2RFSA

X-ray structure of su11274 bound to c-met
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
280
structure length
264
Chain Sequence
QHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLKIHCAVKSLNIGEVSQFLTEGIIMKDFSHPNVLSLLGICLSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hepatocyte growth factor receptor
publication title c-Met inhibitors with novel binding mode show activity against several hereditary papillary renal cell carcinoma-related mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 264
sequence length 280
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2rfsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2rfsA01
5C8KA 3SXSA 3ZCLA 3QTIA 4W8DA 3QF9A 2OIQA 3HMNA 5K0XA 4LRJA 2NNWB 4HCVA 5CSPA 3MYGA 2WFYA 3FL5A 4XP2A 3SAYA 4KD1A 4FEVA 4XRJA 5IQEA 1DAYA 4PY1A 2GNFA 4HPUE 2QODA 3LXPA 4W4YA 4Y85A 4ZZNA 3HAMA 2QLUA 4WNPA 4O7TA 5CANA 3KMMA 3W18A 3ZO2A 1PJKA 3KF7A 4DEAA 2VTQA 4W8EA 4BZOA 1R3CA 2W9ZB 3HUCA 4O0WA 4PL4A 3UYTA 3ZS5A 5HTBA 4C7TA 3VUKA 3IQ7A 4I23A 5AUXA 3KGAA 1PY5A 3TUDA 4UMPA 3V5PA 4Y72A 3ORTA 3QD3A 2UW8A 3E3PA 2IVSA 3QYZA 3NNUA 5EM6A 3C4CA 4CT2A 4WOVA 4XP0A 4WT6A 4R77A 2GTMA 5C01A 2OIBA 4ZXTA 2J51A 3FAAA 4KIQA 3QRJA 2PTKA 1VR2A 3AC4A 2C3JA 5CXZA 3D2KA 1JLUE 3Q2JA 2Y9QA 2W9FB 5AX3A 3IPHA 2JC6A 4TYHB 5EHLA 1TQPA 2XK8A 2PMLX 3GFEA 4EZ7A 2JITA 5LVMA 1W8CA 5IQAA 5BYYA 2P2HA 5L8LA 3BGPA 2ESMA 3OWPA 2C6KA 2R7BA 3C1XA 4FT5A 3WZJA 2WQNA 3V6SA 3RPRA 2I6LA 4XG2A 4KBKA 2EUFB 2YFXA 3M1SA 2P4IA 4KWPA 4XV9A 4EOJA 4R3CA 4WNOA 4QMWA 1YRPA 2H34A 4L6QA 4MXCA 3P23A 4RIWB 4FTUA 1ZYJA 3BU3A 4LI5A 4JQ7A 2BALA 5CASA 2PZYA 3TT0A 4KABA 2H8HA 2UZWE 2JEDA 3MH3A 4D5KA 1ND4A 1RJBA 5AUUA 4E8AA 3EWHA 3QD0A 4S34A 3DJ6A 3SX9A 2J50A 2ZVAA 4JX7A 4KS8A 2QC6A 1M7QA 2WTCA 4GV1A 5CZIA 4DITA 2WAJA 3FL4A 4DC2A 4Z55A 5JT2A 4C4IA 4HVDA 3RM7A 4RZVA 4DE4A 3ZSIA 3KVWA 3QL8A 4NM0A 4BL1A 3F6XA 5DR9A 2JFLA 4TT7A 4GK2A 3R6XA 4KSQA 5DFPA 4XBRA 4W4XA 3ANRA 4D2TA 3PXQA 2IO6A 1R78A 3IW6A 4FKJA 4PL3A 3L1SA 3WF6A 2O8YA 4DYMA 2QOCA 4DT9A 3NS9A 5BYLA 4Z3VA 3EYHA 3A7GA 5M09A 4J52A 3A62A 4E5AX 3QCXA 4EORA 5HU9A 5L6WL 1YI3A 2W4KA 5HO8A 3DKCA 2Z7SA 4R3RA 4IZ7A 4AN3A 4BDGA 5HG5A 1CKJA 4QMQA 3WIGA 4Y46A 3HP2A 1F3MC 2JBOA 3AMYA 4Y73A 3UIBA 2Y4IB 4FK3A 3ZYAA 4DH3A 4CMOA 4QTAA 3IGGA 4YZCA 2OBJA 2Z8CA 5CT7A 4EOLA 4FNWA 2R3KA 3IG7A 3W2OA 2W1ZA 2XK9A 4AE9A 3BHVA 4O7NA 4I6QA 5HCZA 3D9VA 3ZRKA 3SA0A 2XEZA 3F61A 3OC1A 2BKKA 1ZARA 1J1BA 3PSDA 4WG3A 4DEDA 1DM2A 4EC9A 4YJOA 2GS2A 3FWQA 4CZYB 3LVPA 4HW7A 4WBOA 4W4VA 4YJQA 3CGFA 4F4PA 5DR2A 4NT4A 3BEAA 4B6LA 4G1WA 5TOZA 1WBNA 4E5BA 3IW7A 4I5HA 2C6OA 1DI9A 4FTQA 3OWLA 3A60A 3UE4A 5CAOA 5EM7A 4ITHA 3LQ5A 4I0RA 4DN5A 4MF1A 3ORXA 5ANEA 2VZ6A 4QTBA 4B9DA 1GZKA 1H24A 5CALA 4GK3A 3ENHA 4O0YA 3A7JA 5AV2A 2C5OA 4I0TA 2XJ0A 3DLZA 4BCFA 3LPBA 4C0TA 3R8ZA 5AWMA 4YO4A 4I5MA 1PHKA 1KSWA 3QC4A 4FOBA 1U54A 2BROA 3P86A 4F0FA 3FE3A 5E8TA 5HO7A 5EQEA 1JVPP 1LPUA 3IOKA 3NYXA 4U0IA 3VNTA 4ACHA 3AD4A 5FP5A 5IQBA 2OFUA 1SVGA 3B8QA 1OKZA 3BV2A 3QLGA 3T3VA 5KKRB 3KB7A 4ZJJA 1BUHA 1M2QA 2BAKA 3V51A 2WGJA 3QRTA 4S31A 4X21A 5AUWA 3ZLWA 2CGVA 2YDKA 2RF9A 4IAKA 4IC8A 5GJFA 3TIYA 1Q99A 3VBVA 4MEDA 4DFLA 4FKLA 3WIKA 4DHFA 5J79A 3EMGA 4FUXA 4USDA 1ZAOA 4AGUA 2W1HA 4QP7A 1PXOA 4I0SA 5HE3A 5IZFA 5G1XA 3SGCA 5DH3A 4FKPA 1VZOA 3BYOA 1FQ1B 2EXEA 1WBWA 4PX6A 4XUFA 4TYEA 5EDRA 1ZY4A 3FY2A 3L9PA 4C2WA 4DH8A 1ZLTA 3G5DA 2G01A 4I5PA 4LYNA 1QMZA 4L00A 4FSZA 2W1DA 3MFSA 4AZFA 4O21A 5DWRA 4ALUA 4KIKA 1IR3A 2G2IA 2YWPA 4F7LA 3GVUA 5I5ZA 1FBNA 3KK9A 4ZTQA 3UIXA 3KU2A 3D0EA 3A7HA 4GG5A 4F09A 4C33A 1FMOE 5HD4A 2DS1A 3W10A 4BDCA 5I9WA 3NW6A 3MSSA 2BFYA 4IZYA 2BTSA 5CU4A 2IZRA 5H8EA 4ERWA 2W5AA 3RK7A 5BVNA 3VF9A 1JBPE 5CSXA 4MTAA 5EM5A 5I9XA 2C69A 2BHHA 4QTEA 1OKVA 4BF2A 5B0XA 4FSTA 1E1XA 2C3IB 4QMXA 3QYWA 2NP8A 4C35A 4K18A 5KZ0A 3EN9A 4QQTA 1XJDA 4FIFA 3U4UA 4C4GA 2O65A 2RFEA 3FZ1A 4NW5A 3ORPA 2IVVA 1FINA 4JRNA 4F9AA 3L9MA 4YC8A 3ZMMA 2EVAA 1IG1A 3EQCA 3R7IA 3OBJA 4F63A 2I40A 4D4VA 4H05A 1OL5A 3HMMA 3QU0A 4WG5A 2WQOA 4BDEA 5A6OA 2PHKA 2W0JA 1YDRE 2PVYA 3CPCA 4QYYA 4XOZA 1R39A 5M4IA 4KB8A 2R7IA 3C4FA 3F2AA 4EOPA 4YJTA 4OTFA 4AUAA 3NZ0A 4QMTA 4USFA 2RFDA 2BCJA 5GJGA 1OMWA 2VTHA 2J90A 3G33A 4F0GA 2VGPA 3DK3A 4FTIA 2HAKA 2ZMDA 1PRYA 2JIUA 3D4QA 5CLPA 3PDTA 5HNIX 3PIXA 1Y6AA 3TIZA 5A3XA 4M68A 2BAJA 3TKHA 3MB7A 4U6RA 2XNPA 5HIEA 4I4FA 4IZAA 5M44A 2QOOA 4YTIA 4MXAA 5HG9A 3AT4A 4NSTA 3OXIA 5KHWA 4BI0A 3EZRA 3HA8A 3EQIA 3TNHA 3V5TA 3R9NA 3LCOA 3RZBA 3Q9YA 3DBQA 3S2PA 2JKMA 5IH4A 3HZTA 4FNYA 4O22A 1U5QA 4AW2A 2XM8A 1SNXA 1UA2A 2V7OA 3AD5A 4LRKA 2VWBA 4QMUA 1L8TA 1A48A 5FBOA 2G15A 3COHA 4KNBA 3UJGA 5I3OA 3KFAA 5AA9A 5EI8A 5FXQA 1Q97A 3GI3A 1XR1A 1UNLA 2UW7A 2W1EA 2SRCA 1UVRA 1GIIA 4JI9A 4FI1A 2CGUA 4J53A 4J1RA 4EK5A 5FQDC 3ODYX 4IX3A 4DEIA 3CR0A 1KE5A 4KAOA 1WBPA 3G6GA 4CV8A 4BBMA 4ENYA 3FJQE 1KWPA 3MI9A 2F57A 1IA9A 1ZZLA 2C6EA 4IBMA 5IUGA 3VS7A 4Q5HA 2YCQA 4FSUA 3WYYA 2W99B 2XJ1A 3DQWA 3OXTA 4D4SA 4HVSA 3NYOA 4O1PA 5JRQA 2OU7A 2PE2A 3R7GA 2HWOA 2V62A 2B7AA 4QP6A 3GUBA 2VWZA 3GB2A 4FF8A 4WSYA 