2RG7A

Apo- crystal structure of a periplasmic heme binding protein from shigella dysenteriae
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
255
structure length
255
Chain Sequence
AERIVVAGGSLTELIYAMGAGERVVGVDETTSYPPETAKLPHIGYWKQLSSEGILSLRPDSVITWQDAGPQIVLDQLRAQKVNVVTLPRVPATLEQMYANIRQLAKTLQVPEQGDALVTQINQRLERVQQNVAAKKAPVKAMFILSAGGSAPQVAGKGSVADAILSLAGAENVATHQQYKSYSAESLIAANPEVIVVTSQMVDGDINRLRSIAGITHTAAWKNQRIITVDQNLILGMGPRIADVVESLHQQLWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Holo- and apo-bound structures of bacterial periplasmic heme-binding proteins.
pubmed doi rcsb
source organism Shigella dysenteriae
molecule tags Transport protein
molecule keywords Periplasmic HEME binding protein
total genus 86
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2rg7A02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2rg7A01
3AEQA 1N4DA 2OV1A 2YNMD 1G20A 3NU1A 1M1NA 3BE5A 5M29A 1H1LA 4UDOA 2XY4A 1QH8B 1H1LB 3GI1A 3PDIA 4TKUA 4INOA 1QGUA 3G9QA 3PSHA 1K75A 4CL2A 3U7QB 5M34A 2Q8QA 4UDNA 3PSAA 4MLZA 3MFQA 4HMOA 2WHYA 3AEKB 5BVHA 2RG7A 1N4AA 1ESZA 3MINA 3BE6A 5CX1B 1QH8A 2OV3A 3ZTTA 3EIWA 5M2QA 4WZAB 2PS0A 2XH8A 3AERB 4H59A 4XPIA 4G09A 4FKMA 4WN9B 5KOJA 2R7AA 1M1YB 4TKVA 2AFIA 4WESB 4WZBA 1KAHA 4B8YA 1N2CB 2MINB 1QH1B 3AETA 2XDQA 5GGXA 4G07A 4IRMA 5HX7A 3ZKAA 3AEKA 3ZK8A 5JPDA 3ZK9A 2AFIB 4OXQA 4WESA 4WZBB 4PM4A 3HJTA 1G21A 3U7QA 2R79A 4HN9A 3AERA 2XQVA 4HMPA 1L5HB 1QH1A 3AETB 3R5SA 4MO9A 4TKUB 4DBLE 1PQ4A 5FLYA 1XVLA 2PHZA 1L5HA 3AEQB 4GICA 4H0FA 1G20B 2Q8PA 4N01A 2WI8A 5JJ5A 5I4KA 4WZAA 2YNMC 3MWGA 3K1AB 3EIXA 2XDQB 3HXPA 1QGUB 4OVKA 1N2CA 2MINA 2PS9A 2M6LA 3K1AA 2AFHB 4MDYA 3LI2A 4TKVB 3MWFA 2O1EA 5B58T 1M1NB 4WN9A 5KOJB 5JG7A 4BBPA 3TLKA 4WNAA 4MX8A 2PS3A 4XPIB 3MINB 5CX1A 2XUZA 5GGYA 3LHSA 4INPA 4FNAA 3TEFA 1TOAA 4M7OA 1FP4A 2PRSA 4PAGA 4FI3F 1M1YA 2OSVA 1G21B 1K7SN 5KOHB 3AESB 5KHLB 2X4LA 1PSZA 5CR9A 5HDQA 1FP4B 4OXRA 2XV1A 4LJSA 1KARA 4ND8A 1K0FA 5BVGA 3PDIB 2QI9F 4HMQA 1M34A 1MIOA 4WNAB 5AFSA 1KAEA 1K2VN 3AEUB 3UJPA 3AESA 1M34B 3R5TA 4UTOA 4K3VA 4NNPA 3ZK7A 3MD9A 4UTPA 4NNOA 3HH8A 4LS3A 3TNYA 5BVGB 2AFHA 5JOQA 5BVHB 4ND8B 2ETVA 3CX3A 2M6KA 2OGWA 1EFDN 5M3BA 3AEUA 4FILA 1N2ZA 5KOHA 1MIOB
chains in the Genus database with same CATH superfamily
1WDTA 3E1SA 1N4DA 1NZJA 3M7IA 4JDPA 121PA 2VEDA 3T7SA 4CIDA 5KTTA 2R8YA 5IHXA 3PQ4A 4CGZA 3HR8A 4L76A 1OWPA 1XU4A 4P3PA 4C2UA 5FORA 2HN9A 1WDKA 1HEYA 1OOEA 2D7CA 3B9PA 3RK1A 1QZTA 4LQLA 4P33A 4EKDA 5JJCA 3GD5A 4NC9A 4RBNA 5MF6A 3SC6A 2F8MA 4C08A 1Y1QA 2ESRA 2RHBA 2PXXA 1YZUA 2RK3A 2H59A 4K26A 3SJUA 3UVEA 2IDMA 3CSDA 1YZQA 3OQIB 3R6TA 3GGGA 4CL3A 5LLTA 1UJCA 2G71A 4LK3A 4MA0A 4U7HA 3RC8A 3VU3A 1W2HA 4Y2TA 4MUXA 1CF4A 5D7BA 1PS0A 3WLNA 5E7QA 4Y1RA 4NZZA 1QFMA 1E9SA 2AOTB 4W6QA 4X20B 2EBFX 5H82A 1XZQA 4DUYB 2EP8A 1C81A 2RMKA 5C34B 2X8BA 1RCFA 1CZHA 3BILA 4WFJA 1ZH0A 3SJAA 2Q99A 1IM5A 2Q4RA 2DFVA 1X80A 4IWYA 1G0OA 5T5QA 2GN1A 1OE0A 2BFOA 2BFBA 3BN3A 4P4GA 4NBRA 1GQ2A 3HSSA 4P32A 3D6UA 4OFBA 3I5YA 1XCPA 3U5ZB 3DC2A 2Z5LA 1Z0SA 1LI5A 3GG2A 3MAAC 2VTEA 1RZUA 4QG7A 1TE2A 1EP2B 4DLBA 1P4GA 4A10A 3KFLA 2J0EA 1KQGA 4JJAA 4JT8A 4F9GA 3E9MA 3DXYA 1TGYA 4C4ZA 1MDFA 1O4WA 1X94A 2P2ZA 4OOFA 4JI2B 5AJYA 5TMEA 3GOHA 2O8FA 1PG2A 1C8BA 2JKYA 2BFEB 3BSWA 1HYBA 3CUWA 3H2GA 3ITDA 2Z08A 1MQSA 1PZXA 1ZESA 2BMJA 3K1JA 3FN4A 4I3GA 4TLEA 2PPLA 3SHOA 5JASA 3EIXA 4X90A 1WEHA 1J1IA 2YYAA 3I32A 1RJEA 3ZLJA 1JSCA 2GLXA 2IBMA 2ZK7A 3MVEA 4ME6A 4BLVA 2P9QA 2Q1YA 2I3ZA 2Q9AA 4P0TA 1OILA 5A0FA 2JHAA 2WIFA 2DUUA 3ZS9A 2JBHA 1W9MA 4ZYLA 5A7GA 3OH8A 1TW3A 4RKQA 1UBCA 1T2UA 2IYAA 4BFVA 5ARBA 1MB3A 2OCKA 2CB0A 1U1IA 2QX8A 4ZCTA 5FWAA 4BE7B 1FSPA 4BNUA 4PG4A 1H0HA 5HZKA 3WIVA 1HQCA 1GTVA 4Y67A 3RM3A 1WKBA 2PEYA 1G21B 5BSMA 1FP1D 4I6EA 4RJKA 1Q2XA 2BH9A 5FUBA 4EGAA 1WBDA 3HXMA 1EWKA 2EFYA 4EMUA 1PT5A 3R1IA 1G8MA 2AR0A 2GPNA 4NMMA 1NBOA 4QGSA 5I5EA 1XU9A 1KR2A 1QG6A 3Q3IA 2ENUA 1RPJA 4BNWA 5I4BA 1MW9X 4ZJUA 1H4TA 1JQLB 3A1NA 1HC7A 2BFDA 1XMJA 3CTMA 3L0OA 4JMPA 4JKYA 3KSBC 3S70A 1G2IA 3DV0A 3KEOA 4FFLA 3KOYA 4KQ2A 4X9XA 4KN5A 5IFKA 1E2LA 2P1ZA 2Z98A 1BW9B 3VVBA 1QFJA 2WK1A 2BBWA 4Q18A 5FYQA 5SZHB 1YRWA 5EEHA 1KRWA 4I4TA 2A0KA 4K9NA 2AKEA 5FWXB 1R6DA 2VAVA 4CI0B 4L9SA 1GSOA 2PYZA 4GR4A 4QZVA 1NKTA 1KS9A 1GYPA 4HZGA 1HZZA 2XX3A 3W8RA 5AXCA 2O59A 4U2CA 1H0KA 1L5WA 4KGVA 3ZHXA 2YJ3A 3C98A 1DSSG 4YDQA 1DAEA 4CQMD 4GGPA 3F5FA 2Z8ZA 3JQPA 1LJUA 3JWIA 5REQB 3RPEA 4DWOA 4ENRA 1P60A 4RW0A 3T15A 2BM8A 4X1KA 5BQOA 4BEJA 2LRHA 5M34A 2FFJA 1ZM2A 4D46A 4D92A 1JR3D 2IU6A 1E2EA 2JGJA 3DVAA 3QPCA 3DMPA 4BUCA 4PGHA 5BSHA 4KQHA 2Q5CA 5FOXA 3FRHA 4LK2A 3UMYA 2P79A 3E22B 4ZMRA 2PA0A 2GAFA 1DKPA 2Z8YM 1M6HA 4C03A 3V8MA 1YJ5A 4KQXA 2D2VA 2H7XA 3IUYA 3VYRB 2PUDA 5LP1A 1OXKB 2W2OA 1FX1A 3OQPA 2IYRA 1W25A 4HH0A 4QJ3A 1H5UA 1MAAA 4MQ5A 2F3UA 1PV1A 1PEKE 2WAOA 3HFGA 4OXRA 1I4OA 1OA1A 4ZDWA 4X6LA 3C6ZA 1TJ3A 3RAJA 1XV5A 2QLLA 2OZLB 2C0QA 4IRUB 4U8GA 3STWA 3DVAB 1O5OA 2GF9A 3UAGA 3F7MA 1E94E 4RDCA 5CFQA 2QTLA 2B6HA 1EAMA 5C1IA 1OIWA 1AZWA 4AG3A 5IYZA 1H42A 2OD9A 4XWKA 2XCOA 3N28A 1H2HA 1VJDA 