QA 5IEVA 5K5NA 4U43A 4FTTA 2IG7A 2ITQA 3ITZA 2W99B 5CAPA 1OKWA 1CKPA 2HWPA 4IB3A 2QHMA 4BGGA 5EYCA 2W1EA 4FT3A 4CTBA 2VWZA 5AUZA 4U7ZA 3R00A 5CF5A 2OW3A 3RI1A 5AIRA 3A99A 3ZRMA 5KZ0A 3QRIA 4D55A 4FL2A 5A3XA 3QXOA 4F6UA 2W7XA 1H0VA 2WPAA 1RQQA 3PG1A 4XRJA 2X7FA 5ICPA 4RQVA 4R1VA 4LG4A 3TTJA 4DFLA 4BCIA 4ZK5A 3MYGA 3NW6A 4CG9A 3I60A 3IOKA 4IADA 5EI2A 4HVGA 4PRJA 4KB8A 4S2ZA 1DAYA 4QP4A 1UWHA 5EOBA 3CP9A 3B2WA 4Q5EA 4O7NA 2C6IA 4BIEA 4IQ6A 5G1XA 4AZFA 1VLRA 4EK3A 4BYJA 5FUTA 5KNJA 2R7BA 4O4EA 2JIIA 4XHKB 4C36A 3VHKA 4U42A 3EQIA 4QTBA 4C4HA 1O6YA 4FSTA 5IKWA 3W18A 4D9TA 4FYOA 4N6ZA 1VYZA 3H0YA 4NH1A 4XCUA 5EDPA 5IEXA 3CGOA 2UZEA 2XB7A 4MEDA 1PKGA 4BCQA 4FSNA 2R3QA 3Q9WA 1R0EA 3RCJA 3QQJA 4ID7A 3FMHA 4JG6A 4F6WA 4HGLA 5EW9A 5GZ8A 5GZAA 4PTGA 5EYDA 2UW6A 1J7IA 3ALNA 3FV8A 1V1KA 4FTMA 3MS9A 3F5XA 2JBPA 4HCVA 3N9XA 4Y5QA 1KE9A 2X8IA 2FSOX 4DTAA 4AZVA 3TEIA 3DZOA 3CKXA 3GCQA 3QUDA 2PE2A 2WZJA 4MNEA 3WILA 1YHVA 4PF4A 1PMUA 1AQ1A 4FKSA 2O64A 2OF2A 4Y83A 2OH0E 2RFNA 3F3VA 4I21A 3R1QA 4QMNA 4JS8A 2W5AA 4O96A 4FZDB 3V6RA 3FSFA 2O3PA 5BQ0A 3TNIA 2B52A 4XX9A 2J90A 4IAAA 3QQKA 3RM6A 5FDPA 3KRJA 4I5MA 4XV3A 5JRQA 2C6OA 1ZRZA 2QG7A 2Z7QA 3AGMA 5I9VA 5BVKA 4FJVA 3G2FA 4M3QA 3P5JC 3OCBA 3DKGA 1BLXA 3R21A 5IQEA 3UOHA 4Y5HA 4M69A 1OGYA 2CGUA 2QURA 5JFVA 4IX4A 4O7TA 2QR8A 2VWWA 3Q53A 2BAQA 3S1HA 5CU0A 3W2CA 1CTPE 5M44A 4EKLA 3LCOA 2P3GX 5IH6A 3RKBA 2BILB 3FYJX 4B9DA 4GMYA 3BE2A 3QC4A 3HUCA 4YO4A 5HD7A 4RPVA 2UV2A 2QKWB 3NSZA 2UZDA 2ACXA 2GTMA 4EWHA 2J2IB 3BL7A 4GUBA 1X8BA 4C4GA 2ITOA 4DHIB 2ZOQA 2XA4A 4FEQA 4DEBA 4RSSA 1H0WA 3QD4A 5F95A 2XNBA 4O91A 5DEWA 3NS9A 4OBOA 4WNOA 3CXWA 3MN3A 3TV7A 3DZQA 1Y8GA 1VJYA 2UVYA 3O8PA 2CKOA 