2GPHA 3E7VA 3MJ1A 4QPAA 5T6KA 5TF9A 1Y8GA 4BWKA 5E90A 4M15A 4NJDA 3ZEWA 2G2FA 3NUYA 3A99A 1NXKA 5IEVA 3BBWA 3RNIA 1JSTA 2XYUA 3COIA 1GY3A 3BHHA 4TZRA 3PLAE 4F9CA 4GL9A 3DAKA 2E9PA 3D7TB 1GZOA 3K3IA 3MPTA 4RQKA 5LJJA 3CJFA 2G2HA 3MH0A 3QFVA 5E1SA 3Q6UA 4JOAA 5EYMA 5JGDA 4FIGA 2YZAA 5IMXA 5J7HA 1YWNA 4XG4A 5B2LA 3NPCA 4HCUA 2XB7A 2C30A 4TW9A 4C3PA 5IQHA 3MB6A 3CCNA 4K1BA 2B4SB 4L43A 2FGIA 3DGKA 4H58A 4D28A 2Y4PA 3BCEA 4ZZOA 1PXKA 3F5GA 3OP5A 3UO6A 3RAHA 4B8MA 1ZYDA 4ZMFA 4FV3A 3R8LA 2I0EA 3SOAA 3PWDA 1S9IA 3QC9A 5KBRA 4CEGA 5DIAA 2X9EA 4C4FA 3CY3A 5AJQA 3R9DA 2QHNA 4MXOA 5KE0A 4FGBA 2XIYA 4WBBB 2VTNA 3PZEA 5HVJA 4EH6A 3SV0A 5F94A 4LGHA 5IKWA 3MFUA 3PE1A 3II5A 1XH7A 3R9HA 3VBTA 3KULB 4C59A 4QT1A 2X9FA 4RJ3A 4O7VA 4RX8A 2OIDA 1W84A 1MRYA 2YEXA 3F88A 4EONA 2CGWA 3LFQA 3O0GA 4NKAA 2YHVA 3NVMB 5IDPA 2O64A 3NEWA 2UZDA 5FTQA 3SRVB 5EFQA 3WZEA 4AQCA 5J9ZA 2WO6A 3DT1A 4CGAA 2R3FA 4DLIA 4BDKA 3V04A 4IVBA 2C3KA 2YZLA 3VC4A 4DGOA 5FP6A 5M55A 3HL7A 2CNUA 3ZLYA 1SZMA 4M97A 3OF0A 4F99A 3TV7A 3POZA 4ONAA 4P90A 4YJRA 3R2YA 4II5A 1IRKA 2XA4A 1YXVA 4NUSA 2HELA 3F3ZA 3RHXA 3GT8A 4JL9A 5LMKC 4FA2A 1TQIA 2JAVA 3NNVA 4DA5A 3PIYA 4H1MA 4AACA 5I9UA 3Q6WA 4IXPA 1XWSA 4PPAA 3Q2MA 4U40A 4F9YA 5JKGA 3GEQA 3TTIA 1Y57A 3AMBA 5JEBA 4GW8A 4M12A 1XQZA 3A7FA 3LFFA 3PIZA 4IJPA 1MP8A 2XRUA 3DZQA 4CRLA 3U54A 3EFKA 5DT4A 2PPQA 1R1WA 2XK4A 4PNIA 4YBJA 4BDBA 3CTHA 4FT7A 4GSBA 5I9YA 3TZ9A 3JY0A 3UODA 2C6MA 1PKDA 3A2CA 3NUPA 1XH4A 4RWJA 2W06A 1J7IA 2GTNA 4O6EA 5IQDA 2WTKC 3P7BA 3V3VA 3BLHA 5JSMA 4PTGA 4DFNA 2W4OA 3FMHA 4L7FA 3Q4UA 4XV3A 4YR8A 3BQRA 4L45A 4AZSA 1OUYA 3SVVA 5ACKA 4MD9E 4ACCA 5HVYA 2XIKA 5EKOA 2F7EE 2P3GX 3AGLA 3CQWA 2R9SA 3BKBA 3FPQA 2QOFA 3UC3A 4ASDA 3FLYA 2GHLA 2ITTA 4HYIA 2JBPA 3O23A 4ZY5A 3V8TA 4P2KA 3AC3A 2GNGA 3SQQA 3U51A 2GDOA 4I93A 2UZNA 1FGKA 2V7AA 3QX2A 5IG1A 3IO7A 2F2UA 3RJCA 5M4CA 5HGIA 1GJOA 1REKA 3H9FA 4R7HA 2X4FA 2R64A 2XS0A 2IZUA 2Y7JA 3BV3A 3OY3A 4I92A 4FKGA 3RCDA 1KE8A 3O2MA 1VYWA 3I7BA 3KXHA 4AU8A 5C9CA 3TJCA 4JT3A 2DQ7X 2UW4A 2WEVA 3MFRA 3PFQA 4HVIA 4EOOA 3OVVA 3E64A 5AAGA 4NJ3A 3RKBA 4FTRA 3CP9A 1MUOA 3G0EA 3PWYA 4GU6A 4HYHA 1KE9A 5CSHA 2NPQA 4UMRA 3E5AA 3FKNA 2R3LA 4KRDA 5JH6A 4GUBA 4JIAA 4IM3A 2W1IA 4E7WA 3QKKA 4FEQA 4AT4A 3QQLA 4IWOA 4RA5A 5DT3A 1URCA 3NAXA 3JY9A 1WVYA 4G3FA 4GIIA 5CSVA 2ZDTA 1OGUA 4AXAA 4QMVA 4RJ6A 3VS0A 4I1ZA 4K8AA 4BDHA 5HHWA 3EKKA 3QZIA 3KN5A 2OZAA 4BI2A 5BMMA 4WKQA 1MQBA 2EXCX 4BHNA 3FY0A 4H3PA 2ETMA 4X3FC 3FMLA 3UBDA 3SW7A 2VX1A 3MY0A 5KMMA 2YM4A 3LFAA 5BYZA 5CAVA 2QKRA 5C4LA 4FEXA 4YUQA 4NFMA 3C4ZA 3PJCA 3KVXA 4IJ9A 4OTWA 3OFMA 2C0IA 4GFGA 3WI6A 4CKJA 4JVGA 4YBKA 5CF8A 3AG9A 3UG2A 4YLKA 1ZOHA 3WE4A 2C0OA 1P4OA 3ACJA 4KBAA 2UZTA 4CZTA 2ACXA 4EOKA 2CCHA 3FBVA 3V8SA 4BBEA 2CPKE 1OBGA 1BL7A 1H07A 4GFOA 4CFMA 4I22A 5EDQA 5K4JA 2PZRA 4PPCA 4ZJIA 3JR1A 3TUBA 4GJ2A 3UPXA 4OAVB 4BCJA 3C0IA 3W16A 1OKYA 1UU3A 3CD8A 1CMKE 2IG7A 3NVKI 3LOKA 3D7ZA 3E92A 4BGQA 3H3CA 4HNFA 3TKUA 1NVSA 3L8SA 5LMBA 4ZSAA 4OLIA 5CEQA 2JDRA 3R7OA 3SDJA 1PF8A 1S9JA 5BPYA 3FQSA 2NRUA 2FO0A 2UUEA 1Q4LA 2VO7A 3C51A 4FTMA 4U42A 4OBOA 3LMHA 2ZV9A 2C68A 4M8TA 3ZUUA 3OOMA 3R71A 4BTKA 4CYIA 4F1MA 3HMIA 2UZVA 3LM5A 2QOLA 1HCKA 3R30A 4LFIA 4QMOA 4X7QA 4EK6A 2WOUA 2QOBA 1PXMA 3Q9WA 5LCKA 4BTFA 3R7EA 3R83A 5D1JA 4W4WA 5CI7A 4QPSA 1JKSA 2J5FA 2ETKA 3TM0A 4FMQA 5ETIA 1I44A 3TV4A 2HWPA 4QP2A 3EN6A 3LM0A 4O84A 3QTXA 5E91A 3FV8A 2HY0A 3NYNA 4U5JA 4ZK5A 2B52A 5K5NA 3I79A 3G90X 4U43A 4YJPA 3R7VA 4BICA 2R3QA 4UZDA 3SG8A 3RWQA 4RC3A 5EG3A 3F7ZA 1UU7A 3PVGA 4YTFA 3DNEA 2B54A 4PRJA 3PJ2A 5L2TA 5A4QA 5IA5A 5FDXA 3UDBA 2ITNA 1V0OA 2VWVA 4RIYB 3D2IA 4BCKA 5ANDA 4O2ZA 1BX6A 4F1TA 4MCVA 3VO3A 3AMAA 4A9TA 3QLFA 2QOHA 4UB7A 3KC3A 2WU7A 2C5YA 1J1CA 4NKSA 2JGZA 3SD0A 4MXXA 3Q5ZA 2QQ7A 2XF0A 2CJMA 2J6MA 5E8XA 4EYMA 4KIPA 4EZ5A 3GGFA 4TWOA 4PDPA 4QP1A 4O7WA 1W7HA 3MIAA 1R0EA 4ZIMA 3FSFA 1BYGA 4G6NA 5ETFA 2JAMA 4CFVA 3ID6C 4C4JA 4USEA 1CSNA 5H8GA 3F7WA 3OMVA 4ZZMA 4HJOA 3VJNA 4DCEA 1BI8A 2OZOA 4FT0A 4J7BA 4TYIA 3N4TA 4ALVA 2WD1A 2X2LA 4MXZA 3UC4A 4FG7A 3U87A 4EUTA 3E62A 3VW8A 3D5WA 1ZRZA 3FLWA 3FMDA 1K3AA 2P55A 3T9IA 2B1PA 2QU6A 2JIVA 3BGZA 1DI8A 2HENA 4MD8E 3W55A 1O6YA 3GCVA 4KRCA 5LOHA 4CZUA 3QXOA 3BLQA 1FPUA 4N6YA 3GCQA 4FVRA 4DFXE 3EQDA 3OROA 4FV9A 3ZRLA 2ITUA 2GNIA 3BYSA 3RPVA 3FXXA 2WZJA 4DAWA 5AUYA 3ZO1A 1G8AA 4UYAA 2YM7A 4XG7A 2HOGA 1OUKA 4GKHA 3A4PA 4FZ7A 4QMLA 3ALNA 4EH7A 4FG9A 5FXRA 2XCHA 3QHRA 3PY3A 4XRLA 2YDJA 1JKTA 3O50A 2R0UA 4V0GA 3RINA 1Q24A 3V5QA 4ENXA 3TEIA 4JBVA 4R5SA 5CS6A 4B7TA 1U4DA 4IACA 2ZV7A 5AUZA 5FTOA 1V0BA 2CKEA 4PL5A 3UNZA 4GK4A 1Q3WA 2UZBA 2WMAA 3KXXA 2DUVA 4FTTA 4MQ1A 2XNMA 3R2BA 4TYHA 1XH5A 2CN5A 2XNBA 2XP2A 5AP0A 3NW7A 4APPA 3PXZA 3GU8A 4CRSA 2F4JA 4GCJA 5AR2A 4WIHA 4YJUA 3UOHA 4F7JA 3R8VA 4FSNA 3UZRA 2AYPA 3CTJA 3TNPC 3OEZA 2W5BA 5HNBA 2BMCA 4DEBA 1KUTA 4EH3A 3KEXA 1SNUA 3W2QA 3FI4A 3M2WA 4X2KA 4U41A 2X6DA 2H96A 3OW4A 4FSYA 4TWNA 4XG9A 1ZYSA 5C8MA 4TYJA 1CTPE 3IOPA 3MTFA 4M66A 4D2SA 2XYNA 4RIWA 2Z60A 3E88A 1E9HA 1H26A 3PYYA 5HIDA 4YURA 1O6LA 2RL5A 4WRGA 3RVGA 3UZPA 5IQIA 