3LD9A 1BQ3A 1NUPA 3EBPA 1SXJC 2XUPA 3O1LA 4TKZA 5I7HA 2YJTD 1WXWA 4XWAA 2NT3A 3U13A 5FBZA 3W34A 4P98A 5GJVC 5JH7F 5DT2A 3ZCPA 4KK4A 4PZEA 2OOKA 2VHQA 2ZJFA 1JSLA 4K9RA 1PS8A 2VZEA 1CUBA 3K1AB 4O4JB 1I13A 1GNRA 1MT3A 5B2EA 4QEDA 1A69A 3PPVA 2CMDA 4BN0A 5L3QA 4MV1A 3KKZA 2XLBA 5FUVA 2GARA 4KCGA 5ED4A 3ZDZB 4BVHA 4CKEB 1X1CA 3UUWA 3H1BA 1ZEMA 1L9KA 1XAGA 3HDJA 4NATA 1NULA 4RJ2A 4YJFB 1CQPA 3A2NA 1Z2EA 2DLNA 3EGWA 1JHOA 3AC0A 4DDVA 2ISSD 2OSVA 4S24A 1NVFA 3KOMA 1ONOA 4I55A 4AYWA 6REQB 1NNSA 1BHJA 3O9VA 4BP1A 3LUHA 3MTQA 2J33A 1TIBA 3O2QB 2HHJA 2DF8A 4HX9A 1JB9A 3M6IA 5TRTA 2A9JA 3FTEA 4RCZA 1BN6A 2QL5A 2YZKA 2A9QA 3BCRA 3PR3A 3RVSA 2SKEA 3QXGA 1QYCA 3WNZA 2O5VA 2C1ZA 2W6NA 4JP5A 2FZ4A 1T9BA 3HPRA 3SOZA 2H7YA 1F4LA 3FPLA 3H9UA 2MJLA 4JYMA 5JWRA 2FDRA 1ENYA 4HVAA 2C5FA 4RH0A 2NXJA 2CVFA 4R1MA 1OXSC 3RIGA 3LPLA 2GFHA 4C06A 4ARCA 3F9CA 1E99A 1YHNA 1DAMA 3E82A 4V2UA 4W5WA 3ZDQA 4IRXA 1U99A 1DCTA 3PJFA 3R20A 3OTWA 1E0AA 2IOYA 2SNIE 3BXEA 5FEUA 5JXIA 4O2BA 1Q1GA 3NU1A 2GESA 2P65A 1LI4A 5AI6A 3QUBA 3AVTA 4O1HA 1Z6QA 1VIMA 3FGOA 1TT5B 5FJJA 1F3LA 3KVNA 2JEZA 4MAAA 1H23A 1ZHOA 1F4VA 3KUKA 2DC1A 1O9HA 1UPXA 1IY1A 2JASA 2NVOA 1TX4B 2R7MA 3Q15C 4B3XA 1ISGA 1LPSA 3T1YB 2EJVA 3VFDA 3LF1A 4EKGA 1YDMA 2G5PA 5CNKA 4K0RA 5JZ9A 5CK4A 2EWMA 2WICA 2Y1EA 1BVYF 3CUEF 2XB8A 4G84A 4WI1A 4BX3A 1ZO8A 5TJ9A 5JARA 1QB7A 4Q34A 4BMSA 1B3BA 1RWXA 1VCMA 3A1VA 1KBZA 5EJ5A 3VSCA 1J21A 3FPKA 2ISCA 1DMRA 4DR2B 4KXFB 5L3RA 2VHCA 3ELUA 2HV9A 5F51A 2IYQA 3AEKA 2AD5A 5JBIA 2A5FA 1ZJ6A 4PLVA 4PSAA 4GM4A 4UREA 5JD3A 2WIAA 5KWIA 4MUAA 1KI1A 4IIXA 1BQEA 3CJTA 1T5TA 2PX2A 3ROEA 2DRIA 1UC9A 2ACVA 2PGAA 1X2BA 3CUUA 1M2OB 1XCBA 3EXAA 2LIVA 3OOSA 3T5GA 3WBJA 1TZJA 4GX0A 4D6XA 1CS0A 1XDSA 1Z33A 2EZ4A 2P9EA 3PVZA 1PUJA 4XAQA 3IS3A 2NTYC 3G0DA 1W29A 1OAAA 2VHZA 3GB9A 3ODGA 1DZIA 3GELA 1ICIA 1IHPA 4WZBE 5DX1A 4CMCA 4OHWA 3AM5A 1BKSB 2J09A 4Q4JB 3UN1A 2I4TA 1P3Y1 4C4PA 1Z25A 3MWGA 3SC4A 1A9XB 2WSYB 1T2AA 1WZNA 3HR4A 4DV6B 3L7LA 2RH8A 1NONA 1WW8A 1ZCZA 2KM1A 1NUAA 2EKBA 1XTIA 3KLBA 3P2KA 4PGMA 3BSSA 1R1DA 4PY2A 6ABPA 3VNUA 5ENVA 1JVSA 4YX9A 3H2ZA 4MX8A 4GGMX 5CLLA 3NM4A 2H1IA 3OT1B 4ZCQA 3UWDA 3JQQA 1O9BA 1QKKA 4GOKA 1EE1A 5AO9A 3LHSA 1JMKC 1GKIA 1NU8A 4K03A 2A30A 3OLCX 4O4LF 4EMBA 1SCDA 4OX9B 1XF9A 1RQ2A 3ZV6A 2RGXA 1XI2A 3RV3A 1BXRA 2J9YB 4YQFA 3AFOA 4UM7A 4OSEA 4CEJB 4NBSA 1YQQA 2ZAYA 3PQ6A 5I9BA 3WV5A 4MYHA 2ZWVA 3BSYA 3LBFA 3LHKA 4TV8F 4FB4A 3KAPA 5B1SA 3LVFO 5CHEA 1KJWA 2W2KB 4C22A 4PLYA 5JDIC 3VPFA 4E51A 4TS1A 2NTEA 2IXEA 2CNNA 2QVZX 3FNFA 3TIGA 2XE8A 1PWZA 4M0CA 5EHIA 1CETA 5CCXA 1SXQA 5E0KB 3W6OA 2C96A 2G9ZA 3NKVA 1FFYA 2R8ZA 2R44A 3TNJA 2RHOA 2V5UA 1GYQA 1C80A 1KEWA 1X13A 1HY3A 4HDMA 3F9IA 5E7MA 1E3SA 4OQLA 4HLNA 3VSAA 3E7DA 4G4SO 3IP9A 2QRLA 1RD4A 4YMHA 1MT0A 5K8VA 4ZAGA 4HNHA 4UHJA 3PWSA 1CJSA 3SFTA 1JTEA 2BBSA 4N0QA 4OQ4A 3TD2A 2E6UX 1BD3A 2PUTA 4JJGA 3C6YA 4IFTA 5IYZB 4HEA1 1H0RA 4L0CA 4CETA 1K75A 3PPIA 4MYDA 4A91A 2VDMB 3MJSA 3CR7A 3BXOA 4FDVA 2XIJA 3E9ZA 3DFKA 4G0MA 3W79A 3NTOA 2QG4A 1JTVA 2OORC 4B79A 2EGGA 1LUAA 1Q0TA 2Q6LA 1Q1BA 1IEVA 1YBFA 2GBCA 3RVDA 3MINA 3LLVA 4LHWA 3ZH9B 3DKKA 3FPFA 2HMWA 1VIYA 4M9CA 3ESBA 4V24A 2X42A 3D6TB 1E96A 4PLCA 3LCJA 1JYSA 5EZYA 4TL8A 3VDXA 4BNGA 4C7JA 1TCCA 3W5CA 3S0JA 4ESOA 5K2OA 5CM9C 5K0NA 3DR5A 1P9OA 5D7NA 3AMVA 4KH1A 3G8YA 3E8SA 2YNMA 3LK6A 2GFIA 4US1R 5BN1A 3RIHA 1UFOA 2ABWA 3AP1A 4UUAA 5MFZA 3UJNA 3CLHA 3OCWA 2H5LA 3FFWA 3UUEA 3EW7A 1KI4A 1JYEA 2WM8A 5FBHA 4X1KB 2I2XB 2NPFA 3ZGZA 3JASA 4ZGBA 2W7TA 4GLOA 7REQB 5TNXA 1G60A 4JVLA 2JI4A 5P21A 3DNPA 2FZ5A 4X3PA 2VQSA 3QA3E 4C6SA 2QR5A 1U3DA 2OZKA 2XBUA 3NH6A 3HTXA 4NBLA 3QIAA 1EQ2A 2ANCA 1B14A 1GNQA 2IELA 3E2MA 1XRNA 5EJ7A 4DCUA 1RRGA 2G1JA 4R2HA 1T5DX 3P2IA 2GOYA 1A27A 2YWCA 4ZOLB 1B43A 2H00A 4HWTA 3B3GA 3A6DA 1U9JA 4D4JA 5HOQA 4CXMA 4HLDA 4L08A 3U62A 4AK9A 4K6CA 4U7JA 1Y3BE 5JWOA 2R9VA 4QUJA 6ADHA 2YRFA 1EUCA 2X3UA 1SUWA 3GJSA 4KDFA 4Z2YA 3H9EO 4MMZB 5T41A 3ZEIA 4PO1A 1NYTA 2YCLA 4RL6A 5HM6A 2G07A 1NI3A 3CRNA 3CWZA 4KR0A 3H9BA 1OHHA 3HMQA 1XDGA 3KSUA 3QVXA 5AW8A 1NR5A 2QN8A 3FYUB 4J0JA 4CDNA 1Q6YA 2Z8XA 2PWAA 1D1PA 4ECAA 2A84A 2WJZB 3OAAD 1FNMA 3ETLA 3QLEA 4QUIA 4R1OA 1XDWA 1W34A 1P2SA 4FSXA 4RE6A 1UCFA 1XMXA 4N5LA 4C04A 4CUKA 2QXTA 4UUMA 1C3OA 5AFSA 2FMHA 1CE8B 3ONDA 5YASA 4IVNA 2I7XA 3QHQA 4PHCA 2OHHA 1C4WA 2QL9A 3F6SA 3EODA 1EFRA 1HDOA 1PKEA 3SR0A 4MR8B 3UFBA 1K63A 1E1QD 4DF3A 1W7AA 2R86A 4BC1A 3PC4A 3W77A 5LUAA 1R3DA 4WXRA 3F1KA 1KSJA 3HCOA 2OGWA 1J8QA 2UZ1A 4HTFA 3CF2A 2A1IA 2R4QA 5IZCA 1D6NA 5EY5B 2RAFA 1MH1A 1USWA 3TOZA 1V3UA 5ALYA 4AJ2A 3AIKA 2W93A 4W7HA 4XTRA 3E3MA 5ARCA 4R8MA 1QP0A 3WISA 3EG9A 2IXDA 1NQOA 5BUZA 3UMCA 2V97A 3V80A 5K0TA 2F9MA 4HNGA 1WUJS 1Q16A 1KHTA 2R4TA 2ZRDA 2B3DA 3FMIA 4EDHA 3AF5A 5SICE 2XDAA 5DT9A 3WGUA 2YWJA 2PX0A 1ONPA 3V8RA 1A2OA 2RI0A 5K8TA 5KNBD 1ZIPA 3QLJA 1OZFA 4HXFB 4NEHB 4U7WA 1P72A 4E1BA 1WRBA 4JYCA 3WADA 3RO7A 4P7BA 4H15A 4ARUA 3DL2A 3S1SA 4L9AA 1X2EA 4XD7A 5LMZA 1FTYA 2XUFA 3KKOA 3NHSA 5CBKA 4J4TA 3TAXA 4HKTA 3TDNA 3ACCA 3P9RA 2JB9A 3NKFA 3NVMB 2QIOA 2G0AA 4JB8A 1F2VA 1A2BA 