4A9TA 4BDAA 1ZWSA 3L1SA 2BKZA 1ND4A 1JLUE 3IW4A 3KRWA 4X7QA 3T9TA 1GNGA 2PMLX 5GJDA 4CVAA 2Y4IC 4G6OA 2CKQA 4BCJA 3ZH8A 3FLQA 4HOKA 4IAYA 4UV0A 3PLAE 3QTWA 2C6LA 3CIKA 4NJ3A 5DHJA 4FV8A 4G3FA 4TPTA 2B9JA 3ZEPA 4C3FA 5H3QA 1OL7A 4CEGA 4NUSA 4FC0A 4FICA 5FBOA 4UZHA 3FDNA 3FMDA 3KKVA 3R9DA 4D1SA 4XUFA 5DYJA 3R6XA 4C4IA 1JKTA 2VTPA 3FKLA 1KWPA 5FEQA 4KS8A 3KXGA 4NCTA 3SX9A 1KE6A 3F3UA 4HVDA 3FJQE 3OG7A 1U46A 2GNLA 3IGGA 4EL9A 5HORA 3G15A 3S2PA 1FVVA 3E64A 5EQYA 5DT3A 4CLIA 4E5AX 4M69B 3U9CA 2R2PA 4C62A 2J7TA 4ZTLA 4Z7HA 4JX7A 3UNZA 1CKIA 4G6NA 1XJDA 5CVGA 3S0OA 4M14A 3KA0A 5FEDA 3EYGA 4IB1A 3TL8A 2CCIA 3LOKA 4D9UA 3A7JA 3D5VA 2C3JA 4ANNA 1Q24A 3VAPA 4A06A 4K9YA 4A9UA 2PVNA 3VS7A 4H05A 4UBAA 4ZEGA 4D2WA 4QMPA 5J5TA 3QXPA 2BZHB 2XJ0A 2EXCX 2DYLA 3DT1A 2W1ZA 5LMKC 1U59A 3KXNA 4FL1A 4EOQA 4ZTQA 1Q4LA 2WU6A 3NNVA 4FTQA 4R7IA 4PDYA 2XNMA 3BU3A 3AC2A 3PUPA 5K0KA 3L9NA 3CQWA 1XHAA 3MY1A 3MH0A 4BF2A 4FV0A 3V8TA 3F3ZA 3JPVA 4YTCA 4FTRA 1LEZA 3TKHA 5FWKK 3BLRA 3BQCA 4HGEA 1H1SA 3FI4A 3SOCA 2GQRA 3ZO1A 4E4LA 3U9NA 5A6OA 4DG2E 3IECA 5AX9A 3ZBFA 4K77A 2OXDA 2IZUA 4GT3A 3WZEA 3W0QA 4E4XA 4GH2A 4QEBA 4FIIA 4FTKA 5CSVA 4C8BA 3Q32A 2JKMA 5KMKA 3PG3A 5IQDA 2RKUA 3QTUA 2JC6A 5HIDA 5HO6A 2W1IA 3CSVA 5DH3A 2XEZA 3MPMA 3DJ7A 3IPHA 3P78A 5ANGA 1JQHA 2XKCA 4C7TA 3HV4A 5CU2A 3QBNA 4IANA 4S34A 4MXAA 3E3BX 3U87A 4TZRA 2V7AA 1H25A 1YHWA 3GP0A 3FI8A 1YW2A 2WO6A 2Y6OA 4LGDA 5E1EA 1KE7A 2H96A 3OMVA 3LM0A 3VS2A 4M97A 4ASZA 4AP7A 5IH5A 4PX6A 3OBJA 3MH3A 3NCZA 3VBXA 4QPAA 4ZSAA 3L8SA 3T8OA 1I09A 1V0BA 4J71A 3SRVB 5K4IA 3Q52A 5L6PA 3QYWA 5FBNC 3DJ6A 4EQCA 2GSFA 4KABA 4EOLA 2EWAA 2XKEA 3O8TA 5D7VA 3TT0A 4EWQA 2G15A 4RT7A 4E7WA 3DDQA 4L52A 