1SYKA 3SOCA 3CSVA 4MKCA 4C4HA 4M0ZA 4RVKA 1PW2A 2UV2A 3P08A 3D14A 3E87A 3P78A 5JGAA 4XLIA 4EKLA 5A4CA 2UZUE 4IDTA 2J0JA 3DBDA 2W96B 3I1AA 3QTRA 2IW8A 2B9HA 4X3FA 2HW7A 4GYIA 3BX5A 4DTBA 4CCBA 5L2IA 4KBCA 4A06A 4AN9A 5D11A 4IIRA 5A4TA 4FKRA 4BWXA 4FKWA 3A61A 3ERKA 4FKVA 3ZSGA 4G3CA 5M06A 3DS6A 4QPMA 2I0YA 4CG9A 2B55A 3D94A 1KV2A 3O51A 4HPTE 4EZ3A 5L2QA 4UWBA 2J9MA 3Q4ZA 4Z9LA 3RZFA 4Z7HA 4FV4A 3K5VA 4V04A 2OW3A 4GMYA 3LFCA 4E6QA 3ZDUA 5IUHA 3OTVA 4PMTA 1NY3A 3NYVA 1QPDA 5TT7A 4FV8A 3CQUA 4GYGA 3LMGA 5EHYA 2A4LA 2ITOA 2WKMA 2Z2WA 4N0SA 3IKAA 2R5TA 3O8PA 1JSUA 4GS6A 2YM3A 3WE8A 1ZOEA 1M2PA 5EK7A 4ACDA 3KCKA 1OL7A 4DFZE 5G6VA 3VS1A 3NUNA 4XV2A 2A27A 2V0DA 3BHUA 3O17A 5AEPA 4IAZA 4CMUA 2C6DA 3VBYA 4CFFA 4PDYA 1ZMWA 4O83A 3GU6A 4OBPA 4BVUA 3QTUA 5H3QA 3C4EA 3FZPA 4JBOA 2PZPA 4LG4A 3AC2A 3QUPA 3VUIA 3GQIA 4F9BA 5LCJA 3UMWA 4F6WA 3KMWA 3F5PA 3FZOA 3U9CA 3H10A 3S1HA 5M56A 4O0TA 3AOXA 3R21A 1OIRA 3DBFA 4YGAA 3W8LA 4IB0A 3OHTA 3G2FA 4JNWA 3DXQA 5JFWA 1V0PA 2EB2A 3BEGA 3CXWA 3SLSA 3R00A 2ZAZA 3HV5A 3VHEA 5DYJA 4NM3A 3HMOA 3S00A 5IMEA 2GQSA 4I94A 2C1AA 5CY3A 4LMNA 4RGJA 2WTIA 3F3WA 1JAMA 3KCFA 2IPXA 5EOBA 5KBQA 3NDMA 3DTCA 2W17A 3QA8A 5FEQA 3V5WA 2GMXA 3LXNA 5DT0A 5FXSA 3UG1A 2ZB1A 4I6FA 2W05A 3LE6A 4D5HA 1YKRA 1YDSE 1H27A 2PZ5A 3DPKA 1REJA 1WFCA 3GC9A 3I5NA 3QTZA 4IEBA 4J99A 3P79A 4EH5A 4Y5QA 5BUIA 4MNEB 2ZM1A 3ZFYA 3K5UA 4S2ZA 3DXPA 1OL1A 2OJIA 4QP3A 2BZKB 4MBLA 1YXUA 3QWJA 5KHXA 3GOKA 1H1RA 1PXIA 5HLNA 2QG7A 3UVQA 2EWAA 4EQMA 5E1EA 4J8MA 5JN2A 2H6DA 4I6BA 3JYAA 3S3IA 2IJMA 3WOWA 3CEKA 3LW0A 3FMJA 4HYUA 4F6SA 4DT8A 3ZC6A 1P14A 3E8DA 4DBXA 3PVWA 2HXLA 3R1SA 4TYGA 4EBVA 5GZ9A 5K0KA 1H0WA 5F95A 4M69A 5E9EA 2XJ2A 2VTRA 3VBXA 3BE2A 1OITA 2QR7A 2YIYA 2VTJA 4QOXA 3AD6A 5AP7A 1WBSA 3U4WA 4EH8A 3ZRMA 2B0QA 2XCKA 3RI1A 4UXLA 1K2PA 3CGOA 3ZFXA 1OBDA 4U44A 4YC6A 4FVQA 3T3UA 5M53A 5HBJA 5DPVA 4AAAA 3ZXZA 5GIPE 4QMNA 4GJ3A 1Q3DA 2VWXA 3LHJA 5J8IA 5HX6A 3NUAA 2CLXA 3DB6A 1H1QA 4G3GA 4LL0A 1MRVA 1WCCA 2WQMA 2Q83A 3ZXTA 4BB4A 4YZBA 3TZ7A 4BFMA 2A0CX 5IH5A 1F0QA 1OVEA 2OJJA 4PTEA 4J71A 4JLCA 3VBQA 4XH6A 3VS2A 3OUKA 5KMIA 1PXJA 3EQHA 4YHFA 3SKCA 5CEIA 4EEVA 4UMTA 4JRVA 3ULZA 5TKDA 3FC2A 3L9NA 2YERA 5EW8A 4F6UA 5AR3A 3TACA 4BTJA 2PWLA 5AIKA 3NWWA 4P5QA 4AW0A 1GNGA 4EL9A 3BHTA 2J0MB 4MVFA 2FUMA 4KKGA 3R04A 3VW6A 3EZVA 4KIKB 1Y6BA 5BUJA 5M51A 4EWQA 4JG6A 5A14A 1J3HA 5CT0A 3LIJA 4M13A 5KMKA 4F7NA 4QMPA 5I0BA 3ZSHA 4AT5A 4IQ6A 4R1VA 4DEHA 2CNVA 2OXYA 4Z16A 4H39A 3I0QA 4QYGA 2GU8A 1NW1A 4MD7E 2X81A 4UXQA 3EFWA 4DFUA 4RFYA 5FGKA 3TV6A 5HLWA 4EI4A 4J97A 4LQMA 3OBGA 1V1KA 2PMNX 3R28A 5CI6A 4GVAA 4MWIA 5CEMA 1LR4A 5HORA 2XNEA 3HKOA 3GFWA 4NTTA 4MBJA 4DCAA 1GAGA 1Z9XA 4FT3A 4BIDA 3OT3A 2QONA 4AG8A 3O8UA 1M17A 4JDJA 2QHMA 4WUNA 3H9OA 3TWJA 1UNGA 5IA2A 3MVMA 1PMUA 2YJSA 4FICA 5J95A 4JR7A 3FI3A 4EHZA 4LUDA 1Q41A 4U3YA 5DOSA 1PXPA 1UWHA 2VWWA 2OH0E 4I5CA 2UW9A 5JFSA 2C5XA 1PMNA 2IN6A 2JDTA 1NVQA 3A4OX 4AZEA 2WTWA 2W7XA 4BCQA 3ORLA 2QURA 1OKWA 2PSQA 3GP0A 5IUIA 4HGSA 4FIHA 1JKKA 2GCDA 2EU9A 1JSVA 3W33A 3PPZA 4ASZA 3ZTXA 1Y91A 3FYJX 2IZSA 4FK6A 4IANA 4TXCA 4QP9A 3ETAA 3VWAA 2X0GA 3PVBA 1APME 4FOCA 3W2RA 3ZOSA 3IDBA 3VS3A 4ID7A 4DH7A 3UO5A 2XVDA 1FVRA 3Q5IA 3V5LA 2E9OA 1SM2A 4I41A 4F9WA 3W32A 4TKSA 4TRLA 3NMUF 4YMJA 1ZWSA 2IVUA 3OTUA 4YLJA 2R3OA 4NCTC 4FTOA 2YCSA 4UN0C 4XV1A 2YN8A 3MW1A 4MBIA 5EM8A 2B9FA 4WD5A 2RG6A 2OF2A 3UOJA 4E73A 2V22A 2LAVA 4IB5A 4QD6A 3CE3A 4RJ8A 5JMSA 4NK9A 2C6IA 3T9TA 4JDKA 1H25A 1GOLA 4BBFA 5GZAA 3UYSA 3H0YA 4BDJA 4L53A 3C5IA 2HZ0A 2YABA 1KV1A 2BAQA 2X8DA 2O0UA 4YPDA 4U7ZA 2RKUA 3RAWA 4X2NA 2V5QA 3W2PA 4BCHA 5ETAA 4K0YA 3TDWA 3D7TA 4FKTA 2F7ZE 1YHWA 3C5UA 2VAGA 5E8SA 4WNMA 3R1YA 5KO1A 1QCFA 2X8IA 1PYXA 3DFAA 1W83A 3RK5A 3AT2A 5TR6A 4EJNA 4PTCA 5DN3A 4C34A 3CJGA 4FNXA 2ETRA 2XBJA 2VTPA 2WQBA 2J5EA 2VNWA 3EQGA 3L8PA 4IX5A 4C3RA 2VTLA 4FEWA 4JAJA 4FKIA 2PVLA 4GRBA 5AX9A 4CKIA 4CTCA 2E9NA 2HXQA 3V5JA 3BE9A 4CFWA 2YM8A 2WMTA 4OBQA 4TY1A 2R3IA 4OTRA 4RLLA 2X4ZA 3COMA 3OY1A 3R73A 5D9HA 2CDZA 3EKNA 2RGPA 3S95A 3LKMA 5C27A 1JNKA 4A9RA 5CVGA 5FEDA 5T68A 4FE2A 4IZ5A 3RK9A 3DAJA 4AZVA 1YW2A 2FYSA 4XCUA 5AV4A 2BFXA 4O6LA 2F9GA 4BCNA 5K3YA 2BKZA 2QCSA 5A54A 1TKIA 5GNKA 2BRHA 1ZMVA 3OXZA 5BMSA 5M57A 2Z02A 2VGOA 1DAWA 5CEOA 5IPJA 5IISA 4ITJA 2VTIA 3KULA 4RPVA 3NUSA 3ANQA 3Q52A 1SMHA 3RBWA 4X2JA 1Q8TA 2BRMA 3ZZWA 4EOIA 1O9UA 5E8YA 4G5PA 3PY0A 5A9UA 2X2MA 4H3BA 4R1YA 5DVRA 1B39A 3N51A 4HYSA 3DCVA 4FZDB 5HOAA 1AD5A 4ZJVA 5HNGA 2BRBA 3MJ2A 1FMKA 3RALA 3SRVA 5A4LA 5AP4A 5HIBA 3Q9ZA 5CU3A 3RTPA 3DKOA 4FV5A 1AGWA 1ZMUA 4Q2AA 3FHIA 4E26A 3FXZA 4ERKA 3BYVA 4BCPA 1A06A 1OB3A 3I60A 1AQ1A 3VS6A 4RX5A 3U6IA 4G17A 4FYOA 5AM6A 2YCFA 4IW0A 4O27B 5FTGA 4GVJA 2LGCA 4C36A 2YISA 3P5KA 5BVEA 5EQYA 5HCYA 1WVWA 1WVXA 4JR3A 4D4RA 3IW8A 4O0UA 5IEYA 5KCVA 3GU4A 3R02A 5LXMA 2WMWA 2PL0A 4MHAA 3E8EA 2ZV8A 4L3PA 1I09A 3S0OA 3O8TA 2O5KA 3P4KA 3VQUA 4FUYA 5JZNA 3OD6X 5T3QA 2GNLA 2Q0BA 4S32A 2X6EA 4BGGA 3WF5A 5IEXA 1YHVA 3GQLA 4RC2A 2G9XA 3WBLA 4JG7A 2FSOX 4AOTA 4C02A 5JGBA 4ACMA 1Q8UA 5HTIA 2XEYA 4RT7A 5AA8A 4YPSA 3MPAA 