3ADBA 4F7DA 2R6FA 4MUHA 3WL6A 1VB3A 2QVBA 3FB1A 4AZTA 1EXWA 1Z63A 3DMTC 1Q92A 3HJTA 3QQ5A 3FYCA 3OEHA 1ZGBA 4CIAA 3RNLA 1IRXA 1KE1A 3MF4A 1Q21A 1Y6RA 2D5CA 1AHPA 4AWBA 4DBLE 1UC8A 3W7AA 4JI0B 4OOEA 1PG0A 4X8HA 4BIMA 1C9DB 3L7OA 4IINA 4DLKA 1ZJWA 2WIBA 3QMMA 1ZVVA 3LY8A 1AK2A 1V43A 1MV8A 1CZLA 1X7HA 1ZK2A 2ORVA 5FB3A 4AB1A 4JLDA 3EGXB 1RXUA 4D4GA 5KKAA 3AJ8A 2NUTB 3DBVO 4KIJA 3KYCA 4MB0A 4PS0A 1YCFA 2BM0A 3GPLA 4Q4AB 1GDTA 1L0BA 3DKPA 1QGYA 1OH7A 4RD0A 2WYIA 1XLUA 3RLIA 3ELWA 3OKAA 5K8JB 4WH0A 4RF3A 4L6AA 2CUNA 5KAPA 4B2PA 3G5LA 2FSFA 2Z09A 1S8AA 3W3ZB 3LKDA 1EG7A 1K4MA 3L4SO 1VJCA 2Q62A 3OMWA 1EP3B 2VJNA 5EZSA 4BX8A 2F3RA 1LGYA 5IJAA 1YJQA 2AXQA 3BMXA 1GKKA 1UPAA 3JSAA 2ZOSA 4O5OA 2WR8A 4J07A 3GDOA 4I9FA 4C0BA 3CZ5A 3DH0A 2OFWA 4GEGA 3EZFA 3DLIA 1V96A 3D02A 4DV2B 2IHZA 3PHBE 3QI2A 3B20A 1UDBA 4O4HB 4BJ1A 3K3PA 1BA2A 1Y7HA 3MCZA 4RPCA 4X7RA 4LKOA 4E4RA 3P0RA 3AVUA 2IYPA 1QU2A 1XRRA 4V0ME 4PZAA 3RBAA 2WZBA 1JG4A 2RBGA 4Q7MB 4KAJA 4M4SA 4DPMA 5CBPB 2H4HA 1M9NA 2DWPA 2PGXA 5FBQB 3KSZO 1GCIA 4NQRA 5KYKA 4JJ4A 5C53B 2G82A 3R7WB 2PTGA 4FBGA 4KH0A 4PCLA 5L3ZA 1ZJ4A 1RWOA 4K88A 2IYUA 4MGZR 4Q7QA 1A4XA 4LC0A 1YDEA 3HFJA 3LMKA 4M0KA 5IVKA 1KFEB 2CKDA 2JFFA 5DMXA 5KS2A 2ERXA 2FPMA 1NXXA 1F5NA 4P81A 5AJXA 2XUDA 3KELA 5TQ2B 1R2QA 2W8BA 3H1PA 2RHGB 3KQPA 3SF0A 5F3RA 2AL7A 3K72B 3EEOA 4M83A 3ZIAA 2YJZA 3L06A 4HAIA 1PT7A 5E3JA 1HO3A 4MKFA 4YAKA 2P4UA 2R0QC 2G76A 3QX9A 2QW0X 1WSAA 5CEEA 3UM9A 4YPOA 5BSWA 1US8A 3F97A 1P31A 3C74A 4D9CA 4EW2A 2L0XA 1KSHA 2JJ2A 5AVRA 1TQ8A 3QSGA 4MDEA 4N48A 4BDTA 3BE4A 1ZUNB 3OM9A 4P38A 3U3OA 1UIRA 4XGIA 4CV0A 3HP4A 1VG1A 3IOYA 3PL5A 5H3CA 4FVTA 5CU7A 3KTDA 2Z04A 1D4ZA 2BTOA 3QEAZ 4UQPA 1DJOA 1IHUA 1ADYA 4MCHA 3AUUA 3A6HA 4WESB 3PGXA 2QUIA 3AUXA 1G5QA 4ZVKA 4MMXB 3THRA 3LNTA 2BKLA 2IIQA 2ZPTX 1YS7A 2FH5B 1NXTA 4BS9A 1H2AS 3P4YA 4D4MA 2E82A 4HUQA 1QTQA 3WA6A 2VWPA 3A9TA 1W47A 1C2TA 4RANA 2CLFB 2M6RA 2YXBA 1GOTA 2YZGA 3R0IA 3UAOA 1JKJB 3MN1A 3UCEA 4Q6WA 8ADHA 3QEMB 4GBGA 1RBQA 1NW8A 2ZYDA 3FCYA 2R79A 3GWGA 1V5EA 2CJFA 4QFBA 4RK0A 1RLMA 2BSQA 3MGAA 2HH9A 3EGDA 3HU1A 4FX5A 4OXIA 4URZR 3U3KA 3SIWA 1QF9A 3GEIA 2DETA 4RIFA 2CFTA 4QM6A 1JXQA 1V8OA 4RKFA 5JZOA 5LXTA 4O3MA 3B2QA 3O47A 1MQAA 4I5FA 3SLRA 3WK6A 2QKYA 3F67A 5J5CA 4ZCRA 1JHZA 1XXHB 3GRFA 4RLSA 3ZHYA 4AJPA 2VH5R 3N76A 3UUGA 4H4EA 4KITB 2Y67A 3CX6A 4KLAA 4UUPA 5A3RA 4GMDA 1PNVA 2ZJ8A 1KQ3A 2NPOA 3FCCA 1PKXA 1XNGA 4ND6A 3WGNA 3KE8A 4N47A 3OIVA 4LY6A 5EXTA 2VG8A 4TPKA 2VXCA 2GN2A 4Q9AA 1MO2A 1RKXA 4QYTA 1AHHA 3C7AA 3UG7A 3U60B 1XZCA 1Z73A 3CLSC 4CODB 1E58A 2PWBA 3F4BA 3ND8A 1O6ZA 4PIVA 4UBLA 5F2KA 5BXQC 5LWHA 1TEVA 1QDUA 2QP4A 3EXFA 1YZFA 2J6HA 4K7JA 5BXYA 1EXDA 1XPUA 1WBJB 1QHHB 1UR5A 2P3QA 1W1IA 2PH1A 3CKMA 2AG5A 3FCUB 1T8RA 1W0KD 2L18A 2GVZC 3WZLA 3AESB 3GLQA 2I78A 4CQJA 3RH0A 4HWPA 4EM6A 4BEBA 3JARB 1N5MA 4GI3A 2CDAA 3DE5X 4RK4A 3HJGA 3SIPA 5TS3A 4ITRC 1UMBB 4XUEA 4RKRA 4KKXB 4CTKA 2ZJYA 4R0MA 2IY7A 1GPAA 2RI1A 1VGQA 5FAXA 4D4HA 1IWPB 1ATZA 3BK1A 3DULA 4L5AA 4WWHA 5HMMA 3TINA 3DWGA 1AV7A 3U4DA 4NNPA 4MZDA 1A1VA 2NXCA 3SPXA 3GFFA 4GYWA 4WADA 1VI6A 1SHLA 2G08A 4JASB 3U44A 1L6RA 5THXA 3DJYA 1TCBA 3HKDA 4CTOA 3S1AA 3V00A 3NHYA 1SKMA 1T5SA 5FYDA 1LV7A 5FKJA 1KOLA 2R84A 4DOMA 1FJGB 4BIIA 2BTQA 5E6SB 3RSQA 2DT8A 4TTRA 3TL2A 1ZK1A 3ANNA 3VTFA 3EXHA 3RIEA 4ENVA 1I6WA 1LNZA 5CJ2A 2B61A 2JJ1D 2Z2KA 3A9CA 3HLTA 3U1TA 1OPRA 2DHEA 3GFSA 3K9LA 5CVUA 4CIXA 3MJTA 3D8HA 3AF4A 3G9XA 2VR1A 4KXQA 4EFMA 1X1QA 5SYAA 3ZX5A 4EAQA 5L9AA 1KTIA 2GNAA 2DQYA 1LV8A 2V6JA 5KU1A 1GRVA 2J41A 3E35A 3E9EA 2DEUA 3AUFA 4CT5A 4ZZ1A 3V8NA 3UA4A 2I1WA 4RFSB 1ZI8A 3F7TA 5JAQA 4IFBA 3AI2A 4LECA 4H59A 4Y6SA 5AQEA 3HXOA 3BF8A 4JITA 1P4HA 4O4LB 3RBZA 4YMIA 3TI7A 3TM5A 2NV2B 3WMFA 5IJ9B 1ZW6A 4AQ7A 2HK7A 2VSQA 1R27A 1DO0A 2CXHA 5AK0A 5DNAA 3UMGA 3C6KA 2DWCA 5DYWA 3ICCA 5ADVA 2P2GA 3O8NA 2IEYA 2V59A 4NG4A 4EOGA 5NLLA 1M2VB 2P30A 4KO8A 3NEAA 2NO9A 1XD9A 2YFHA 4FMCF 4NONA 2VPPA 4HN9A 3IAFA 3BFPA 1AD2A 5CLQA 1TMKA 3LX4A 4YAGA 4QXOA 1INLA 2YMPA 1PDVA 2OV6A 3BMNB 4XYBA 4NJEA 5EP4A 1C30B 1DJLA 1HFJA 3EVDA 1H1TA 1PGJA 3PKJA 4LBYA 2P5YA 4JCCA 4OHYA 3BAFA 1W8IA 5KNCD 3BZBA 1PV4A 4R05A 1Y6FA 2FP4A 1R6AA 2QD3A 2AI1A 4QU0A 4P3NA 1QGUB 1FRZA 2GPAA 2PDAA 4JXJA 3LO8A 2Y1XA 2OY0A 4YP5A 3GRRA 1QYWA 3IR5A 3BE8A 1H4QA 1YI0A 2QB5A 1YIOA 3TSOA 3VR0A 2V3VA 3T1VA 2PXCA 4Z0TA 1O97C 2XVXA 3ETCA 1EFLA 3UBMA 4Z0HO 2NMVA 2HF8A 2IHJA 3ONEA 2IUSA 4LYHA 5G0UA 4INPA 3WQBA 3ZWNA 5C5CA 3C7CB 4G6ZA 4E4YA 1XRLA 1M8GA 4J1TC 5FWDA 2FEKA 4D9GA 2EBUA 1V1MB 2Q1SA 2FP4B 2X2EA 3LV8A 2AYXA 1J7JA 1PR6A 4KO3S 4LJYA 5F2EA 5C35A 3H5WA 3ROXA 4TTTS 4G5XA 4WLOA 4PG5A 1AQNA 4ND8A 2HKIA 5KQLA 1AK9A 3WDLA 5DULA 4AO7A 1RACA 1UADA 2HNBA 1A0OA 2IXGA 3CF4G 4TUYF 4FQ8A 1JTFA 3DLHA 2V6FA 4BVJA 5A9RA 4IX1A 3VDRA 2AOUA 4LTMA 3E6AA 3QBJA 5DIZA 2XRYA 5E9WA 1M8KA 2ECPA 3PITA 5D00A 4JP8A 5ICSA 3JXEA 5AJZA 5DTIA 4MS4B 4WKBA 2B6NA 3M6LA 4P4UA 1RRMA 2I7DA 5DEIA 2JIPA 2O7NA 4TTIA 3F3YA 4CFSA 2ZM5A 1EFDN 2RKOA 2J9FA 1SD1A 4GPIB 1WKVA 4LCEA 3IQEA 2Q6TA 4UVIA 1JYFA 4RTSA 2VA9A 1XO1A 3LGSA 1I2ZA 1EVJA 1RWPA 2O2CA 3TW6A 