4RVTA 4KRDA 3VBWA 3DXNA 4FZAB 3DJ5A 2P2HA 1TQMA 3SXFA 4U8ZA 4WSQA 5FEEA 4ENXA 3CPCA 4IVAA 3R71A 3AT2A 4L3PA 3QRJA 3OXIA 4HVIA 4Z55A 4DF3A 4NM3A 3RCDA 4FV6A 3QZFA 4GK4A 5DG5A 4DT9A 2OKRA 4BCFA 4EZ5A 3EQGA 3HAVA 4FKGA 4F78A 3KMUA 4UWYA 4O83A 4BTKA 3U4UA 5ETFA 4XG8A 5DOSA 5CF4A 4GJ3A 2YIWA 5AADA 5L4QA 4QD6A 2V22A 3UPZA 3VBQA 3BV3A 4D0XA 2I0HA 4BHNA 4V01A 3LFQA 2WU7A 3ACKA 3PYYA 3OVVA 4DFZE 2J50A 4BFMA 4BDDA 3B2TA 4CFNA 1GY3A 5EOLA 1TFFA 1KV1A 5L2IA 3FC1X 4DHZA 1W83A 2V0DA 4ZAUA 3FI2A 1WBPA 3MSSA 5CNNA 4BB4A 5DT4A 3ZXZA 3DB8A 1QL6A 2CGXA 4YNOA 2QVSE 4NW6A 2OJ9A 3B8QA 3TDWA 4Q2AA 4MKCA 2OH4A 5J1WA 2OIBA 4BCPA 2YCSA 1FMKA 3W32A 4EOOA 2BUJA 4PDSA 2X8EA 4FV1A 3MI9A 4X2JA 3UG1A 2YWVA 5AUTA 3E93A 4QMTA 3NDMA 4BIBA 3W2OA 3SRVA 3VUKA 4M67A 4MD9E 3FZRA 3DTCA 3KXZA 3Q2MA 2X0PA 3FZPA 4FZFB 5C03A 3UBDA 4F0GA 3D5XA 4YHJA 1FBNA 4FNZA 4KUJA 2C3LA 2W5HA 4EZ3A 4KIKA 4YU2A 4FTLA 3VS4A 4F0IA 3PXQA 4RX5A 3R30A 3PE1A 4ZP5A 5IUIA 2ZMCA 2OXXA 3N51A 2GU8A 5FLFA 3FY2A 3THBA 3G0FA 3HMIA 3R2YA 2YIXA 2DUVA 4WUNA 4MCVA 3QKKA 3UQGA 3EN9A 4YR8A 2X7OA 3D83A 1ERKA 5DIAA 1NT2A 4S30A 4AAAA 2C1AA 4CNHA 2YAKA 2PVRA 5M4IA 3OZ6A 2YDJA 4JXFA 3BHUA 3VUDA 4NT4A 4CYJA 3ZO2A 4ZY5A 3H0ZA 4CMTA 2C6DA 2KULA 3OBGA 4FIGA 5IUHA 1YQJA 4I6FA 4DINA 5CXZA 4V0GA 4E6DA 5LVPA 3QQHA 3UODA 2P33A 2PE1A 3G33A 3C0IA 4FVRA 3TV4A 4O7ZA 4X3FC 1REKA 2PUPA 4FEWA 2X0GA 3DS6A 3VUGA 1UU8A 1ZYLA 3FHIA 3PJ1A 3KQ7A 2W9ZB 3HVCA 4W4XA 4X0MA 5J1VA 2VO7A 2WEIA 1P2AA 3PRFA 4PNKA 2WQMA 4RJ4A 4I6HA 4G3CA 4M0ZA 4ZZOA 4LQMA 1XR1A 2OJFE 2R3IA 3IDBA 2IF8A 3FQHA 4PP7A 3H30A 4RJ7A 3QD2B 4ACHA 4A07A 2XYUA 4L01A 1PF8A 4RVLA 4FKQA 4FE2A 3F61A 3T9IA 3AC8A 3VONA 4K2RA 2JDOA 4NW5A 3JS2A 3C4ZA 