1BL6A 2KTYA 4ZTHA 2C0TA 3E93A 3MN3A 4I20A 2UVYA 3NCZA 1TVOA 1BMKA 4YC3A 4UMUA 5L6OA 2YAKA 2CCIA 3RP9A 4ZTSA 3QQUA 1ATPE 3Q53A 4C38A 2PMOX 4RFZA 1BLXA 1JWHA 3HVCA 3G6HA 2OK1A 3CPBA 3QAME 4G5JA 2O63A 5CVFA 4NIFA 3MV5A 4EUUA 2GHMA 2J0KA 4FNZA 4RWKA 3VUDA 2HZNA 5C4KA 1PXNA 3W2CA 3OZ6A 4HVHA 5CF4A 4ANMA 3JUHA 4UWCA 2C5VA 2OWBA 3IK3A 3UIMA 3EHAA 4CQEA 3QQKA 4AZTA 4BKYA 5LWMA 3D15A 4L01A 3V01A 5HTCA 2WNTA 3HECA 2XKDA 3DJ7A 4FSMA 4XYFA 3TG1A 4DLJA 5JFVA 2HIWA 5GZ8A 1YDTE 4CQGA 4O86A 3NGAA 3JVSA 5FM2A 4PP7A 3MS9A 4L68A 3HEGA 2HZ4A 4YZNA 4AW1A 1H1PA 4A7CA 5IU2A 2FVDA 4G16A 5CQUA 2UW5A 4FTNA 3VRYA 5CEPA 3KXGA 4IVCA 5I9ZA 5BVWA 4EQUA 1FVTA 3CKWA 1F5QA 4CVAA 3F3VA 4GT3A 4JG8A 3N4VA 1NVRA 4TN6A 4AA5A 3F2RA 2XIZA 4WSQA 5CU0A 3RPYA 4IC7A 2ITQA 1Q5KA 1XH9A 3HDMA 1OECA 4ZTNA 4ANBA 3UQCA 2UW0A 5AAEA 4YLLA 2PYWA 5M07A 4P5ZA 3H4JA 5K9IA 5CSWA 4CFUA 3N9XA 4D2WA 2PMIA 5KNJA 3Q60A 4GT5A 4NCTA 1RDQE 3ZLXA 2OF4A 3OG7A 3RPOA 3LMIA 5LMAA 3AXWA 1U59A 3MVJA 2VWYA 2YA9A 4FL3A 2YJRA 5B2KA 3WILA 4YZMA 3P0MA 4YTCA 3VIDA 4QP4A 1NA7A 4GFMA 2ZV2A 4RIXA 4O7YA 4ACGA 5CU6A 2HYYA 1QPCA 2HY81 1G8SA 4AF3A 1H08A 2XNGA 1H8FA 4QTCA 2OKRA 2YIWA 4AZWA 4U45A 3C13A 5HE2A 2ZM4A 3R22A 4OT6A 4RX7A 1TQMA 2VWIA 4I3ZA 4BGHA 1W0XC 2A1AB 2JDVA 5AP3A 3HV4A 5IQFA 4OTGA 4LRMA 4X0MA 5KMJA 4CCUA 2A19B 4AE6A 4R5YA 2BRGA 4AOJA 2XM9A 4ZSGA 1UNHA 4QNYA 3C4WA 3PY1A 4M14A 3ET7A 5DLSA 5DNRA 5GJDA 4D2VA 3E7OA 3JXWA 4QP8A 1YI4A 3SG9A 1MRUA 4FV6A 4C57A 2OZAB 4FZ6A 5HG8A 4NFNA 3KRRA 4KINA 3NAYA 3QGYA 3U8WA 2Y4IC 2VX0A 1PYEA 3FLNC 4JAIA 5D12A 3UP7A 3ZZEA 4Q9ZA 3TTJA 2BZHB 2WTDA 2EXMA 3FDNA 3MFTA 3FPMA 5AR4A 1QL6A 2E9UA 2FH9A 4QNAA 3HRCA 3OOGA 5D41A 5CX9A 4BCOA 4YHTA 4BDAA 2PU8A 1YHSA 2X7OA 4EWHA 4MF0A 4EOSA 3HA6A 4F7SA 3QZHA 3RHKA 4U97A 3EN5A 5BVFA 5A6NA 2JDSA 2YM5A 4AA4A 4EHGA 5TE0A 4NZWB 5LWNA 4B4LA 3R1QA 3WF8A 5JFXA 4ORKA 3KA0A 4NTSA 3WZDA 5AUVA 3ZFMA 4FTAA 5EOLA 4MWHA 2BILB 5FG8A 4O96A 4EQCA 4F0IA 4FTJA 1PMVA 4Y8DA 5DG5A 2JLDA 4PQNA 4GKIA 2ITXA 3BQCA 4E20A 1YOJA 4FKQA 4O82A 3KKVA 3PJ3A 3FXWA 3WZUA 3R7UA 4QYEA 3QQGA 4FSQA 5DHJA 3HRFA 2F2CB 3MPMA 3MA6A 3GOPA 3EL7A 5CAPA 4AX8A 1BKXA 3KK8A 1YI6A 3A7IA 4X6QC 3SW4A 4A9SA 3DJ5A 5M4UA 5KKRC 1Q8YA 2BIKB 3MBLA 3ZC5A 1LP4A 1WBOA 4XMOA 2C5NA 2WTVA 3GU7A 5I4NA 1YWVA 4UWYA 4DGGA 4RVLA 1P5EA 3HV6A 3PTGA 3UNKA 2GHGA 4N4SA 1CM8A 1WAKA 2OG8A 4H1JA 2REIA 3DB8A 2BDFA 3NNWA 4GU9A 2PUIA 3MWUA 4L3LA 3FQHA 4TWPA 4U81A 4RSSA 5H2UA 3NLBA 1GIHA 5JZJA 4NWMA 5HZNA 3O71A 3W2SA 4ZMEA 3BU6A 3T8OA 4AS0A 4DINA 1JKLA 3PLSA 4L44A 4FEUA 3Q3BA 3FSKA 2WMXA 1RW8A 2XNOA 1OZ1A 1H00A 4R7BA 4UALA 4RVTA 4A4LA 2GS6A 2UW3A 1YWRA 3FMEA 2P33A 3DXNA 3P9JA 4L8MA 4BIEA 4FIIA 3FI2A 2HZIA 3ENMA 3G9NA 2QI8A 3QZFA 3NW5A 3BELA 5LARA 3ALOA 1VJYA 2QO7A 3QTWA 4ZP5A 4IAYA 5CAUA 3FEGA 3DDPA 3EL8A 2QVSE 4IH8A 4CMTA 5JQ8A 4E5WA 4J95A 2X8EA 1XBAA 4RZWA 4A4OA 2PVHA 2OXXA 4Q5EA 5CXHA 5AM7A 4ZY6A 4WUAA 4O1OA 5K4IA 5D10A 4UEUA 4Y5HA 4O81A 3QX4A 4IAFA 4CV9A 2PZIA 2OSCA 4EKKA 3LQ8A 1BI7A 3AC1A 2PUUA 2YACA 5AV1A 2QU5A 3ZUTA 1J7LA 2WTKB 3ZH8A 1H1WA 3UQFA 2ITVA 1H28A 5L8KA 2G1TA 4K11A 4LGGA 2XUUA 4JBPA 1IASA 2XKCA 4YNEA 3GNIB 5HX8A 3G51A 5CTPA 3PSBA 4RWIA 2AUHA 2B9IA 2X7FA 5ANGA 5J87A 3KRXA 4B8LA 4BY9E 4H3QA 1B6CB 4ZOGA 3RWPA 2BR1A 4TL0A 2YDIA 1KOBA 4IX4A 4EBWA 5I9VA 4RC4A 3P7CA 4G34A 3C7QA 4C61A 4ZSEA 2VNYA 4YU2A 4FIJA 5AP6A 2YM6A 4RIOA 4AGWA 1YXTA 3GCPA 2XNNA 3DBEA 3ORNA 5AR8A 5JRSA 4AGCA 5HU3A 3VN9A 4HNIA 4V0GB 3DK6A 5FBNC 4FX3A 1X8BA 3H0ZA 3HV3A 1W82A 3Q32A 2ONLC 4PF4A 4RX9A 4ZLYA 3RCJA 4IE9A 3MESA 3VAPA 5AMNA 3DY7A 3P1AA 1O6KA 3DK7A 4WO5A 4ZS4A 5BX0A 2ITYA 4AN2A 3BBTB 2WIPA 3EFLA 4J8NA 2PUNA 4KKEA 2I0HA 1XH6A 3R8UA 4KSPA 4LOPA 3QQHA 4ASEA 2I7QA 3LFSA 4IDVA 4ALWA 3KRLA 5GHVA 3I4BA 4K9YA 5AIRA 3ZM9A 3PJ8A 5GINE 4HCTA 4G9RA 1YVJA 4O0VA 4MH7A 4ZTMA 4D2PA 4FGRA 4IWPA 3BHYA 2PVRA 4IFGA 3TNWA 4DH1A 4F64A 4MX9A 5K5XA 5LVNA 2QOKA 3BWFA 1OPKA 2XIXA 4IWQA 3PP1A 4PMPA 1GZ8A 3MY1A 3QRIA 1FOTA 3DZOA 3EQBA 3FMMA 3MIYA 4G3DA 4E3CA 4G9CA 1Z57A 3OCSA 4FSRA 3UGCA 4BCGA 3ULIA 2X7GA 4JJRA 4W9WA 3POOA 4XOYA 3B2TA 2J7TA 4M67A 3D5XA 5AR5A 4RJ5A 3VJOA 4E4XA 2XK7A 2PK9A 3ZUVA 2AC5A 4X3FB 3SXFA 2P0CA 2OJGA 2GQRA 5J5TA 1WBTA 4LOOA 3ORIA 3IDPA 3OS3A 2B9JA 3F66A 4ITIA 4BDIA 3ROYA 3EFJA 3LFNA 4E4LA 2FSLX 2RSVA 3MH2A 4FL2A 3UVPA 5HICA 3VF8A 5CZHA 3ZM4A 1GIJA 3ZONA 3A8XA 5CEKA 2YLEA 4G3EA 4AA0A 1M7NA 4LOQA 4AGDA 4DG3E 1IA8A 3VULA 3A8WA 2XRWA 2R4BA 3JPVA 3R63A 4FV1A 4IB3A 3NR9A 3ZEPA 2BUJA 3KY2A 4N70A 2BVAA 3I5ZA 3KXNA 5TO8A 3Q9XA 2YIXA 4XS2A 3HMPA 4N57A 2BDJA 3CQEA 4QRCA 3RM6A 3LQ3A 3DU8A 4UZHA 3OWJA 2CKOA 1Q62A 2ZJWA 2VV9A 2C6TA 2VO6A 4BCIA 5HQ0A 1H0VA 1JQHA 4FV0A 1HCLA 5IF1A 1CDKA 4L42A 4D1ZA 5F20A 5KMOA 5DRBA 2YITA 3VHKA 5DEWA 4L9IA 3DDQA 1U5RA 2WMRA 4PUZA 2R2PA 3KL8A 4MNEA 5AP2A 3ZLSA 4ANLA 2VTOA 4D2RA 5L2SA 3E8CA 2WELA 3DAEA 3HX4A 3LXLA 3QHWA 4O91A 4DH5A 3VUMA 3F82A 4IAIA 4D58A 5FWKK 3OWKA 2J4ZA 3KXZA 2JDOA 4CSVA 4O0XA 4G31A 2C4GA 3DV3A 4P4CA 4BYJA 2VO0A 5LVLA 4Y83A 1ERKA 2OO8X 1RQQA 3OW3A 4GG7A 5EKNA 3FMNA 2RFSA 3OCGA 2CN8A 2VRXA 4NM5A 3QQJA 3D5UA 4FKSA 2Z7RA 