5B30A 3FD8A 2H4XA 3N2GA 3DV9A 1B6SA 2OXRA 3DOOA 3D3EA 4FHEA 4KIFA 3KFXA 2XZTA 4MMYB 5FQOA 2XRMA 3NTVA 3G0OA 3GK3A 4V0NA 1IQUA 1IVNA 3EF0A 3M5CA 3U17A 4KXXA 1ESDA 2GK3A 2QJOA 4NDNE 4RD3A 3ZY2A 2QZSA 4OL0A 1YBHA 4GPZA 5BUCA 3S5UA 4ZT5A 2CYAA 4UU0A 2HYIC 1PL6A 1DBIA 1N7JA 2JKVA 4PLTA 1FSFA 4O1MA 2NTNA 4MV8A 5JO0A 2YKGA 2C4NA 3ZDDA 2SECE 3EF1A 4J43A 1QHIA 2AA3A 5DGXA 4UXIA 3IKLA 4CR7A 4ND1A 1YF3A 2XKBA 2BJHA 1K08A 2VP4A 4G1CA 1ULBA 3RASA 4XUCA 1Z37A 4G5HA 4FC7A 2W0MA 1YFZA 2H4FA 5FBVB 2ORED 4B71A 4IVPA 5LFAA 2VUHB 2AC2A 2HR1A 3A6KA 3O0DA 2R6ZA 1OU4A 2V6MA 5BQ5A 3WDKA 4L4SA 4CG0A 1S8NA 1QIKA 1YGPA 4G9BA 4LWPA 4LNHA 2WTUA 5EIWA 4EY8A 5G0VA 1PDOA 1JG3A 3VH1A 4G1EB 4F4UA 3IL2A 5DU2A 1V2GA 2QTFA 5EWLB 1ECBA 1F3OA 4TV8B 3V7YA 5LMNB 1BQ4A 1TADA 4QD3A 3WLKX 2W6ZA 1UFVA 1L4GA 2G0NA 2WJ6A 2OR3A 5JD6A 5LQCA 2IEBA 3PRJA 2ZATA 3C4QA 3O4HA 3E9CA 2R7KA 2FEXA 1DQRA 2ALJA 1AH2A 1CY7A 4IM7A 1Z4MA 3ZZUA 2OHIA 3OPYA 3ERCA 1PNRA 2QRVA 4HL6A 3FSGA 3WVNA 3OFJA 2XHZA 4KZKA 5BSEA 1TEZA 1SJ9A 3I12A 4OHRA 3QENA 4LC9A 1YVDA 4DNOA 2JIOA 4ZCLA 3I9FA 4OJMX 5CDGA 4N6GA 2EQAA 1K2WA 2C3UA 4W8GA 4WXMA 2FOIA 2JLCA 2ZP1A 3WJ2A 3R8CA 3EXHB 1NF2A 1NM5A 2WPDD 3L46A 3N0RA 4QOFA 1UBHS 1U4OA 1ECJA 2RGBA 3NIWA 3V2GA 3V1YA 3WRXC 2WNIA 1TXGA 4KQ1A 4CV3A 1CC1S 2I3GA 1AF4A 3BIFA 5B7GA 3VNBA 2IUYA 2O05A 1Y9DA 2ZTLA 1M34E 1NG9A 3AI3A 1CCWA 2H2DA 1WV1A 4H2DA 3T9EA 4I9UA 4GR5A 3RC1A 4KLRA 3ZS8A 4DV4B 3A6LA 2XGSA 3BWDD 4M0EA 2VYVA 1M34B 2W4QA 5JRZA 3NEPX 4D79A 1VLQA 3KKPA 1U65A 3DKIA 2NOAA 1TZMA 1CQZA 1GZDA 2I7TA 2QT1A 2FSVA 3T3OA 3RS5A 4UBNA 5ITSA 1SC6A 2CCKA 1D2NA 1C4OA 3B7GA 3RYHA 3HDQA 4H77A 1DKMA 4MGEA 1Z2OX 3OBIA 2HQSA 1YCGA 2WZQA 1TFUA 1V7CA 2J3KA 4DRZA 3JQ7A 1LTQA 2XB6A 4I50B 4DMKA 1KQFA 1XP5A 2IFTA 1E66A 2F1OA 3IA2A 1EK6A 4PF1A 4QOJA 4DR1B 5LZ2A 2FMFA 4M7PA 3WFZA 2C9YA 3A0RB 3GLKA 3JR3A 4LNUB 4H6WA 4U3JB 1MOZA 5F1YA 1MZVA 4N40A 4Y1FA 3P1JA 4OH1A 3PQ3A 4C7OA 3VR1A 3CYFA 1U8TA 1NQXA 5B3KA 2WG1A 3KZCA 3W8DA 2PKWA 1DIBA 2DUWA 5JMTA 1ECLA 3AB3A 4G01B 3JQAA 2BHRA 2X5XA 3RJ9A 4AAYA 1C7IA 1U7XA 1URPA 3C3DA 3OTQA 4LEIA 3ZWOA 4F5EA 1Z4PX 5JCOC 5KTMA 1MQ8B 4MYSA 4RA9A 4QO7A 3ZN2A 1GGVA 5HCIA 1DI0A 2AEEA 3VTZA 2QLNA 3FYUC 3NTLA 3T3HA 3DKVA 1MO3A 3NYQA 5I9SA 2C92A 3R9XA 4NBVA 2F8TA 3U4MA 4MYUA 4DLXA 1K6JA 4MHTA 4FE3A 1II8B 4U39A 2EKZA 2WABA 1FTWA 1KMCA 1X7DA 3Q98A 2WVGA 4XIJA 3P20A 2XSZA 3B85A 3NOXA 5IC4A 2HWUA 3KQOA 1ITZA 2PLRA 4BKRA 2EFDB 3L1UA 1HV8A 3PUHA 3R24A 1VHDA 5CTAA 2OECA 3SHQA 5KQGA 4JXXA 4N4AA 4MPPA 2VP2A 4MEBA 3RUPA 2R5FA 1DQYA 2DUMA 5B57C 5JZMA 1U63A 5CH8A 4HAZA 3OCJA 4N8DA 4EK9A 3OCCA 4CCWA 5JHHB 1E2UA 1II8A 4B1FA 1WE2A 4LE1A 1G7SA 3O7MA 2VNJA 4X1YB 2WIGA 3S81A 1OSNA 5AHRA 4MJ3A 3T5TA 3WLMA 1EH5A 3PQDA 1ORIA 3TFOA 2F90A 3L6RA 4IIJB 2CLMB 4FM9A 4HB4A 1SQ5A 1JKXA 1V5IA 1LXCA 5IWCA 4Y2YA 1KDOA 3MWDA 1XA3A 2J9RA 1YC5A 1C0KA 3FUXA 2C29D 1A5TA 1N2JA 2YJNA 1CQJA 3AG6A 4DCVA 5J5AA 5HIKA 3A1SA 1KZHA 4M7OA 2B69A 3OY7A 1CR6A 4YECA 3UAXA 4U7DA 1UBTS 4W9MC 5HILA 4IXDA 4CDMA 1I0LA 2JGLA 3JATB 1E1CA 3I58A 4RA6A 4YCSA 3KHKA 1PSZA 1X77A 3CRW1 1GEGA 4JK3A 4CR6A 1IB6A 1N3YA 4L4YA 2XZOA 1XMQB 2O7VA 3BXHA 3FOBA 1HPLA 4KPFC 2J0UA 4GI1A 1FFSA 4JI1B 5JTTA 2QL6A 4F4DA 3I53A 3U0VA 3HGMA 2Z57A 5JAUA 1C7FA 3UAVA 1VC2A 1WTCA 2CE7A 2H85A 3OM0A 2DZDA 1R9JA 1UFRA 1X7WA 4MH0R 1H9AA 4X1IB 4HDAA 3E9NA 2UYYA 4TSKA 4ZEXA 3U61B 4B4DA 1UKYA 3S1AB 2AFHA 4LW8A 2XUAA 4Y2HA 5F21A 1EJBA 2ZSJA 2OCPA 4ZWNA 1SVLA 4BVGA 4EUEA 3OICA 1KH1A 1KMQA 1QLHA 4LHYA 1EWRA 5ILQA 3TL6A 3WQHA 4ITUA 2O8DA 2A5LA 1XQVA 3LT1A 4MRMB 4IJ5A 1ZUWA 4TS9A 1MJ5A 4CCYA 1ID1A 1V6CA 3HCPA 4EHDA 5AESA 1ACLA 2HQRA 3SEAA 2XF8A 1ML3A 1A9RA 3JS5A 1V5GA 5JQGF 4N39A 4RGVA 5CA0F 3PWTA 2AIRA 3N5CA 2A9OA 1I10A 2RAVA 1L7VC 1HLFA 3O9ZA 2WT8A 2H5EA 2GH1A 2VSNA 1M2HA 1KYYA 1SCAA 2VN8A 3O91A 4ROSA 3SCZA 3HI6A 4M1KA 3V33A 3GNTA 3O95A 4A2CA 1E2PA 5KSOA 4GWKA 1GCUA 3AWDA 4F2PA 3WAJA 3P45A 1IY9A 4MQBA 4RF2A 2W2LA 3VR6D 3BT7A 4A4DA 2DR3A 4LGVA 1K3TA 3JD1A 1QYVA 4A6DA 2DFNA 1XZGA 2AX3A 3T9CA 5ESDA 1J8DA 4GLFA 4G0VA 2E5WA 4WOCA 5BYJA 2WU8A 4HLUC 3ILSA 2FFBA 3R3ZA 5KTSA 2D6FA 2B4QA 2UUAB 2Z4SA 1DTWA 3QKIA 1W581 1Z0IA 3ZOZA 3RVBA 1GRCA 1C9MA 4LMBA 5LKRA 3G2MA 2W2NA 2PK3A 4CKWB 3NRBA 4ZANA 4TQUS 1X8XA 4LC1A 4P2BA 1N25A 4Y2XA 1IPHA 4BZXA 1AXRA 4AI6A 4DLYA 2FSHA 2FUG6 4TTVA 2IHKA 2PBRA 1PI3A 3M4XA 4H4DA 1KPGA 4AF6A 1H2ZA 1Q11A 3O1HB 3A1TA 1MC1A 3ZUPA 4OBXA 1ELOA 3F90A 1PVOA 1IRIA 1XVLA 5MN4A 1P6UA 1Z4QA 5J4LA 4GICA 5JJBA 3H4MA 2GD2A 3MXTA 3WRVA 3ZU2A 4AJEA 3FZEA 1U5AA 4YQYA 2AJBA 2DXIA 1XFDA 2AXNA 4TTPA 3G2LA 1W52X 5ABPA 2IV7A 3PL1A 2KMLA 3IQWA 3AJAA 4TMKA 2WUEA 3DBLB 5D3KA 1XN4A 1X87A 1TA0A 3H83A 4WN9A 5LA6A 3MAGA 4EJ0A 3CWCA 2XRFA 4W9NA 5JS7A 3UG6A 3JQ7B 2H2AA 1NW5A 1A9PA 2GHTA 4WK4B 3ZDCA 1C1XB 4PU0A 4XB6B 1K7EB 2P9FA 3AT1A 3BWMA 4BB9A 1TOAA 4NR0A 3WTBA 3CGGA 2NP7A 3DAOA 2P77A 4F38A 3B1WA 3NOOA 1DC4A 5EXPA 3K35A 1Z16A 4CM9A 4DA7A 5HUJA 3HN2A 4O8CA 2IH2A 1RHJA 3D3NA 2D13A 4H18A 1QR6A 3LT5A 3K6KA 4AX4A 1QHFA 2JAOA 1QG4A 1U1CA 2Q2OA 1KI9A 4EYQA 5H68A 4NRDA 4HBGA 3ZLBA 3QFFA 1QIIA 3O8QB 4YBZA 4QOHA 1NX9A 1N77A 