2XIKA 4L44A 4DHJA 3PJ2A 4BDGA 5DVRA 4ENYA 1OL1A 2GQGA 2V7OA 2IVSA 3OCSA 3P5KA 4FT5A 3HL7A 4BCKA 1H1PA 3EWHA 4GFMA 4YJTA 1XH4A 2I0VA 4FG9A 1JNKA 4I5HA 5FP5A 3UOLA 3F69A 3GGFA 1PMVA 1ZYCA 5IA5A 3TIZA 2OWBA 4ITIA 4ANQA 3UO6A 2C4GA 4M8TA 5M56A 5DFPA 5AUVA 5DBXA 1ZYSA 2IZSA 3PIZA 4G31A 3DK3A 4PMPA 5KX8A 4Z7GA 5HG8A 4LDTA 3Q3BA 1YVJA 4YJVA 3QZHA 1OUKA 3HMMA 1M52A 4KKGA 4I5PA 3V8SA 1A06A 1UU7A 1T46A 3D7TA 3VC4A 4AN3A 1J91A 3PVGA 3PXKA 1OITA 2YAAA 4L8MA 3ZRKA 5E91A 4YJNA 2JKKA 3DDPA 2R3KA 4RFYA 4FOCA 4WKQA 5IA3A 5IPJA 4D4RA 5KMMA 4TTHB 3MA6A 4C34A 3O7LB 4C37A 3LHJA 1OZ1A 2PVYA 3CTQA 2ITUA 1Q8TA 2LAVA 3FXWA 3QQFA 3UE4A 3VJNA 4FEUA 1XH6A 2O5KA 5LARA 2YWPA 4I0RA 2C69A 4G5JA 4HNFA 4DDGA 5IMEA 4AZWA 5KMLA 4ACGA 4HNIA 3DKCA 1WBSA 2PVLA 2PL0A 3QTZA 4RX9A 3LPBA 4OLIA 4ZTHA 1YDRE 4G16A 4G3GA 3PSCA 3DFAA 1UVRA 3PLSA 4DCEA 4B8MA 2W9FB 2X0QA 4IZYA 2GNGA 1A9UA 5I9UA 3UG2A 4BDJA 3V5WA 5EKOA 2QO2A 4QMMA 4YLJA 4FV3A 1YWVA 3DAEA 1URCA 4NM7A 3SW7A 5M4CA 4CCBA 3TDVA 3E8CA 3Q6WA 4QMYA 4RFMA 4AN9A 1SVGA 2UW8A 1PXMA 3SG8A 2IW6A 4J97A 4R5SA 3QF9A 3EQHA 2WMQA 4FGRA 3DFCB 3F66A 4D1XA 5EQEA 1APME 4QTEA 1NY3A 2EUFB 1U54B 3F5GA 3FWQA 4HCTA 4YTIA 4J98A 1H1QA 2QOHA 3GC8A 3KK8A 3ANQA 3QFVA 1YI3A 4IM0A 3DBQA 4OTWA 3ZLXA 2XIXA 3PY0A 3LFFA 3PTGA 5AV4A 2GNJA 3TNPC 3VNTA 3R9RA 4BTMA 5ETCA 1QCFA 2X6EA 3SVVA 3TUBA 2YM4A 2QCSA 4R5YA 2VTTA 3CQEA 5I3OA 4A9SA 2HENA 3GC9A 4U0IA 1ZXEA 5DMZA 3LQ8A 3BGQA 2YCRA 1PXIA 2WTJA 4MXZA 3COIA 4JRNA 2XM8A 3ZDUA 3MTLA 2IW9A 5IMXA 3LMIA 2XBAA 3UOJA 2UUEA 5AM6A 4XH6A 3PA3A 4NFMA 2JDTA 4W9XA 5AP7A 3GOKA 3KRRA 3PVWA 4KWPA 4RGJA 4Y85A 4FV4A 4YZNA 3LFAA 4BTJA 3P7BA 2VAGA 4D4YA 3W0RA 4QP7A 4QP1A 4IDVA 3QZIA 2OJJA 2PY3A 