1W98A 4PNKA 5EW3A 3AQVA 4EH2A 3R01A 5ANKA 4GEOA 3EN7A 4BKZA 3LJ1A 5AR7A 2Z7LA 5KMNA 3CLYA 5HEZA 1URWA 1Y8YA 2WB8A 3NUXA 3C50A 5ITAA 4EJ7A 4WA9A 5D7VA 5EW9A 4FZAB 5BVDA 4F1OA 4AP7A 3U6HA 1CKIA 3HYHA 4E93A 2PVMA 4LV8A 2UZLA 3REPA 3ZBXA 3EB0A 2RFNA 4PDSA 5B7VA 5BNJA 1U54B 3IDCA 4PV0A 3TUCA 5AP1A 4LUEA 5FRIA 2R0IA 3PA3A 2BTRA 4MK0A 3PP0A 4YNOA 2HW6A 2ERZE 3VS5A 4A07A 4G2FA 2ZOQA 3G0FA 3NIEA 5DI1A 3EQPA 4RWLA 4R7IA 1DS5A 4R78A 4IM2A 3KXMA 5ICPA 3G15A 4MYGA 3FLSA 2ITWA 4DFBA 2BZJA 4ANNA 2I1MA 3BZ3A 3ITZA 4J96A 5FUTA 4V05A 1VYZA 5B2MA 1STCE 2JFMA 4M69B 2WXVA 4PP9A 4JQ8A 4QO9A 1M14A 4U80A 3I6WA 3BI6A 2FA2A 3NSZA 3LLTA 3PUPA 4I21A 2NRYA 4FKOA 4DG2E 4YSJA 2CKPA 2F7XE 5CVHA 4QYFA 4OTPA 2VD5A 4UYNA 5CU2A 3DA6A 3ODZX 2J0LA 4IFCA 4XEYA 3PG1A 3HNGA 5EDPA 5H8BA 3WF7A 3FQEA 2QKWB 5HCXA 4UX9A 3FZRA 2PUPA 3UVRA 4D0WA 4ZSJA 1YXSA 4C4EA 4OTHA 2QNJA 2RIOA 4F08A 2OICA 2YIRA 1L3RE 4JDHA 3PZHA 4JQEA 4XG3A 2GS7A 2QD9A 4PMMA 1XKKA 2R3MA 2ITZA 5HO6A 4XX9A 3TNQB 4K2RA 3DTWA 2ONLA 2WEIA 3IS5A 4IVDA 4A9UA 2W4JA 4ZY4A 5IH6A 2PE0A 3EH9A 4WRSA 4BR3A 1EH4A 2ITPA 1OPJA 1PKGA 1ZXEA 2F49A 3LZBA 4XJ0A 4O7ZA 5E4HA 4B0GA 4DFYA 4HGLA 4E4MA 4K33A 4FYNA 4I6HA 4WNKA 4BYIA 4XNEA 4QTDA 3QZGA 2OH4A 4FIEA 5FEEA 4ASXA 5HD7A 3DBCA 4HZRA 3EN4A 3OT8A 3QBNA 4EH4A 3IW5A 5ANJA 2CKQA 3QTSA 3TN8A 4A4XA 2C3LA 2DYLA 2GFCA 4IB1A 3EOCA 5EI6A 4R3PA 3W1FA 4IADA 4QMYA 3F69A 4LGDA 5CENA 2J0IA 2VTSA 3FC1X 4MQ2A 3QQFA 5ETCA 4KUJA 4UY9A 2CNQA 2VTMA 4XHKB 3QUDA 3SXRA 3C4XA 3VVHA 1IAHA 3KMUA 1OL2A 2R3HA 5C26A 4FTCA 5C1QB 1OIUA 2QO9A 2OJFE 5A46A 3NNXA 2CHLA 4HGTA 5CNOA 4S30A 3I7CA 2UVZA 3CS9A 4M84A 3ATTA 3H30A 4XBUA 4O0RA 5EH0A 2X39A 4OR5A 2E9VA 3IW4A 3MVHA 4KKHA 4BZNA 3PPKA 4QQCA 5IA3A 5EYDA 3R8MA 4ANQA 4XP3A 3RAIA 4L67A 3E63A 5EYKA 1LUFA 1ZY5A 3BYMA 3HGKA 5DRDA 5JK3A 1SVEA 2BHEA 4IHPA 3O7LB 4OT5A 5HESA 2R3GA 3FZTA 3MVLA 2OGVA 5I3RA 2GFSA 4ANSA 4O7RA 5CQWA 2XH5A 2Q0NA 5IQGA 2VU3A 3G9LX 3PXYA 4E6CA 4A9YA 4JS8A 5HE1A 5FDPA 3BIZA 5M4FA 3NRMA 3F9NA 4ZAUA 1OI9A 3VUHA 1YOMA 2WIHA 1JOWB 3BRBA 1UU8A 3M42A 4TTHB 3H9RA 3KREA 4AOIA 2A2AA 3WARA 3ATSA 3FZSA 4QYHA 5L8JA 4RFMA 4RMZA 5HVKA 2H9VA 3TXOA 4OTQA 3TZ8A 4ZLOA 4OAUC 3K2LA 5C8NA 4FKUA 3UIUA 3RMFA 4LMUA 1KOAA 3UMXA 5AAFA 3BPRA 4FG8A 4AWIA 4JX3A 5E92A 2VWUA 5DBXA 3QD4A 2ZYBA 3QRUA 4OGRA 4PMSA 4ZSLA 5F4NA 4NYEA 3NIZA 2WPAA 1UKHA 3GCUA 5BUEA 3F5UA 2VUWA 4BDFA 4L52A 5EHOA 4YP8A 5BVKA 4BC6A 4F70A 4L3JA 4BRXA 2WMQA 5AUTA 5KX8A 3QKMA 3OCTA 3AGMA 2WU6A 3L8VA 4JDIA 2XK3A 2WMUA 4FV7A 4D1SA 4CLJA 3EQFA 3PVUA 4EC8A 5KMLA 3KRWA 2PY3A 4D1XA 4I24A 3QCSA 1R0PA 4L46A 3VS4A 4M3QA 3DNDA 5E7RA 4KIOA 4RA4A 5ANIA 5HBEA 3AC8A 4BDDA 2IW9A 4GH2A 1U46A 5BVOA 3F3TA 3PG3A 4R6VA 5C03A 1UU9A 4FVPA 4QMMA 2WMVA 3FLQA 3CBLA 5ACBC 1RE8A 2GNHA 3HUBA 4NW6A 5DGZA 5H9BA 5CAQA 5J9YA 2BIYA 4U8ZA 5J1VA 4U79A 2UZEA 1XHAA 2VN9A 3GENA 4FTKA 1KE6A 5AFVA 1SVHA 1Q8WA 3KQ7A 4XG8A 4O38A 5L3AA 4CXAA 1OM1A 3ELJA 2OJ9A 3BU5A 5AV3A 3UPZA 3HP5A 5EYCA 2BPMA 4HZSA 2W5HA 3EIDA 2YIQA 5HE0A 4AT3A 4UMQA 4RJ7A 4AW5A 5IA4A 3ZDIA 2C6LA 2R3NA 1FVVA 1PXLA 3E3BX 4EH9A 2VX3A 4XG6A 2R3JA 1UWJA 4MAOA 3I0OA 4HOKA 3TZMA 5J7BA 4RBLA 4OTDA 4UBAA 4NU1A 3LFEA 3LJ2A 2Y6OA 4E1ZA 1M52A 5DE2A 2GSFA 2XKEA 4F65A 4ZS0A 4ANOA 3QGWA 1LEZA 3CD3A 4GUEA 1QPEA 2XKFA 3BWJA 1H01A 1Q61A 2OI4X 3P7AA 4RG0A 3R8PA 3QUEA 4DEGA 3K54A 1IAJA 2I0VA 1UKIA 3R9OA 3V6RA 3WZKA 2WHBA 5LVOA 3EQRA 1J7UA 1T45A 2JKQA 4CD0A 5IQCA 5FD2A 4LL5A 3BYUA 3FKLA 3UP2A 4PDOA 4YJSA 3UOKA 4D9TA 3F5XA 2WMBA 3FYKX 2Y6MA 3THBA 4CNHA 3CY2A 4M0YA 3R7YA 4BTMA 4Q9SA 4FL1A 1YQJA 4X6RA 4EK3A 3TDVA 4QMZA 5EI2A 3O7LD 1FGIA 2AC3A 3COKA 2C47A 3NCGA 1OIYA 2PVKA 1XO2B 2GQGA 3GBZA 3L9LA 4JIKA 1QPJA 4NEUA 4IWDA 5GIOE 3R0TA 1CKPA 1P2AA 3RPSA 3GU5A 3PRFA 3OCBA 2OXDA 4M7IA 4O7SA 5DMZA 3PA5A 4OTIA 3FI8A 4X2GA 2BRNA 4OUCA 4DF3A 3Q04A 3LCSA 4CLIA 4NL0A 4PPBA 4RQVA 2X1NA 4WG4A 3ZO4A 5M08A 3ZHPC 4L7SA 2FB8A 1Q8ZA 4D55A 4TPTA 3BGQA 2FSMX 2QLQA 2QOIA 3DOGA 4EHVA 5IA0A 3R1NA 3RAKA 3HDNA 4FC0A 4FV2A 1XBCA 3FKOA 2O2UA 4N6ZA 2GNJA 3N4UA 4H36A 4C62A 2ZMCA 5KZIA 1M2RA 2HK5A 2WMSA 1VEBA 3L8XA 3QKLA 4BI1A 4GT4A 4K77A 4DG0E 2UZOA 3UO4A 4Z7GA 3LFBA 4CYJA 2RG5A 2IZTA 3QCQA 1H1SA 3CKXA 3DKFA 4NIFB 4U9AA 4D0XA 2VO3A 1GZNA 3D5VA 4IMYA 3CTQA 3VBWA 3HLLA 4YO6A 3C0HA 4V01A 4O7LA 1KE7A 3ROCA 3DQXA 3TNIA 2UVXA 1XH8A 3TCPA 3PE2A 1ZZ2A 4U3ZA 4APCA 3MDYA 3CIKA 2YLFA 3MTLA 4KA3A 4ZLZA 1T46A 2XZSA 3PJ1A 4YSMA 4EHEA 3PSCA 5HBHA 2QR8A 3MGYA 2QG5A 5DEYA 3TKIA 3U6JA 5JQ5A 1NT2A 3PXKA 4PWNA 5AV0A 4G6OA 4AFJA 3EJ1A 2FSTX 3Q96A 4TWCA 3B2WA 1WBVA 4BN1A 2JKKA 4YJVA 5AP5A 1ZYCA 2OLCA 4DTKA 2PULA 1PMEA 4CFXA 5CF5A 2E2BA 4X3JA 3UOLA 3LXKA 2YWVA 4FT9A 5CF6A 2ZM3A 4RVMA 5E8ZA 3Q4TA 4J98A 3GC7A 2XMYA 2XIRA 3S4QA 3HV7A 3TL8A 5L6PA 4HGEA 2IWIA 3GC8A 3PPJA 4YZ9A 5LQFA 2CGXA 3QTQA 2IW6A 3IECA 3M11A 1B38A 2ERKA 5F9EA 2Z7QA 4DTAA 4BKJA 2NO3A 2YAAA 3LCTA 4P7EA 1A9UA 2DWBA 3CC6A 5HG7A 4YZDA 4FODA 4FSWA 4JBQA 4E6AA 3DKGA 2PE1A 3FMKA 3BLRA 5DA3A 3LCDA 4DGLC 4EYJA 4CT1A 1YXXA 5CNNA 4RJ4A 4YHJA 3F3UA 2VTTA 3LFDA 5HKMA 1UV5A 4RIXB 4E4NA 5EQPA 3LAUA 2B53A 3PXRA 4O0SA 4C37A 4RLKA 