2ADOA 3D4NA 3S55A 1NOJA 2C3MA 4BWVA 2C7PA 2PRJA 1A8SA 1R0ZA 2AJ8A 3FDFA 4JT9A 5DASA 1K5PA 2Q3LA 3L1JA 3RSOA 3KAKA 3ZK7A 3OIFA 1OTXA 4N0PA 3CE6A 4JQCA 4XASA 3MGBA 1IH8A 3DNFA 3L8DA 1W1WA 4Q9IA 3IVGA 2Z0MA 1CEEA 4B80A 3AEUA 1FUIA 1YZYA 4V0KA 1Z3IX 1VTKA 1MX3A 2BFNA 1OXVA 1ZHHA 2N3ZA 1UINA 2C8KA 2WILA 2YNMD 4REQA 1TQDA 5AI8A 3E22A 3TLZA 3U2QA 1BH2A 5J2UB 3FUVA 4YTEA 3U4CA 5CMLA 2I65A 2G9QA 4ZVPA 2ZCVA 4HF7A 1JS1X 1P5FA 1I7QB 1T3HA 3KFVA 2QRKA 2H16A 3ENNA 3PSAA 4LWOA 4KOEC 3W3AD 2QRNA 4BLRA 3SNKA 3FI0A 1O54A 4B44A 3F46A 3LH5A 5J2TA 4R40A 4FJ1A 2JIQA 3UJBA 4Z4GA 2JJ8A 2O0KA 3DDWA 3O73A 3MWLA 2FZCA 3PGVA 5LP6B 3BJIC 4PZPA 4PVCA 5LYJA 5EJ6A 1I6LA 4JBLA 5L4NA 3FTNA 3RVJA 1DINA 1J97A 5DNCA 1M54A 2G77B 2GPYA 1N0HA 1XK6A 1BIFA 1N2CB 3D5TA 5JYCA 3ZZTA 1EAYA 1EI9A 2XDQA 4E88A 1I2AA 3DUFB 5DI9A 1RAEA 3TR0A 3ESXA 3MHPA 4ZAWA 3X2SA 4JNKA 2YZMA 1EFCA 2VCEA 3OX1A 1I9CA 5I8ZA 2D3TA 2P8JA 4PM4A 2XGJA 5JY1A 5JXJA 4CM8A 4W7SA 4QIHA 4N6NA 2RGWA 3GA0A 4HS4A 4PS1A 4GKAA 1BDIA 5IC5A 1WXEA 4B9EA 2EFGA 4F56A 3DFIA 2G72A 2QS9A 3IDZA 4G9EA 4J0IA 4JUDX 2IUEA 4L95C 5LQMA 1RHQA 1JU3A 1WPXA 4W9RA 5GZ3A 1QYRA 3LM8A 3SS7X 3X2EA 4RD2A 1I4EB 3A31A 3NGLA 3NCHA 3KYJB 4IH1A 5KWSA 4NJMA 1PYGA 4DC9A 4G0YA 1YHYA 1AB5A 3IUNA 1FFHA 5BWOA 3ZHSA 3T61A 1DCFA 1KZ1A 4Y0AA 4RF5A 4E2YA 4QKQA 8MHTA 2A0YA 2EFJA 3MCAA 4TYPA 5H59A 5B5SA 5CM2Z 1JIXA 4G0WA 1BHO1 2O1EA 4I36A 2D5IA 1DKLA 3MTEA 1WO8A 1WM1A 4QARA 4U9UA 3CR8A 2FG5A 4LJ7A 5E9AA 1KXZA 3NKLA 4ABYA 3DE1X 1CZOA 3P97A 3PUYA 4R51A 4KR2A 1JH9A 3NVKI 1J2UA 1HURA 4Q1AA 2IP4A 5J63A 3BL8A 1C0EA 3IP3A 2BKAA 1POWA 1CRZA 2BEVB 4FYHA 5AOVA 3F2VA 2GBIA 2C9OA 4NU8X 1YWGO 4KAAA 3ZQUA 2VQ3A 5AVXA 4B2LA 3K2EA 3AG5A 2IV2X 4ER5A 1ZXLA 3QA9A 1L5VA 3SP1A 3B5EA 4BNZA 4HD8A 2X0IA 1F7VA 3COJA 2CLKB 4IUBS 1W36C 1VE6A 4WDRA 1LSOA 2VC2B 5TLSA 1ORHA 4RENA 3QU9A 4J7CA 3AUSA 4ROTA 1AGRA 2WLSA 3CZMA 2A0UA 5KYXB 2C7OA 2FZLA 3ILVA 5ALXA 3RYCA 5CFPA 5C7OO 4HTFB 3IEPA 1Y37A 3ZLUA 4EY5A 1RAFA 2RCYA 5FL3A 1P29A 1ISSA 4QGBA 1STOA 2PFSA 1JHXA 1I2DA 2IYSA 1DIHA 3RQIA 5AHOA 4N0EA 3JATA 3VU8A 5TQ0A 2QTWB 4LMRA 3TXAA 1B23P 3QELB 3H5AA 1B1CA 4GLBA 4J16A 1L2TA 3HYNA 1AA9A 2Z9CA 1IFXA 4KQ9A 3JTMA 3LDUA 1N2OA 3QF7A 4LA4A 4C43A 2IRWA 4TLAA 5A4DA 5EIEA 5K20A 4BMXA 1P80A 1CPYA 3SIRA 1PD1A 2JZNA 1NJ1A 1ZN8A 3H6KA 4N3GA 4N76A 1DXHA 4KSYA 2UYHA 1U28C 3K0KA 1MZPA 5BW5A 4JUAA 4YAFA 1T2VA 4FE4A 4CV2A 4H3KB 5JXHA 1JIQA 3DZFA 3I4LA 2XWBF 4ZOAA 5BVHA 9MHTA 2O50A 3INNA 2WVHA 2YXNA 2NPIA 1ORVA 4LF8B 5J58A 2ZJAA 2PGOA 3PYXA 2XGGA 1VL6A 4FNOA 2VHWA 3MRVA 2LV8A 4O4IF 3U3MA 1UM9B 4NS1A 3TRDA 3SWWA 2PZAA 2QT0A 1PZGA 2QSZA 2W2TA 2Z83A 4YJHB 2V7WA 4QASA 5FTLA 3H0CA 4URWR 5EG5A 3KK0A 4ND2A 3H75A 3B78A 4XW2A 2HFJA 3T5MA 1Z6ZA 2EL7A 1KQPA 2OLKA 4RYDA 1KY5A 4G07A 3AL2A 1VKOA 5F2OA 1ORTA 4PFJA 2NUAB 2YWRA 4I6GA 2W6QA 3HJHA 3P71T 4FHGA 4C9BA 4ERNA 1NG1A 3LBIA 1YR6A 5KQSA 1C1HA 1HZJA 5GVRA 1U8ZA 1J0XO 3ON5A 3KS9A 4MXDA 1SCQA 3G88A 3HCAA 1EB9A 3CPJB 2X7JA 3B6MA 3OIWA 1KZ6A 5I9LA 4C7KA 2PAFA 5FR2A 3TKLA 3ZVKA 3W7VA 3I8XA 3WLOA 4Q02A 4GL2A 4V2IA 2JBWA 1CRPA 1AZTA 3WK5A 4YYZA 5JSYA 3R7BA 5KUTA 2C5AA 2IU3A 4HGNA 4M36A 2CBXA 1Q7RA 2ZR9A 3FE2A 4CIWA 1FRQA 5E6RA 1C1DB 2BKEA 1LFDB 2PBZA 4MDYA 1XUOA 3TMYA 3EEQA 1UT5A 3QVTA 4HFRA 3BXXA 4OQMA 2NZJA 2F3QA 4ZU1X 2X0DA 4RCVA 3N87A 3OWOA 5JNTA 1WG8A 1EGMB 1TT7A 4GI2A 2IA5A 4HC4A 2PBLA 2Q6KA 4NV0A 4URHA 5AVSA 3QYPA 4G0ZA 2FX3A 3TW0A 1YMUA 4BTEA 3SEZA 1FP4A 1NXQA 4GT1A 1PFWA 1TEHA 3RVNA 4FB5A 1EJ0A 4S1NA 3O1JC 1QIHA 1K8RA 2NSDA 2NZYA 4M2LA 1J8YF 3RQSA 4PR3A 3VX4A 3RW9A 5DI3B 1F8XA 4HY3A 3K05A 1LK5A 1R4MB 2I87A 3GHYA 4MQEB 1L4FA 1ZN7A 4TVKA 3TLCA 2CDCA 3D2CA 4UVHA 3PVSA 3MD0A 1Z5PA 4B4OA 4HG2A 3RHSA 3P5SA 1FOEB 2QRPA 2HL6A 3TIVA 1XEWY 4CF3A 2YQ4A 2VJCA 4QNMA 1HDRA 1MB9A 1BVHA 1M6NA 2JHCA 2XQKA 2AWNA 3VKGA 1PUXA 3ZLVA 2WP0A 3U4GA 4BY9E 4G2NA 5HR5A 1MJHA 3BB1A 1W6RA 2C2YA 1P7YA 2FDXA 2HX1A 5DMHA 4DRXA 3JYQA 5D01A 1XJCA 1JLRA 4YR9A 5CFMA 4X6XA 1IATA 3EXFB 5EJMA 5KTNA 1NLMA 1RHMA 4EO7A 3KB6A 4ADSG 1CNMA 4QBGB 3HKCA 3ECSA 5AJHA 5AT1A 3VR2A 3KDSE 3AEYA 4E5VA 3NASA 4I55B 4LHXA 1T8SA 3PYLA 2P7IA 3S2SA 1EFRD 2VOEA 4QLOA 1E4VA 3RKSA 4G65A 2FN8A 1B16A 1G3UA 3IMCA 3SKVA 2ZUBA 4BO9A 1WX1A 1RZRD 1XK7A 4DR4B 3ESYA 1NXOA 2C95A 2RK4A 3NT5A 4P80A 4FGUA 3FOCA 1KKUA 4V0OA 3VC1A 5IN4A 2FMTA 3DD5A 1N6PA 1XEXA 3LLMA 3D64A 3M0EA 4X92A 3RROA 1HWYA 3AZPA 1DELA 2HHAA 4QPDA 1WLSA 4QPJC 3GJ0A 3U44B 4A1OA 1GXSB 2I62A 3DXFA 1U8FO 2IZ7A 2X0FA 3ROKA 1U0GA 2PRIA 2PS0A 3BMOA 4ZRNA 1NBMA 4TVBA 2BSAA 3F78A 4D4LA 3D0OA 4DWVA 1HF3A 1GPBA 1KY2A 2IXFA 4EFKA 1NL3A 3L0SA 3I6ZA 5IZCC 3THWB 1FYVA 2QXYA 3N70A 5EESA 1L7EA 2HD4A 4I8XA 4B17A 1WY5A 1K8ZB 3CNOA 2V45A 3VJLA 4ENTA 4OQQA 1PEYA 1EK0A 1PQUA 3K0AA 3QBEA 2JD0A 2VA8A 4URYR 3RVPA 1AKWA 4B74A 3S1LA 5BQPA 2X0JA 1Y8QB 8AT1A 2G9VA 4UNPA 1DFHA 4AZ0B 1Z39A 1B73A 3H5VA 5EJ8A 3KKMA 1VMKA 4TROA 3RC9A 4CFZA 2YUTA 4WKPA 3OY2A 4JVOA 4DM3A 1M2KA 1XJWA 1PZFA 2CWWA 2OXTA 4MO9A 3LXUX 3B9BA 5J2UA 3MBOA 1ZD9A 2AI3A 2O0MA 5ICEA 3RVRA 3QFCA 1XWIA 1QS0A 3P9PA 4WLUA 4JI5B 2AOXA 2IHVA 2X6QA 1IBKB 1S2IA 3OQNA 1Y9EA 3GMDA 