2X4FA 4R3PA 4TYEA 4IWQA 4L9IA 2YLEA 4DEAA 5HVKA 5IQBA 3N4VA 3QUPA 4PPBA 2WMWA 4CZTA 3W1FA 4ZLOA 2AUHA 2BCJA 3LIJA 3HECA 5FQDC 2VGOA 2ZM3A 3DKOA 4MNFA 4BRXA 2PU8A 2OFVA 3LFBA 3O71A 4HYHA 1Q61A 3HV7A 2WAJA 4C0TA 2WMSA 4AE6A 2WKMA 2J0JA 3P7AA 3E63A 3MFRA 5FG8A 5TF9A 2AC5A 2I0YA 4YZDA 3LCKA 4MH7A 4FT0A 4E20A 3FPQA 1PXKA 2QO9A 4AG8A 3EB0A 5HVYA 2OFUA 1DS5A 3NUPA 5HE3A 2UW5A 2R64A 3EQRA 3QZGA 2JFMA 2X2MA 4G17A 2C5XA 1B38A 4EOIA 1H8FA 1YKRA 4LOPA 1XH9A 4FV5A 4OTFA 4O82A 4EQMA 4YZ9A 2ITYA 3IKAA 2R3PA 3E62A 3PXZA 4FV7A 4CSVA 3A60A 3QCQA 4BDBA 1R78A 2R9SA 4G5PA 3QQUA 3LMGA 4PQNA 3HP5A 5CLPA 3G5DA 4ZOGA 4FEVA 1BI8A 2HWOA 4K0YA 3UDTA 1ZMUA 2NP8A 1QPDA 4MYGA 2NNWB 2ZYBA 3FXXA 3W0NA 2R3RA 2FO0A 4L46A 4FKJA 4RMZA 2X2LA 3UNKA 4BI0A 5HBHA 3BU6A 4I0TA 4IEBA 1JSUA 5HCYA 2WOTA 2B0QA 4LM5A 3FLSA 3AKLA 4RX7A 4BCOA 5EYKA 4F9WA 3UIMA 2VTIA 3UC4A 1KE5A 2Y0AA 4M66A 3MA3A 3U51A 4R7HA 4LI5A 5C4LA 3OTUA 1IASA 2X4ZA 5TR6A 4MD8E 4AZEA 3C0HA 3BWFA 1ZOHA 3MV5A 5GHVA 3QTQA 4Y73A 5JQ5A 1Q8UA 2J0KA 1H1WA 2ETMA 4OTGA 4RIWB 2Z02A 2H34A 1JWHA 4NSTA 4QP8A 3EFJA 4QYYA 3EKKA 2X7GA 2RIOA 2GNIA 2YITA 3GC0A 3QWJA 5F9EA 3U6IA 4ORKA 1XH5A 3CKWA 2XJ1A 5A6NA 4YPDA 2XIRA 4KIQA 3MB7A 1SNXA 4H39A 2BIYA 2NO3A 2WTIA 4BI1A 5I5ZA 1OGUA 5ETIA 3W2PA 2WOUA 3COMA 4O7LA 1FQ1B 4DGLC 3VVHA 4P90A 3GU7A 2RF9A 3PVBA 4BL1A 3VUMA 4IMYA 2BFYA 3OW4A 5CI6A 4WNKA 1UKIA 5AX3A 3HMPA 3MFTA 4LUDA 3KULA 2C1BA 2NRYA 4O81A 3ODZX 3W33A 4DH5A 5J79A 1QPEA 2HAKA 4QPSA 5HG9A 2XARA 3OUKA 4UEUA 3KF4A 4IE9A 4C02A 5LOHA 2VTHA 4EBVA 4E93A 4Y95A 5DR2A 1XWSA 3DKFA 4QMLA 4IM2A 1XH7A 4HYSA 4BDCA 4ERKA 2CLXA 1O6LA 4DH1A 4EH8A 2QOBA 3IDPA 3A7IA 4L43A 2PUIA 2EU9A 3A7FA 3R8MA 5L6OA 4MQ1A 3V04A