4BHZA 4MXYA 3U55A 5J5SA 2OFVA 4BCMA 3QD2B 2YCRA 4EK8A 4EK4A 2WTJA 2JKOA 1OL6A 1ZYLA 5FM3A 2JD5A 4CTBA 3TI1A 2PVJA 3GC0A 3QRKA 4TNDA 4FBXA 5CYIA 3SC1A 4CKRA 5L4QA 2XK6A 2CMWA 3QALE 5IDNA 3FHRA 3OEFX 5KUPA 1OIQA 2R3RA 3IONA 3LJ0A 5D7AA 3TJDA 4CG8A 3MY5A 2PVFA 3NX8A 4K6ZA 3ZO3A 2R3PA 4CFNA 4YTHA 3RGFA 3I81A 4C2VA 3UTOA 4ZTLA 4KS7A 5J9LA 2WOTA 4LM5A 1WZYA 3LLAA 3V8WA 4BWPA 3R9RA 1JPAA 1K9AA 1Z5MA 4G6LA 2C1BA 3KRJA 4RIYA 3LCKA 5L2WA 5AADA 2O3PA 3UZTA 3ZBFA 3C0GA 1IEPA 1E1VA 3E8NA 4ARKA 2KULA 4X2FA 4E6DA 3O96A 3ORMA 4I4EA 4DGMA 4BIBA 3AT3A 4YJNA 3Q4CA 1H4LA 4FZFB 3JS2A 2CSNA 4D9UA 5LVPA 3DFCB 2IVTA 2V55A 2XBAA 4WHZA 3UNJA 3WF9A 4DBNA 4HVGA 5IA1A 5FLFA 3QXPA 4C3FA 5E8UA 3PXFA 3VQHA 3WYXA 3C9WA 3B8RA 4JXFA 4S33A 3RNYA 4IVAA 2BZIB 4C58A 4UV0A 3QCYA 3SHEA 2W1FA 5J1WA 3HRBA 2BDWA 4QQ5A 5E8WA 5HI2A 3VUGA 4GIHA 4MNFA 3NUUA 4XLVA 4ZEGA 4IX6A 3W8QA 3ORKA 1P4FA 5E8VA 3D83A 1ZOGA 1G3NA 2VTAA 1LEWA 4DEEA 3OUNB 5ANOA 2ZB0A 2Y0AA 4W9XA 3VUTA 4AFEA 4IM0A 2Y8OA 3PA4A 4NH1A 2ZDUA 4Y95A 4TNBA 1OPLA 2J2IB 2EB3A 4IAAA 5HLPA 5A4EA 4EOMA 4D4YA 1J91A 1WMKA 5LMKA 3UQGA 3DLSA 3QWKA 2WQEA 2X2KA 3FUPA 2JIIA 3ZU7A 3KN6A 3I6UA 2QO2A 1XBBA 4NM7A 4RRVA 1G5SA 2P2IA 5F1ZA 4B99A 3PRIA 4EOQA 3FLZA 4LV5A 3ACKA 4ZTRA 3ORZA 4QMSA 2HCKA 4C8BA 1YOLA 3GCSA 3QA0A 1MQ4A 3U9NA 1HOWA 3EYGA 3KF4A 3VRZA 3IGOA 3K3JA 3MH1A 2UW6A 5BQ0A 5CWZA 3HAVA 3JVRA 4O2PA 3AC5A 2W1CA 4FR4A 3F2NA 2PVNA 2W1GA 4DGNA 4OW8A 4FTLA 3GXLA 4BZDA 2CLQA 2QOQA 5DR6A 4QQJA 3MA3A 4R8QA
chains in the Genus database with same CATH superfamily
5C8KA 3SXSA 3ZCLA 3QTIA 4W8DA 3QF9A 2OIQA 3HMNA 5K0XA 4LRJA 2NNWB 4HCVA 5CSPA 3MYGA 2WFYA 3FL5A 4XP2A 3SAYA 4KD1A 4FEVA 4XRJA 5IQEA 1DAYA 4PY1A 2GNFA 4HPUE 2QODA 3LXPA 4W4YA 4Y85A 4ZZNA 3HAMA 2QLUA 4WNPA 4O7TA 5CANA 3KMMA 3W18A 3ZO2A 1PJKA 3KF7A 4DEAA 2VTQA 4W8EA 4BZOA 1R3CA 2W9ZB 3HUCA 4O0WA 4PL4A 3UYTA 3ZS5A 5HTBA 4C7TA 3VUKA 3IQ7A 4I23A 5AUXA 3KGAA 1PY5A 3TUDA 4UMPA 3V5PA 4Y72A 3ORTA 3QD3A 2UW8A 3E3PA 2IVSA 3QYZA 3NNUA 5EM6A 3C4CA 4CT2A 4WOVA 4XP0A 4WT6A 4R77A 2GTMA 5C01A 2OIBA 4ZXTA 2J51A 3FAAA 4KIQA 3QRJA 2PTKA 1VR2A 3AC4A 2C3JA 5CXZA 3D2KA 1JLUE 4DHIB 3Q2JA 2Y9QA 2W9FB 5AX3A 3IPHA 2JC6A 4TYHB 5EHLA 1TQPA 2XK8A 2PMLX 3GFEA 4EZ7A 2JITA 5LVMA 1W8CA 5IQAA 5BYYA 2P2HA 5L8LA 3BGPA 2ESMA 3OWPA 2C6KA 2R7BA 3C1XA 4FT5A 3WZJA 2WQNA 3V6SA 3RPRA 2I6LA 4XG2A 4KBKA 2EUFB 2YFXA 3M1SA 2P4IA 4KWPA 4XV9A 1TFFA 4EOJA 4R3CA 4WNOA 4QMWA 1YRPA 2H34A 4AAYA 4L6QA 4MXCA 3P23A 4RIWB 4FTUA 1ZYJA 3BU3A 4LI5A 4JQ7A 2BALA 5CASA 2PZYA 3TT0A 4KABA 2H8HA 2UZWE 2JEDA 3MH3A 4D5KA 1ND4A 1RJBA 5AUUA 4E8AA 3EWHA 3QD0A 4S34A 3DJ6A 3SX9A 2J50A 2ZVAA 4JX7A 4KS8A 2QC6A 1M7QA 2WTCA 4GV1A 5CZIA 4DITA 2WAJA 3FL4A 4DC2A 4Z55A 5JT2A 4C4IA 4HVDA 3RM7A 4RZVA 4DE4A 3ZSIA 3KVWA 3QL8A 4NM0A 4BL1A 3F6XA 5DR9A 2JFLA 4TT7A 4GK2A 3R6XA 4KSQA 5DFPA 4XBRA 4W4XA 3ANRA 4D2TA 3PXQA 2IO6A 1R78A 3IW6A 4FKJA 4PL3A 3L1SA 3WF6A 2O8YA 4DYMA 2QOCA 4DT9A 3NS9A 5BYLA 4Z3VA 3EYHA 3A7GA 5M09A 4J52A 3A62A 4E5AX 3QCXA 4EORA 5HU9A 5L6WL 1YI3A 2W4KA 5HO8A 3DKCA 2Z7SA 4R3RA 4IZ7A 4AN3A 4BDGA 5HG5A 1CKJA 4QMQA 3WIGA 4Y46A 3HP2A 1F3MC 2JBOA 3AMYA 4Y73A 3UIBA 2Y4IB 4FK3A 3ZYAA 4DH3A 4CMOA 4QTAA 3IGGA 4YZCA 2OBJA 2Z8CA 5CT7A 4EOLA 4FNWA 2R3KA 3IG7A 3W2OA 2W1ZA 2XK9A 4AE9A 2A98A 3BHVA 4I6QA 4O7NA 5HCZA 3D9VA 3ZRKA 3SA0A 2XEZA 3F61A 3OC1A 2BKKA 1ZARA 1J1BA 3PSDA 4WG3A 4DEDA 1DM2A 4EC9A 4YJOA 2GS2A 3FWQA 4CZYB 3LVPA 4HW7A 4WBOA 4W4VA 4YJQA 3CGFA 4F4PA 5DR2A 4NT4A 3BEAA 4B6LA 4G1WA 5TOZA 1WBNA 4E5BA 3IW7A 4I5HA 2C6OA 1DI9A 4FTQA 3OWLA 3A60A 3UE4A 5CAOA 5EM7A 4ITHA 3LQ5A 4I0RA 4DN5A 4MF1A 3ORXA 5ANEA 2VZ6A 4QTBA 4B9DA 1GZKA 1H24A 5CALA 4GK3A 3ENHA 4O0YA 3A7JA 5AV2A 2C5OA 4I0TA 2XJ0A 3DLZA 4BCFA 3LPBA 4C0TA 3R8ZA 5AWMA 4YO4A 4I5MA 1PHKA 1KSWA 3QC4A 1VLRA 4FOBA 1U54A 2BROA 3P86A 4F0FA 3FE3A 5E8TA 5HO7A 5EQEA 1JVPP 1LPUA 3IOKA 3NYXA 4U0IA 3VNTA 4ACHA 3AD4A 5FP5A 5IQBA 2OFUA 1SVGA 3B8QA 1OKZA 3BV2A 3QLGA 3T3VA 5KKRB 3KB7A 4ZJJA 1BUHA 1M2QA 2BAKA 3V51A 2WGJA 3QRTA 4S31A 4X21A 5AUWA 3ZLWA 2CGVA 2YDKA 2RF9A 4IAKA 4IC8A 5GJFA 3TIYA 1Q99A 3VBVA 4MEDA 4DFLA 4FKLA 3WIKA 4DHFA 5J79A 4AXFA 3EMGA 4FUXA 4USDA 1ZAOA 4AGUA 2W1HA 4QP7A 1PXOA 4I0SA 5HE3A 5IZFA 5G1XA 3SGCA 5DH3A 4FKPA 1VZOA 2IF8A 3BYOA 1FQ1B 2EXEA 3AKLA 3W0QA 1WBWA 4PX6A 4XUFA 4TYEA 5EDRA 1ZY4A 3FY2A 3L9PA 4C2WA 4DH8A 1ZLTA 3G5DA 2G01A 4I5PA 4LYNA 1QMZA 4L00A 3W0MA 4FSZA 2W1DA 3MFSA 4AZFA 4O21A 5DWRA 4ALUA 4KIKA 1IR3A 2G2IA 2YWPA 4F7LA 3GVUA 5I5ZA 1FBNA 3KK9A 4ZTQA 3UIXA 3KU2A 3D0EA 3A7HA 4GG5A 4F09A 4C33A 1FMOE 5HD4A 2DS1A 3W10A 4BDCA 5I9WA 3NW6A 3MSSA 2BFYA 4IZYA 2BTSA 5CU4A 2IZRA 5H8EA 4ERWA 2W5AA 3RK7A 5BVNA 3VF9A 1JBPE 5CSXA 4MTAA 5EM5A 5I9XA 2C69A 2BHHA 4QTEA 1OKVA 4BF2A 5B0XA 4FSTA 1E1XA 2C3IB 4QMXA 3QYWA 2NP8A 4C35A 4K18A 5KZ0A 3EN9A 4QQTA 1XJDA 4FIFA 3U4UA 4C4GA 2O65A 2RFEA 3FZ1A 4NW5A 3ORPA 2IVVA 1FINA 4JRNA 4F9AA 4LV7A 3L9MA 4YC8A 3ZMMA 2EVAA 1IG1A 3EQCA 3R7IA 3OBJA 4F63A 2I40A 4D4VA 4H05A 1OL5A 3HMMA 3QU0A 4WG5A 2WQOA 4BDEA 5A6OA 2PHKA 2W0JA 1YDRE 2PVYA 3CPCA 4QYYA 4XOZA 1R39A 5M4IA 4KB8A 2R7IA 3C4FA 3F2AA 4EOPA 