4WQMA 1MJNA 2UZ3A 3HADA 4IOMA 4Q0MA 3LOPA 5LZ4A 4OQZA 1NVVQ 3QUSA 4RORA 3V4FA 1PIWA 2HV8A 3COSA 3EXEB 3PDJA 2CXTA 3B6ZA 3IOEA 1V6SA 1LB1B 2Q07A 3BORA 4ND4A 2P0EA 3KLPX 5KCMA 3ZV7A 1VHWA 5CB6A 1A8IA 2CE2X 1YGYA 1ZD1A 1BFUA 2XUZA 2Q7OE 1VCHA 4I1OA 3UB2A 3EVNA 5HQ3B 2I71A 4M55A 1KXJA 3IKJA 3ZBPA 1IN5A 5FPSA 1EK5A 1I9GA 5AKGA 1GL9B 2QN1A 4QYXA 4EGJA 4Y30A 1Z2PX 2H5JA 2Z3VA 1V45E 3QE4A 4NOKA 4KR9A 2W2XA 3PXGA 4Q12A 3RTBA 3LLUA 2WAAA 3UJ7A 2NU8A 5I7UA 3GCXA 1BGXT 4XRGA 3HL4A 2LVBA 1HRKA 1LA2A 1MGPA 1L6IA 2XTAA 5IULC 3KT0A 4LXQA 3IDSA 2RONA 2Z4RA 1NDQA 2VWQA 2PXHA 3OO1A 4Q48A 4BP9A 2I1QA 5CA1A 4LBZA 2WMNB 1C0PA 2GN0A 1HE1C 3P9CA 1L5RA 4S0ZA 1E2HA 1FZTA 2NT4A 3GEGA 4IDDA 1NP6A 1ISFA 5D3ZA 5TVKA 3F4KA 4B47A 4HUTA 5DBIA 1QO7A 1E4EA 3A04A 4QBIA 4E09A 4CEHB 1SBTA 1RXEA 3QUTA 3O4JA 2HBYA 1KC3A 2V6BA 2WF9A 4FWTA 3S2IA 3WB9A 3DNMA 2FR1A 2VAWA 5HBGA 1Y48E 5LXTB 3QVUA 3GLTA 5BMVF 1JQDA 1BCSB 4RZXA 2OCYC 2ZUUA 3KYIB 5DGIA 4MS3A 1VSBA 1GTG1 4OHCA 1S02A 3N7UA 4QNRA 4MVJI 4R9RA 1HOXA 3LVRE 3PA6A 2BEWA 4WZAE 3ZNNA 1O6BA 1DBRA 1YS4A 3NORA 2I34A 2O1SA 2V6GA 3SJ7A 3C7DB 1RI3A 2WYWA 1SBQA 4R2WA 4A0SA 2R8EA 4FSDA 2QTRA 1CYEA 4RZ2A 1B2RA 1UZNA 3AM3A 4LQDA 1YB2A 1G1MA 5CYOA 4WCVA 2VT7A 1XMSA 3EVZA 3IUEA 3ECAA 4HBZA 4Y0VA 3ZV5A 3X1MA 3RIXA 5TGZA 2BR3A 5HQTA 2YS6A 4D3DA 4L0QA 5KTKA 1MG5A 1UJ2A 2IBTA 1SN7A 4TYYA 4B81A 1K9VF 2B8TA 4LFCB 3ZOKA 5H9VA 2WUWE 4QA9A 4RD4A 4A6EA 4OA8A 1NW7A 2F7SA 4RDHA 3WICA 1ANKA 4I81A 4KHZA 4I8DA 5DYGA 2I6QA 2X13A 4OUDA 3U4AA 5GOTA 3ANXA 4FGZA 1RM5A 1FDSA 3W8EA 3I76A 4M76B 1S5PA 2GAIA 2JAHA 2DHQA 2RHLA 2W2MA 4K8RB 1N33B 1RYNA 2LP4Y 1FP2A 4Q7KA 4BLOA 1BKDR 2V58A 3D1LA 1KA9H 3HCRA 1RBMA 3WLSA 5U4XA 4MJ7A 4E5NA 2OPBA 3CNHA 2WE8A 3JVDA 4NYMQ 2EJWA 3GEBA 1V7QA 4I1SA 3CE9A 4DRYA 1Q0RA 1QVRA 1XQWA 4KBFA 4CKWA 1KYQA 1ZM3A 5FWNA 1L1FA 4XCXA 4UHCA 2J7PD 3EIHA 2VSXA 2IUFA 4YQEA 1GGJA 1SB8A 4B73A 1OFIA 1AMUA 1KQOA 1BE8A 4QODA 4QQKA 2WWVD 2NIPA 4GS5A 5C1PA 1EM8A 4L0MA 1J0CA 3C5EA 3I4FA 4MW4A 4JBHA 2B5WA 4TL9A 1CY1A 4Q3OA 1I1HA 4LRYA 3TX6A 4WXYB 3VBEA 4BMPB 3J7AC 3GMTA 1DBPA 2XOKA 5DLYA 4RKWA 4P54A 5FWYA 2ZVQX 3K9FC 5KWVA 5HNKA 5A3SA 1BU5A 1OKKD 2G1AA 3DZ8A 4FBLA 1MABA 2A86A 3BWXA 3EZ7A 1OJLA 1USIA 3R9WA 3AHGA 1DEKA 4XDYA 1VMDA 1S0UA 2ADFA 2QIPA 3NLLA 4L15A 1T2NA 4AZVA 3DAYA 4RHEA 4INJA 3PT5A 2AW3A 1DPGA 1N5LA 1X39A 4NTZA 4OUDB 4Q7LA 3PGMA 2HUNA 4IYJA 2CNDA 3WJAA 4DS3A 2QP3A 2FPUA 2W11A 3IELA 2OPHA 1GPYA 2A4KA 4LDRA 5F33A 5AXDA 3QIVA 2R85A 2WJ4A 3CM0A 3L1KA 3M8KA 5DXAA 3EPPA 2VP0A 3LKZA 2PZJA 2EFCB 4LJAA 2R48A 5EUBA 1YASA 3IQGX 4EDFA 4KE7A 1LNQA 2WDPA 2GF0A 1EUCB 1LLFA 2E87A 4LZLA 5HP4A 3DE2X 1CVIA 1PUIA 3QLVA 4KPEC 4S1OA 2IHNA 2AR9A 5H3HA 1PBTA 2J3MA 4RPHA 5JSZB 1ZH4A 2A6PA 3O3CA 1NMZA 1UZLA 1KZ7B 1M74A 3BHJA 2NSYA 2ZTVA 3I9JA 1W4RA 3JQCA 3P9ZA 3PXUA 4CL2A 2VYFA 1DC3A 2OAEA 1V3TA 2EZUA 4R8LA 1FFEA 1I94B 5CXSA 2JJ1A 3MSXA 5ELXA 4II2A 3MJCA 3ESZA 4IJUA 3KLOA 3LY5A 1T6NA 1G7CA 1ESZA 2QORA 3DF7A 2C5LA 3IB6A 5FOVA 1FBNA 1T24A 3H2YA 4EW3A 5DTQA 3PX7A 1MXHA 1IPFA 5TX7A 1QE3A 2SKDA 3MBKA 2I4MA 1A98A 2D5AA 2GZDA 3R4VA 1Z17A 5DLDA 4DG5A 3HI4A 4DMCA 1HKUA 1REQB 2NACA 2F43A 3B1ZA 4QDOA 4XQGA 1NOKA 4AQDA 5ECGC 1Y82A 3EULA 1LBQA 1PRYA 2P62A 2ZR7A 2CF5A 2X4GA 3DQQA 3V7FA 4WBXC 2WIJA 3AUTA 2LKCA 3B1VA 3PS9A 3LL7A 4ZICA 3TTVA 1U3GA 2O2SA 2P4HX 2JHFA 3DMYA 3K1ZA 4ZO7A 1XL0A 2C88A 2BEKA 3AHDA 1L5HB 2ARKA 3IPRA 3QVLA 4IDEA 1KSGA 3GXOA 4P34A 4ALKA 2FPPB 1Y0BA 3GN2A 2HIGA 3GAZA 2GBLC 3PFKA 2JFPA 3F3KA 3K2BA 3KQYA 5F35A 4AG6A 1RCTE 3C5VA 4FLEA 2FJ0A 4JLPA 1TTPB 1YMQA 3TQQA 1DEXA 1JN0A 3B36A 4QDUA 5F4ZA 2K87A 3DUFA 4JC4A 4EELA 4BWGA 2FAXA 1FIUA 1LQ2A 2HLDA 4QXQA 1VJGA 4BECA 3TN7A 2W8ZA 2ZYUX 4LPKA 1M5TA 4C5AA 4TKVB 3RSSA 4N8SA 1VRWA 3GHHA 4R7GA 1E79A 2WTEA 2XMCA 1TVKA 1V11A 4IHKA 1UC4B 5JY6A 3UXHA 5TMBA 4EJMA 2ECQA 4G85A 3U81A 4HVCA 3LHDA 1MVOA 4MGIR 1TAUA 2FCRA 2WB4A 3NEYA 5IT9A 4GMGA 1KP9A 1AT1A 3Q5GA 3ZBQA 1G17A 1T9KA 3QQPA 1ZNWA 4GI7A 1E89A 2EFEB 1LLUA 3I45A 3N7AA 4JLBA 5AVVA 1GDHA 1BC5A 5E7IA 4JBYA 4L5JA 1X1RA 2FRXA 2UU9B 3LUBA 6LDHA 1PP4A 4MLDA 4GSLA 4O4HF 1S3FA 4P7KA 4HDSB 3ZQ4A 2ZVPX 3LSTA 2VJLA 2G1UA 1CUDA 4L3VA 4Q9NA 1G59A 4FDAA 1RIIA 5FA6A 3H9QA 5CD1A 1VMEA 4JQOA 5CA0B 1ZNZA 3ZE9A 2K7ZA 2O06A 4E0BA 4QTYA 3QVWA 1YOBA 1NF9A 2NNLD 4QPNA 3ZD9A 4GVLA 1RYMA 4OIMA 5IT5A 3IEMA 3H0KA 2JJ2D 3M4ZA 3LHIA 4G89A 5ALEA 4KRXA 5KPDA 1Z0JA 2D2EA 3ELBA 3H2JA 5EXSA 2BRUA 4HNRA 4JP2A 1B6RA 1OYWA 4NZYA 1P62B 5DB4A 5EPUA 3CCCA 3R4CA 2XA1A 2V4ZA 3ORRA 2QTGA 1EINA 2JJYA 4DTIA 5J4YA 3QE0A 2ZYVX 2QWXA 5HIIA 4GNRA 1NFQA 4BCDA 4G4IA 4BKUA 3VPBA 3DPIA 1QO0D 2Y1WA 1DAFA 3JQRA 1NVWQ 1OXTA 5KX5A 2JFUA 3AW9A 3ZJYA 3IJEB 3G6WA 2HWXA 2APJA 1SIUA 1WMEA 2R96A 5DPMA 3KQKA 4BNMA 4XYLA 4IMPA 1FTQA 2ZIWB 3VR5D 2R2GA 3BERA 4PGGA 3NXSA 2HCRA 4Y6PA 4J2TA 2VYNA 2JLYA 2RHDA 3JV7A 3GZTB 1GN9A 4B6GA 4ZAFA 4ARZB 1X7WB 3L7KA 4DSUA 2ORWA 4REOA 3QLUC 4R8SA 4B83A 5F12A 3GZ4A 3MT0A 1NUSA 1NVXQ 2DPLA 3BMNA 3IEKA 4KIWA 4V3CA 5AKJA 1FJ2A 3T5CA 3D8SA 2M1XA 4YO8A 4BKOA 1NVVR 4XX0A 5EPEA 5I7FA 3T1HB 2YV4A 4NMHA 6NULA 2CV1A 1NXWA 1ZC3A 3OIGA 4UZEA 