4YJTA 4OTFA 4AUAA 3NZ0A 4QMTA 4USFA 2RFDA 2BCJA 5GJGA 1OMWA 2VTHA 2J90A 3G33A 4F0GA 2VGPA 3DK3A 4FTIA 2HAKA 2ZMDA 1PRYA 2JIUA 3D4QA 5CLPA 3PDTA 5HNIX 3PIXA 1Y6AA 3TIZA 5A3XA 4M68A 2BAJA 3TKHA 3MB7A 4U6RA 2XNPA 5HIEA 4I4FA 4IZAA 5M44A 2QOOA 4YTIA 4MXAA 5HG9A 3AT4A 4NSTA 3OXIA 5KHWA 4BI0A 3EZRA 3HA8A 3EQIA 3TNHA 1ST4A 3V5TA 3R9NA 3LCOA 3RZBA 3Q9YA 3DBQA 3S2PA 2JKMA 5IH4A 3HZTA 4FNYA 4O22A 1U5QA 4AXEA 4AW2A 2XM8A 1SNXA 1UA2A 2V7OA 3AD5A 4LRKA 3PFYA 2VWBA 4QMUA 1L8TA 1A48A 5FBOA 2G15A 3COHA 4KNBA 3UJGA 5I3OA 3KFAA 5AA9A 5EI8A 5FXQA 1Q97A 3GI3A 1XR1A 1UNLA 2UW7A 2W1EA 2SRCA 1UVRA 1GIIA 4JI9A 4FI1A 2CGUA 4J53A 4J1RA 4EK5A 5FQDC 3ODYX 4IX3A 4DEIA 3CR0A 1KE5A 4KAOA 1WBPA 3G6GA 4CV8A 4BBMA 4ENYA 3FJQE 1KWPA 3MI9A 2F57A 1IA9A 1ZZLA 2C6EA 4IBMA 5IUGA 3VS7A 4Q5HA 2YCQA 4FSUA 3WYYA 2W99B 2XJ1A 3DQWA 3OXTA 4D4SA 4HVSA 3NYOA 4O1PA 5JRQA 3W0PA 2OU7A 2PE2A 3R7GA 2HWOA 2V62A 2B7AA 4QP6A 3GUBA 2VWZA 3GB2A 4FF8A 4WSYA 2GPHA 3E7VA 3MJ1A 4QPAA 5T6KA 5TF9A 1Y8GA 4DHJA 4BWKA 5E90A 4M15A 3BL9A 4NJDA 3ZEWA 2G2FA 3NUYA 3A99A 1NXKA 5IEVA 3BBWA 3RNIA 1JSTA 2XYUA 3COIA 1GY3A 3BHHA 4TZRA 3PLAE 4F9CA 4GL9A 3DAKA 2E9PA 3D7TB 1GZOA 3K3IA 3MPTA 4RQKA 5LJJA 3CJFA 2G2HA 3MH0A 3QFVA 5E1SA 3Q6UA 4JOAA 5EYMA 5JGDA 4FIGA 2YZAA 5IMXA 5J7HA 1YWNA 4XG4A 5B2LA 3NPCA 4HCUA 2XB7A 2C30A 4TW9A 4C3PA 5IQHA 3MB6A 3CCNA 4K1BA 2B4SB 4L43A 2FGIA 3DGKA 4H58A 4D28A 2Y4PA 3BCEA 4ZZOA 1PXKA 3F5GA 3OP5A 3UO6A 3RAHA 4B8MA 1ZYDA 4ZMFA 4FV3A 3R8LA 2I0EA 3SOAA 3PWDA 1S9IA 3QC9A 5KBRA 4CEGA 5DIAA 2X9EA 4C4FA 3CY3A 5AJQA 3R9DA 2QHNA 4MXOA 5KE0A 4FGBA 2XIYA 4WBBB 2VTNA 3PZEA 5HVJA 4EH6A 3SV0A 5F94A 4LGHA 5IKWA 3MFUA 3PE1A 3II5A 1XH7A 3R9HA 3VBTA 3KULB 4C59A 4QT1A 2X9FA 4RJ3A 4O7VA 4RX8A 2OIDA 1W84A 1MRYA 2YEXA 3F88A 4EONA 2CGWA 3LFQA 3O0GA 4NKAA 4BJJA 2YHVA 3NVMB 5IDPA 2O64A 3NEWA 2UZDA 5FTQA 3SRVB 5EFQA 3WZEA 4AQCA 5J9ZA 3TYKA 2WO6A 3DT1A 4CGAA 2R3FA 4DLIA 4BDKA 3V04A 3VONA 4IVBA 2C3KA 2YZLA 3VC4A 4DGOA 5FP6A 4AXDA 5M55A 3HL7A 2CNUA 3ZLYA 1SZMA 4M97A 3OF0A 4F99A 3TV7A 3POZA 4ONAA 4P90A 4YJRA 3R2YA 4II5A 1IRKA 2XA4A 1YXVA 4NUSA 2HELA 3F3ZA 3RHXA 3GT8A 4JL9A 5LMKC 4FA2A 1TQIA 2JAVA 3NNVA 4DA5A 3PIYA 4H1MA 4AACA 5I9UA 3Q6WA 4IXPA 1XWSA 4PPAA 3Q2MA 4U40A 4F9YA 5JKGA 3GEQA 3TTIA 1Y57A 3AMBA 5JEBA 4GW8A 4M12A 1XQZA 3A7FA 3LFFA 3PIZA 4IJPA 1MP8A 2XRUA 3DZQA 4CRLA 3U54A 3EFKA 5DT4A 2PPQA 1R1WA 2XK4A 4PNIA 4YBJA 4BDBA 3CTHA 4FT7A 4GSBA 5I9YA 3TZ9A 3JY0A 3UODA 2C6MA 1PKDA 3A2CA 3NUPA 1XH4A 4RWJA 2W06A 1J7IA 2GTNA 4O6EA 5IQDA 2WTKC 3P7BA 3V3VA 3BLHA 5JSMA 4PTGA 4DFNA 2W4OA 3FMHA 4L7FA 3Q4UA 4XV3A 4YR8A 3BQRA 4L45A 4AZSA 1OUYA 3SVVA 5ACKA 4MD9E 4ACCA 5HVYA 2XIKA 5EKOA 2F7EE 2P3GX 3AGLA 2R9SA 3BKBA 3CQWA 3FPQA 2QOFA 3UC3A 4ASDA 3FLYA 2GHLA 2ITTA 4HYIA 2JBPA 3O23A 4ZY5A 3V8TA 4P2KA 1G8JA 3AC3A 2GNGA 3SQQA 3U51A 2GDOA 4I93A 2UZNA 1FGKA 2V7AA 3QX2A 5IG1A 3IO7A 2F2UA 3RJCA 5M4CA 5HGIA 1GJOA 1REKA 3H9FA 4R7HA 2X4FA 2R64A 2XS0A 2IZUA 2Y7JA 3BV3A 3OY3A 4I92A 4FKGA 3RCDA 1KE8A 3O2MA 1VYWA 3I7BA 3KXHA 4AU8A 5C9CA 3TJCA 4JT3A 2DQ7X 2UW4A 2WEVA 3MFRA 3PFQA 4HVIA 4EOOA 3OVVA 3E64A 5AAGA 4NJ3A 3RKBA 4FTRA 2NYAA 3CP9A 1MUOA 3G0EA 3PWYA 4GU6A 4HYHA 1KE9A 5CSHA 2NPQA 4UMRA 3E5AA 3FKNA 2R3LA 4KRDA 5JH6A 4GUBA 4JIAA 4IM3A 2W1IA 4E7WA 3QKKA 4FEQA 4AT4A 3QQLA 4IWOA 4RA5A 5DT3A 1URCA 3NAXA 3JY9A 1WVYA 4G3FA 4GIIA 5CSVA 2ZDTA 1OGUA 4AXAA 4QMVA 4RJ6A 3VS0A 4I1ZA 4K8AA 4BDHA 5HHWA 3EKKA 3QZIA 3KN5A 2OZAA 4BI2A 5BMMA 4WKQA 1MQBA 2EXCX 4BHNA 3FY0A 4H3PA 2ETMA 4X3FC 3FMLA 3UBDA 3SW7A 2VX1A 3MY0A 5KMMA 2YM4A 3LFAA 5BYZA 5CAVA 2QKRA 5C4LA 4FEXA 4YUQA 4NFMA 3C4ZA 3PJCA 3KVXA 4IJ9A 4OTWA 3OFMA 2C0IA 4GFGA 3WI6A 4CKJA 4JVGA 4YBKA 5CF8A 3AG9A 3UG2A 4YLKA 1ZOHA 3WE4A 2C0OA 1P4OA 3ACJA 4KBAA 2UZTA 4CZTA 2ACXA 4EOKA 2CCHA 3FBVA 3V8SA 4BBEA 2CPKE 1OBGA 1BL7A 1H07A 4GFOA 4CFMA 4I22A 5EDQA 5K4JA 2PZRA 4PPCA 4ZJIA 3JR1A 3TUBA 4GJ2A 3UPXA 4OAVB 4BCJA 3C0IA 3W16A 1OKYA 1UU3A 3CD8A 3O5AA 1CMKE 2IG7A 3NVKI 3LOKA 4MUQA 3D7ZA 3E92A 4BGQA 3H3CA 4HNFA 3TKUA 1NVSA 3L8SA 5LMBA 4ZSAA 4OLIA 5CEQA 2JDRA 3R7OA 3SDJA 1PF8A 1S9JA 5BPYA 3FQSA 2NRUA 2FO0A 2UUEA 1Q4LA 2VO7A 3C51A 4FTMA 4U42A 4OBOA 3LMHA 2ZV9A 2C68A 2AQXA 4M8TA 3OOMA 3R71A 3ZUUA 4BTKA 4CYIA 1W2FA 3HMIA 2UZVA 3LM5A 2QOLA 1HCKA 4F1MA 3R30A 4LFIA 4QMOA 4X7QA 4EK6A 2WOUA 2QOBA 1PXMA 3Q9WA 5LCKA 4BTFA 3R7EA 3R83A 5D1JA 4W4WA 5CI7A 4QPSA 1JKSA 2J5FA 2ETKA 3TM0A 4FMQA 5ETIA 1I44A 3TV4A 2HWPA 4QP2A 3EN6A 3LM0A 4O84A 3QTXA 5E91A 3FV8A 2HY0A 3NYNA 4U5JA 4ZK5A 2B52A 5K5NA 3I79A 3G90X 4U43A 4YJPA 3R7VA 4BICA 2R3QA 4UZDA 3SG8A 3RWQA 3NFFB 4RC3A 5EG3A 3F7ZA 1UU7A 3PVGA 4YTFA 3DNEA 2B54A 4PRJA 3PJ2A 5L2TA 5A4QA 5IA5A 5FDXA 3UDBA 2ITNA 1V0OA 2VWVA 4RIYB 3D2IA 4BCKA 5ANDA 4O2ZA 1BX6A 4F1TA 4MCVA 3VO3A 3AMAA 4A9TA 3QLFA 2QOHA 4UB7A 3KC3A 2WU7A 2C5YA 1J1CA 4NKSA 2JGZA 3SD0A 4MXXA 3Q5ZA 2QQ7A 2XF0A 2CJMA 2J6MA 5E8XA 4EYMA 4KIPA 4EZ5A 3GGFA 4TWOA 4PDPA 4QP1A 4O7WA 1W7HA 3MIAA 1R0EA 4ZIMA 3FSFA 1BYGA 4G6NA 5ETFA 2JAMA 4CFVA 3ID6C 4C4JA 4USEA 1CSNA 5H8GA 3F7WA 3OMVA 4ZZMA 4HJOA 3VJNA 4DCEA 1BI8A 2OZOA 4FT0A 4J7BA 4TYIA 3N4TA 4ALVA 2WD1A 2X2LA 4MXZA 3UC4A 4FG7A 3U87A 4EUTA 3E62A 3VW8A 3D5WA 1ZRZA 3FLWA 3FMDA 1K3AA 2P55A 3T9IA 2B1PA 2QU6A 2JIVA 3BGZA 1DI8A 2HENA 4MD8E 3W55A 1O6YA 3GCVA 4KRCA 5LOHA 4CZUA 3QXOA 3BLQA 1FPUA 4N6YA 3GCQA 4FVRA 4DFXE 3EQDA 3OROA 4FV9A 3ZRLA 2ITUA 2GNIA 3BYSA 3RPVA 3FXXA 2WZJA 4DAWA 5AUYA 3ZO1A 1G8AA 4UYAA 2YM7A 4XG7A 2HOGA 1OUKA 4GKHA 3A4PA 4FZ7A 4QMLA 3ALNA 4EH7A 4FG9A 3AKJA 3UDSA 5FXRA 2XCHA 3QHRA 3PY3A 4XRLA 2YDJA 1JKTA 3O50A 2R0UA 4V0GA 3RINA 1Q24A 3V5QA 4ENXA 3TEIA 4JBVA 4R5SA 5CS6A 4B7TA 1U4DA 4IACA 2ZV7A 5AUZA 5FTOA 1V0BA 2CKEA 4PL5A 3UNZA 4GK4A 1Q3WA 2UZBA 2WMAA 3KXXA 2XANA 2DUVA 4FTTA 4MQ1A 2XNMA 3R2BA 4TYHA 1XH5A 2CN5A 2XNBA 2XP2A 5AP0A 3NW7A 4APPA 3PXZA 3GU8A 4CRSA 2F4JA 4GCJA 5AR2A 4WIHA 4YJUA 3UOHA 4F7JA 3R8VA 4FSNA 3UZRA 2AYPA 3CTJA 3TNPC 3OEZA 2W5BA 5HNBA 2BMCA 4DEBA 1KUTA 4EH3A 3KEXA 1SNUA 3W2QA 3FI4A 3M2WA 4X2KA 4U41A 2X6DA 2H96A 3OW4A 4FSYA 4TWNA 3W0OA 4XG9A 1ZYSA 5C8MA 4TYJA 1CTPE 3IOPA 3MTFA 4M66A 4D2SA 2XYNA 4RIWA 2Z60A 2AEGA 3E88A 1E9HA 1H26A 3PYYA 5HIDA 4YURA 1O6LA 2RL5A 4WRGA 3RVGA 3UZPA 5IQIA 1SYKA 3SOCA 3CSVA 4MKCA 4C4HA 4M0ZA 4RVKA 1PW2A 2UV2A 3P08A 3D14A 3E87A 3P78A 5JGAA 4XLIA 4EKLA 5A4CA 2UZUE 4IDTA 2J0JA 3DBDA 2W96B 3I1AA 3QTRA 2IW8A 2B9HA 4X3FA 2HW7A 4GYIA 3BX5A 4DTBA 4CCBA 5L2IA 4KBCA 4A06A 4AN9A 5D11A 4IIRA 5A4TA 4FKRA 4BWXA 4FKWA 3A61A 3ERKA 4FKVA 3ZSGA 4G3CA 5M06A 3DS6A 4QPMA 2I0YA 4CG9A 2B55A 3D94A 1KV2A 3O51A 4HPTE 4EZ3A 5L2QA 4UWBA 2J9MA 3Q4ZA 4Z9LA 3RZFA 4Z7HA 4FV4A 3K5VA 4V04A 2OW3A 4GMYA 3TMOA 3LFCA 4E6QA 3ZDUA 5IUHA 3OTVA 4PMTA 1NY3A 3NYVA 1QPDA 5TT7A 4FV8A 3CQUA 4GYGA 3LMGA 5EHYA 2A4LA 2ITOA 2WKMA 2Z2WA 4N0SA 3IKAA 2R5TA 3O8PA 1JSUA 4GS6A 2YM3A 3WE8A 1ZOEA 1M2PA 5EK7A 4ACDA 3KCKA 1OL7A 4DFZE 5G6VA 3VS1A 3NUNA 4XV2A 2A27A 2V0DA 3BHUA 3O17A 2X0OA 5AEPA 4IAZA 4CMUA 2C6DA 3VBYA 4CFFA 4PDYA 1ZMWA 4O83A 3GU6A 4OBPA 4BVUA 3QTUA 5H3QA 3C4EA 3FZPA 4JBOA 4I6LA 2PZPA 4LG4A 3AC2A 3QUPA 3VUIA 3GQIA 4F9BA 5LCJA 3UMWA 4F6WA 3KMWA 3F5PA 3FZOA 3U9CA 3H10A 3S1HA 5M56A 4O0TA 3AOXA 3R21A 1OIRA 3DBFA 4YGAA 3W8LA 4IB0A 3OHTA 3G2FA 4JNWA 3DXQA 5JFWA 1V0PA 2EB2A 3BEGA 3CXWA 3SLSA 3R00A 2ZAZA 3HV5A 3VHEA 5DYJA 4NM3A 3HMOA 3S00A 5IMEA 2GQSA 4I94A 2C1AA 5CY3A 4LMNA 4O4EA 2WTIA 3F3WA 1JAMA 3KCFA 4RGJA 2IPXA 5EOBA 5KBQA 3NDMA 3DTCA 2W17A 3QA8A 5FEQA 3V5WA 2GMXA 3W0NA 3LXNA 5DT0A 5FXSA 3UG1A 2ZB1A 4I6FA 3P5JC 2W05A 3LE6A 4D5HA 1YKRA 1YDSE 1H27A 2PZ5A 3DPKA 1REJA 1WFCA 3GC9A 3I5NA 3QTZA 4IEBA 4J99A 3P79A 4EH5A 4Y5QA 5BUIA 4MNEB 2ZM1A 3ZFYA 3K5UA 4S2ZA 3DXPA 1OL1A 2OJIA 4QP3A 2BZKB 4MBLA 1YXUA 3QWJA 5KHXA 3GOKA 1H1RA 1PXIA 5HLNA 2QG7A 3UVQA 2EWAA 4EQMA 5E1EA 4J8MA 5JN2A 2H6DA 4I6BA 3JYAA 3S3IA 2IJMA 3WOWA 3CEKA 3LW0A 3FMJA 4HYUA 4F6SA 4DT8A 3ZC6A 1P14A 1ST0A 3E8DA 4DBXA 3PVWA 2HXLA 3R1SA 4TYGA 4EBVA 5GZ9A 5K0KA 1H0WA 5F95A 4M69A 5E9EA 2XJ2A 2VTRA 3VBXA 3BE2A 1OITA 2QR7A 2YIYA 2VTJA 4QOXA 3AD6A 5AP7A 1WBSA 3U4WA 4LDTA 4EH8A 3ZRMA 2B0QA 2XCKA 3RI1A 4UXLA 1K2PA 3CGOA 3ZFXA 1OBDA 4U44A 4YC6A 4FVQA 3T3UA 5M53A 5HBJA 5DPVA 4AAAA 3ZXZA 5GIPE 4QMNA 4GJ3A 1Q3DA 2VWXA 3LHJA 5J8IA 5HX6A 3NUAA 2CLXA 3DB6A 1H1QA 4G3GA 4LL0A 1MRVA 1WCCA 2WQMA 2Q83A 3ZXTA 4BB4A 4YZBA 3TZ7A 4BFMA 2A0CX 5IH5A 1F0QA 1OVEA 2OJJA 4PTEA 4J71A 4JLCA 3VBQA 4XH6A 3VS2A 3OUKA 5KMIA 1PXJA 3EQHA 4YHFA 3SKCA 5CEIA 4EEVA 4UMTA 4JRVA 3ULZA 5TKDA 3FC2A 4F78A 3L9NA 2YERA 5EW8A 4F6UA 5AR3A 3TACA 4BTJA 2PWLA 5AIKA 3NWWA 4P5QA 4AW0A 1GNGA 4EL9A 3BHTA 2J0MB 4MVFA 2FUMA 4KKGA 3R04A 3VW6A 3EZVA 4KIKB 1Y6BA 5BUJA 5M51A 4EWQA 4JG6A 5A14A 1J3HA 5CT0A 3LIJA 4M13A 5KMKA 4F7NA 4QMPA 5I0BA 3ZSHA 4AT5A 4IQ6A 4R1VA 4DEHA 3BLAA 2CNVA 2OXYA 4Z16A 4H39A 3I0QA 4QYGA 2GU8A 1NW1A 4MD7E 2X81A 4UXQA 3EFWA 4DFUA 4RFYA 5FGKA 3TV6A 5HLWA 4EI4A 4J97A 4LQMA 3OBGA 1V1KA 2PMNX 3R28A 5CI6A 4GVAA 4MWIA 5CEMA 1LR4A 5HORA 2XNEA 3HKOA 3GFWA 4NTTA 4MBJA 4DCAA 1GAGA 1Z9XA 4FT3A 4BIDA 3OT3A 2QONA 4AG8A 3O8UA 1M17A 4QDVA 4JDJA 2QHMA 4WUNA 3H9OA 3TWJA 1UNGA 5IA2A 3MVMA 1PMUA 2YJSA 4FICA 5J95A 4JR7A 3FI3A 4EHZA 4LUDA 1Q41A 4U3YA 5DOSA 1PXPA 1UWHA 2VWWA 2OH0E 4I5CA 2UW9A 5JFSA 2C5XA 1PMNA 2IN6A 2JDTA 1NVQA 3A4OX 4AZEA 2WTWA 2W7XA 4BCQA 3ORLA 2QURA 1OKWA 2PSQA 3GP0A 5IUIA 4HGSA 4FIHA 1JKKA 2GCDA 2EU9A 1JSVA 3W33A 3PPZA 4ASZA 3ZTXA 1Y91A 3FYJX 2IZSA 4FK6A 4IANA 4TXCA 4QP9A 3ETAA 3VWAA 2X0GA 3PVBA 1APME 4FOCA 3W2RA 3ZOSA 3IDBA 3VS3A 4ID7A 4DH7A 3UO5A 2XVDA 1FVRA 3Q5IA 3V5LA 2E9OA 1SM2A 4I41A 4F9WA 3W32A 4TKSA 4TRLA 3NMUF 4YMJA 1ZWSA 2IVUA 1W2DA 3OTUA 4YLJA 2R3OA 4NCTC 4FTOA 2YCSA 4UN0C 4XV1A 2YN8A 3MW1A 4MBIA 5EM8A 2B9FA 4WD5A 2RG6A 2OF2A 3UOJA 3W0RA 4E73A 2V22A 2LAVA 4IB5A 4QD6A 3CE3A 4RJ8A 5JMSA 4NK9A 2C6IA 3T9TA 4JDKA 1H25A 1GOLA 4BBFA 5GZAA 3UYSA 3H0YA 4BDJA 4L53A 3C5IA 2HZ0A 2YABA 1KV1A 2BAQA 2X8DA 2O0UA 4YPDA 4U7ZA 2RKUA 3RAWA 4X2NA 2V5QA 3W2PA 4BCHA 5ETAA 4K0YA 3TDWA 3D7TA 4FKTA 2F7ZE 1YHWA 3C5UA 2VAGA 5E8SA 4WNMA 3R1YA 5KO1A 1QCFA 2X8IA 1PYXA 3DFAA 1W83A 3RK5A 3NFGB 3AT2A 5TR6A 4EJNA 4PTCA 5DN3A 4C34A 3CJGA 4FNXA 2ETRA 2XBJA 2VTPA 2WQBA 2J5EA 2VNWA 3EQGA 3L8PA 4IX5A 4C3RA 2VTLA 4FEWA 4JAJA 4FKIA 2PVLA 4GRBA 5AX9A 4CKIA 4CTCA 2E9NA 2HXQA