3ZK8A 4E22A 3F47A 3MAJA 4M1EA 4TTJA 4XVUA 1VQ1A 2AJLI 3QU7A 4ND3A 1DU4A 5IBCA 4M9UA 1HX7A 1BE0A 1CE8A 1Q7TA 2X1LA 1Y63A 2CCGA 2JAUA 1PW7A 2CK3D 3DZKA 3SX2A 4HMPA 1T4CB 2FOLA 3JVUA 5BWBA 1HFEL 1N32B 2P91A 1WSWA 2KQUA 3LOUA 3N8IA 4E5PA 4A36A 4FGSA 1ZS9A 3AM4A 1PFQA 4UE3S 4DT1B 4ZCPA 1L7BA 4HDKB 4IEFB 1N0IA 4J7AA 1ZK4A 1VBKA 2ZIZA 1C4XA 1JA1A 5L6LB 1BGWA 4ZRMA 1RC1A 5A9TA 5LNK6 4RTOA 1IZ0A 1Y1KE 1KAOA 2OQIA 2RARA 3IVXA 4D97A 1M6VB 4NG5A 3S2UA 1H94A 5CA1F 2QTMA 1SEVA 5KEIA 3SC3A 1P4JA 3BQMB 3IHWA 5GJWC 5CLFA 4Z4QA 3K8YA 3WOVA 5AOCA 1MVLA 1YDFA 2W6IA 2PKQO 1RM0A 3EZLA 3DDOA 1N2HA 1XVAA 2PU7A 3OI7A 4HDNA 2G04A 3UXEA 2WUGA 1N0WA 2O07A 3FKJA 3G6KA 1W6UA 2C9MA 4ZEWA 1JLLB 1XNHA 5IHPA 1E2QA 4NICA 1G4AE 2ODBA 5K3OA 2PH5A 1OASA 3HNPA 4PQEA 1LC0A 1ZR4A 4EPRA 4D3FA 2QYSA 4P4TA 2PQ6A 2D0DA 3FGZA 3VU9A 4YP7A 1R0BA 4MVJD 4PX3A 2YWEA 1L5OA 1ZVQA 1H5NA 4ER0A 3L7BA 4AJLA 3LS2A 3G0GA 2FRDA 4KO1S 2RGYA 4ED9A 5I9NA 3ORFA 2JFZA 2QJWA 1BDBA 3HM2A 4LV8B 4CE6A 5CIYA 2H4ZA 4FEYA 1GV1A 2O3TA 1GQFA 2YV5A 3ZXXA 4L8LA 3QXJA 4ZYWA 5T3UA 4JSRA 1B8OA 2ZSFA 3MEQA 1UFKA 3HK2A 4NFYA 2X1HA 1WZEA 5TC4A 3WLIA 1MW8X 2HNAA 1KEEA 2YIJA 5KZMB 2J5XA 3QWIA 4ZZ3A 1N6KA 1P0FA 2DPGA 2G9UA 3CX3A 3JD0A 4WW0A 4XOUA 1TCUA 1SVKA 2Q2VA 3MCVA 4BKMA 4EENA 5C7IO 3DEKA 2GJ9A 3GAMA 3G49A 1NSTA 3M5PA 4LAFA 1B4DA 3WJ1A 2Q0HA 3FG9A 2AW5A 3CIOA 3CXUA 3HRIA 1V9SA 3HO8A 3R0VA 4O25A 4UFOA 5E7JA 3VR3A 1X6VA 3NDJA 2YWXA 3QFHA 2H0AA 3BG5A 1ZUNA 3DR3A 3G2KA 4PSUA 5DNYB 2Q3JA 3KDAA 2ZYHA 3Q2KA 4BB0A 3LQQA 1HNNA 1QE0A 5K51A 3GPBA 3W4KA 3ENKA 5BP7A 2ZUEA 2MYUA 2E4YA 2OAP1 2C58A 4ZVQA 4B32A 2H0QA 1UWCA 4DQKA 3T0FA 5BR4A 3D4PA 3IUBA 4C6RA 5K3BA 2C4VA 4DHEA 1TTHA 3LAWA 1VRCA 4KUGA 3UMJA 1QWSA 2HSGA 1E61A 1FXUA 2WKWA 2DQZA 3HBJA 4NAVA 3A11A 2XZDA 2GM5A 2LTAA 1U0FA 3CW9A 4QDTA 4UM9D 5CLJA 5AW0A 1G6HA 1V5FA 5FBKA 4MLCA 1U7OA 1VIDA 4IYRA 1WNFA 4L16A 4CM6A 4KO2S 4OI2A 1DAKA 3UHPA 2D0IA 2GGSA 4KN9S 4YV7A 1Y7IA 4KLNA 2FXIA 3R2JA 1O9GA 2C07A 2QAGC 2VL7A 1IN8A 3SXPA 3PQFA 5LYJF 2X5OA 3C3YA 1JU4A 1VYTA 3NONA 1BMFA 4ZAXA 1LZKA 5T4HA 2XT9A 1EJ6A 1RKBA 4YRFA 3WMRA 3RSLA 5H70A 4LKRA 4WZBB 4CV1A 5FRDA 2L17A 4ZV9A 3A2LA 3QG1A 4DE5A 2G4LA 1ZGCA 2FNAA 1WLYA 4FNMA 2VDQB 4TQ9A 3TBHA 3ZR4B 1B0PA 2R65A 1N0UA 4DCOA 3IEVA 1RWQA 2WKQA 4RM2A 1RR6A 1JFRA 1B8PA 3T7EA 2H48A 1U2ZA 5AVUA 3GV0A 5ICMA 4BWYA 1DOHA 4ZC1A 2XWPA 1JJIA 2GUGA 3IQDB 1EQAA 3V1NA 2Z8YA 2RKWA 1QOQB 4ES6A 5EKSA 2I4NA 4Y3UA 1D6MA 1IHYA 2C0CA 5ISMA 3LP8A 4WKGA 3DM9B 2C82A 5JSQA 3JU3A 1LEHA 1CR1A 1EEHA 2ZJ5A 3DEAA 1N2CA 3OE1A 3U39A 2ZDGA 3IMKA 4L28A 1YMVA 4EKIA 3AJEA 1H6BA 1Q2UA 2EW8A 1NGSA 1PWXA 1R3UA 2QX9A 3Q9LA 4JQYA 2PYIA 4OYYA 3RJTA 1XG5A 1C3OB 1YI8A 2IL1A 4H16A 1OD6A 4C4OA 1AC5A 3L7AA 4KC0A 3TRKA 1XQ9A 5LMUB 3IXMA 4YRRA 1P0CA 4WFIA 4YP6A 2CLEB 4P1ZA 4CR8A 1TM7E 1NUUA 2CC2A 3OX3A 4I6JA 3S28A 3UWPA 3U19A 1H8ED 1GUAA 4KK3A 3R7AA 2V7QD 1Z7EA 2HJVA 1QG2A 1UPUA 3R09A 1KMNA 1YJ8A 4HRXA 4Y9DA 2E4VA 1HQDA 4TLDA 4F5ZA 1GNTA 1U8XX 4IIBA 2D1SA 2QT9A 1E77A 1HDXA 4QTZA 4DLPA 1SK8A 4N0MA 4D8VA 3UAZA 3A1DA 3GXBA 4RXTA 2CHVA 3BREA 1DKUA 2ODTX 5DO9A 1S2NA 4B6SA 3K6SB 1F6WA 1J23A 4BYMA 1BS1A 2N1BA 2JLZA 1XN1A 2IT1A 2BI4A 2ZBRA 4L4XA 3NHWA 3AR2A 4KV7A 4O0LA 3HZOA 3LP6A 4ZJYA 1GU7A 1DXOA 1AY0A 1E2JA 4KE8A 1RLIA 4D0LB 2O14A 4QUGA 4PC3A 1EFPA 4AJOA 3G8CA 4MWCA 2WF5A 1B3RA 1GG5A 1T3ZA 3V46A 1FMTA 3WL4A 3GJ4A 3EVFA 4FYPA 2ONKA 1JDBB 1FYXA 1ZN9A 2WWTA 1KOGA 2GYVA 2PWYA 3H1TA 5KYNA 6CHYA 1PR3A 2H7VA 3UGKA 4WGFA 5J2TB 3ZC3A 1JDJA 2G5CA 4DBLC 2P35A 5DNWA 3U7QB 3KU1A 3HHPA 1NNEA 5C8YA 3Q12A 1JDTA 4IQFA 5ECDA 4OSOA 3C0KA 5KYYA 4B8ZA 2EERA 2ZAGA 1FDVA 4PR0A 4R9VA 2WQZA 2YC4C 3M82A 4MS4A 1TD9A 2JCXA 4MI3A 5DE3A 3TQRA 2Y0BA 3BK2A 4H35A 1X7GA 5KYUA 1QVVA 1LBSA 2ZSUA 4MWBA 3Q2OA 1Q0QA 1XMVA 3QMWA 2CHEA 3N3BC 1FW8A 4EUHA 2Q6OA 4HWOA 5A5DA 4S2EA 3QPAA 3QPWA 1NPYA 3Q1KA 4G1FA 2QMEA 1ORRA 3HA5A 3CLSD 4KGZA 2FUG1 3UMFA 5K0SA 1VYVA 3ZXUB 2NU6A 3KT8A 1GFSA 1WMSA 4J9VA 4YC7A 4Y18A 5EZQA 2FN4A 2IZZA 5BV0A 5LVAA 3B82A 1EWYA 1Z2NX 3PFFA 4JQZA 3UO8B 3SDSA 3EWIA 1DB3A 5ESXA 4B3JA 2GO1A 2JCVA 3CEAA 4FEGA 4OBWA 4LJRA 1R9MA 1ZOPA 5DLQC 2BELA 1VLLA 3IOCA 4MQMA 5DGCA 3AR9A 1E9FA 4LDZA 3OCVA 5CB4A 1NBIA 2C4TA 4BV9A 3ENZA 1DRVA 4YASA 3RTGA 4WKNA 1EMDA 4DDTA 2J3HA 1P7VA 3SQDA 4EHAA 2GZHA 2X22A 2IUTA 4C5CA 2OHVA 4GYKA 4TYNA 1T5BA 2HF2A 1M1NB 3EOAI 3MQFA 2YCBA 1AU9A 2AH5A 4G63A 4WSOA 4TYMA 2VYVD 3E53A 1Y7PA 2DFTA 1UJ5A 2IDJA 3IP7A 3C8UA 4Q21A 4DLNA 4YJ2A 5KNBH 1GITA 4GYYA 3CS3A 2ZE7A 4WXEA 3STVA 1ODTC 3PR1A 2C2WA 2F48A 3OWXA 1QCDA 2VK1A 2Y1FA 4H7HA 4CKCB 4FDMA 1UKVY 4AKSA 2ISQA 1SZJG 3QU4A 4MV5A 1ZIOA 4S05A 5DRTA 3STTA 4TXNA 3J80A 3TCKA 1JE0A 4ZHSA 1IZ7A 3DBHB 1ISPA 4OHFA 3Q40A 1OBCA 3BCUA 1RSZA 3ZWVA 1P6XA 1N1EA 3JTEA 1IJKA 3LSYA 2XHEA 4Z86A 1RU3A 3WL8A 1W4AA 1PT6A 2R62A 3GY0A 5BRAA 4RHTA 5HGXA 2FZVA 2FY8A 3UHFA 4OLJA 4Y6GB 1Y81A 3AESA 3IDAA 3MXOA 3R5TA 4M9QA 4KGXA 2F3TA 2Q3FA 3CCBA 3FBWA 3R6DA 4NZMA 3K0HA 3UT6A 2UYCA 2ADMA 3N05A 5JOQA 1VA5A 3DL0A 2F17A 4ZGWA 4ID3A 1EE2A 3NHRA 4ZZIA 1RJ9B 1Y8RA 2HQBA 1A88A 1G5IA 3IBSA 2A1UB 1CY6A 2C8JA 3IH5A 5LN1A 3N2IA 1A8PA 5GV7A 3U40A 3JQBA 3TSAA 3OOHA 3RFCA 5KDLA 4U6SA 3ST7A 1ACJA 4Q9HA 5M29A 3I9OA 4R9SA 4KRYA 2UXDB 3RGWS 1Z5GA 3D8UA 5E9QA 3OZ7A 5HJ7A 3ZU6A 4WFQA 3LWDA 3IO3A 1E7RA 3ZBTA 4G5SA 2X76A 4UATA 3NM6B 3BJMA 4G0UA 1G291 2W98A 1T9HA 1ZBDA 1QP8A 1KIAA 2Z2YA 3G79A 3Q6NA 4NVRA 4CF5A 1PW5A 4AO8A 1SR8A 2QF7A 2BBTA 3OT5A 3BYZA 1P9LA 3PI7A 4ZK6A 1Y1TA 2G4CA 3RVKA 3FTDA 3EBOA 5LD2C 2BGUA 4CQLA 3B48A 1TQ4A 2FF5A 3GP5A 2IYNA 4YIHA 2H9AA 3K2IA 2BR4A 1ISIA 3IOBA 4QXAA 5KYTA 2AFIA 1DVRA 2IDKA 2AF3C 3MJFA 4NJOA 5ALFA 2PUCA 4YHBA 1ULHA 1O2DA 2WFLB 3HWRA 4QXRA 4D82A 3WLTA 4EA9A 1YIAA 5B3LA 3VVCA 1DC5A 2QSUA 4G8JA 4QPPA 1M2WA 4WKOA 4XM1A 3S99A 2V0NA 1JDNA 4UAVA 4UNQA 5U4QA 5A3QA 4LRTB 1E7YA 3CHYA 7GPBA 3N8HA 5HK9A 2F1HA 2JLSA 4N5IX 3U49A 4ZFNA 5KTRA 3URKA 1SULA 2Q3HA 1LY1A 2Z95A 1BZYA 4RX1A 2QMZA 4DMRA 3DMGA 3L43A 4EY6A 4W5JA 4AP6A 1DC8A 1YU9A 5FJIA 1W36D 2FB9A 2R2AA 5J2UF 2WG0A 2WY2D 4KGDA 3F8WA 3NHFA 2B1IA 4FUTA 4GAEA 4WRRA 5COBA 3WRXA 5JNSA 2XCIA 1T2EA 1V47A 4YS6A 4DXAA 1KYXA 4YRTA 1XJQA 4NOJA 3I5UA 1VOTA 3MTAA 4J16C 3EOBI 4G0PA 5E1DA 3EVEA 4K81B 5CXQA 4O0MA 2ONJA 4F84A 1FS5A 1OR8A 1SOUA 3OCXA 2HBZA 2FW9A 1E0KA 2NYUA 4BBAA 3T34A 4KREA 2OHGA 4JFAA 5LQNA 4L9WA 5CJJA 3B51X 3KEQA 4Q47A 1NASA 3O8QA 1PQWA 4M9RA 5KSYA 1U81A 3DKRA 2B4RO 1F51E 3SN6A 2AGVA 1M67A 3H1AA 4PZLA 1AZSC 3GG9A 4MQEA 3TQCA 4ALIA 3E18A 1SKUA 5HF8A 1EVKA 1PJ4A 1VHLA 3R77A 3MWYW 3Q7TA 1ZOSA 4Q4JA 5CNMA 3UV6A 3L05A 4TZTA 2RHRA 1QWOA 4M46A 1T29A 2BUCA 3ZDAA 1C8KA 1T36B 2SCUA 4DQDA 3PXBA 4K2AA 2AK3A 4JROA 4NENB 5TY0A 3VAAA 5B3JC 1BJTA 1FMLA 1DKOA 4GZ5A 5JDCA 4ILEA 3X1JA 1UDXA 1WOMA 2ID4A 2R00C 3G2QA 3E48A 3QJ5A 2IVZA 3HRKA 3NTRA 3I0NA 3RWOA 2VAPA 5A3JA 1UL1X 4J3FA 2AC4A 3S8MA 1N3IA 3G68A 2JHPA 3HABA 1BXGA 3QKSA 4I19A 4J49A 4XGRA 4CEJA 1WQ4A 3ROPA 4EB6B 1M6YA 3DZCA 3UK2A 3U9SA 3OTGA 4KI0A 5IKOA 4EB8A 3VO2A 4KQKA 3OX4A 4PV7A 4K86A 3INRA 3ROZA 2I54A 4CL8A 3V8EA 2D00A 1HT3A 2HBQA 2XQGA 3NPAA 3JQAB 4D0NA 3QOXA 2C99A 2HRRA 5AVJA 3WMGA 2DWUA 4F4HA 2FA9A 3OJOA 1A9TA 1J42A 4ZD6A 2FMUA 2AZDA 3NVAA 1D1QA 1C8LA 4LXXA 3I05A 4HEJA 3T7CA 3WTCA 4CG1A 1LLCA 3ME5A 3MFQA 1BEUB 2FZEA 8ABPA 4X1OA 2RGRA 1ZSYA 4D9BA 1A82A 2PRZA 1EFAA 4P0QB 3KV3O 3KUCA 4UPEA 2J59A 2CNBA 4QAQA 4P93A 3NV9A 1JZTA 4P58A 1GSAA 2ZFUA 5FA5A 3RF6A 3VO1A 1V3VA 1U3CA 3AOEA 2QUBA 5BN4A 2Y9PB 2OQ2A 2PVCA 3UK7A 1BX1A 1DKNA 1CNEA 1HGXA 3K0SA 3M4YA 1EVIA 2R5WA 3L0PA 2BPOA 3P7MA 2PKRA 3VYUB 1Y1RA 1NBWB 3IUJA 2QTHA 4FFMA 3PPXA 4W1RA 2OYSA 1BMTA 1KYWA 3L6UA 4JX9A 4EYOA 1H8HA 3G1UA 4GECA 3AVQA 1KHHA 5HTOA 2AMVA 1JVNA 1BX0A 1E8MA 1O94A 1T1RA 4FIDA 2AKYA 1EUZA 4B3BA 1GAXA 3A4MA 4IWXA 1SVIA 4XRRA 5TPWA 2WMYA 2XBLA 2GS9A 3H9CA 4M22A 2IS4A 5BSUA 3H3XA 4BFXA 3MC1A 3R75A 2B8NA 2ZYRA 3L40A 2P2NA 4PLPA 1SC9A 2PKCA 2V74B 3VYVA 2PG3A 3LNCA 3DZGA 2AFIE 1JFFA 2XUHA 2REQB 1XRSB 2B94A 3L4BC 4RVHA 5JALA 4AJHA 4BHTA 4XX0B 3CW8X 3DFUA 4UCQA 3WNCA 3KV1A 4HUQB 4TLCA 1DBVO 2QVGA 2VLBA 3T7IA 2QX6A 3WNVA 1HNWB 2IS1A 4C4RA 3MPUA 4XFJA 3H3JA 3DQZA 3BTOA 1H2EA 3QTTA 1WB9A 3DVRX 2F55A 3FOFC 3SR4A 1G5FA 2CMHA 3B1XA 3QYJA 4MUFA 1DAHA 2GUWA 5AVZA 1F60A 1DDOA 2EW1A 2J3QA 2WHEA 3OAAA 5FOUA 5IFLA 1LX7A 3C1AA 2ZIAA 3DYIA 3F8TA 1ZITA 1PK9A 3FVTA 3RS2A 1YRBA 3L8MA 2RG1A 1OQAA 3LPNA 4AX8A 2H1VA 1X7YA 1FUKA 2HU2A 1K27A 3NHZA 1HRDA 3UHOA 3FR8A 2VPXA 2XE4A 4GLJA 3D3QA 4AY4A 3WYNA 3L18A 3DBOB 1KARA 4JB2A 5EOVA 3ZYCA 3D7KA 1RQNA 2QROA 1NR7A 4EY4A 1IUNA 4DA0A 1ECCA 1VBFA 2Q7XA 2QVCA 3MA0A 1T4CA 3EGCA 3THWA 2GF2A 4AY5A 4R1PA 1ZMOA 4CU5A 4I1IA 3KJGA 1SM4A 1Y9ZA 1P2TA 3BFVA 5DGDA 5EKUA 4QNNA 2ZBQA 5D8DA 1Y33E 5KQMA 3LE8A 2CLSA 5LZ8A 5K3FA 2DJIA 4M53A 1WCIA 3W6NA 2BFMA 4KIUA 4UHFA 2IEIA 4YJGA 2FMKA 1SIWA 5BRNA 4LVCA 1ETUA 1ZGJA 3MT8A 2II6A 2X8AA 3G59A 2FUEA 2R97A 1VHTA 4P4SB 1VSUA 5CVEA 3HP7A 5FF9A 4FQ7A 4I8IA 1HDYA 4X97A 5TB5A 3WL5A 4ZCIA 2JNWA 4DCMA 1IOZA 1E9BA 1MO4A 1OX4A 1H93A 4GPBA 4CKCA 1DNPA 1SOMA 2X3YA 3KCNA 1QMPA 5K0BA 3G0HA 1QQ5A 1Y4DE 2ZSHA 1VPLA 3QU2A 1YRLA 2O8VA 5D1NA 2UZ1B 3W6PA 1BFKA 1MR3F 1RWKA 1GLNA 4I99A 3E9DA 4K8OA 1RP1A 5DISB 3FX2A 5LSAA 4TUYA 1EUDB 4E70A 5AHKA 3GLUA 4WVFA 3TQHA 1N4AA 3PU6A 5HQJA 4QSMA 3M6AA 3EH2A 3DE3X 2X2FA 3OFVA 4X60A 4WBNF 4A6XA 1K5GA 1A9YA 1N1GA 2V0GA 3HWX1 3V55A 2NVBA 4TKVA 1Y6JA 4G5YA 3PDWA 3BQ9A 4GRAA 1CEYA 3PFCA 1ZLXA 2W58A 1G1AA 4FHZA 4K6OA 3CVOA 1YS9A 2BUBA 4A15A 4EYEA 4IDAA 2OWEA 1TK3A 2XGOA 1YS2X 3ZWKA 1NC3A 3CF4A 1RFLA 3DOEA 5IABA 3A6JA 4QOGA 1XMOB 2DY0A 5A3VA 2BL4A 4AUKA 5KDDA 2QTCA 5AXBA 2OMEA 4RSMA 4CDRA 4DFDA 1XVIA 1XVVA 5LDGA 1JWAB 2PHZA 4OKIA 2HIMA 1XKQA 3A28A 2H06A 3GLVA 1KBQA 4FCTA 3AEQB 1OFGA 1NTOA 4G67A 4KYIB 5E2BA 5KC9A 2PAAA 2HO5A 2KBEA 2ZKLA 1W96A 3ZVMA 1UJ4A 2AUMA 5KU7A 1G64A 1J9EA 1Y8QA 4GPTA 1QAMA 1V37A 3LECA 5EP1A 1FS6A 3NTQA 3GDWA 4URXR 2PSEA 3RI3A 2PLFA 3HZHA 1T1GA 4TT3A 5HE9A 3VNAA 2V4MA 3FI9A 4D45A 1WS6A 2XKAA 3LI2A 1OWLA 2CL0X 5B58T 1FW6A 1C3LA 2KS6A 3U7IA 2XWQA 1BN7A 1PJBA 4X66B 2NSHA 2MYNA 3A0UA 3M1YA 2G0TA 3N6XA 4ZDIA 1RAHA 2FFRA 4RZ3A 1NAHA 3N7TA 2VDOB 5GGYA 1Y98A 5EWJA 2MIIA 1AMNA 4X1YA 3I09A 3Q8MA 3KUXA 2RD2A 2CL5A 4P3OA 4D7AA 1Q22A 2J5KA 4MCAA 2F1IA