2RGDA

Crystal structure of h-rasq61l-gppnhp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGLEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncoprotein
molecule keywords GTPase HRas
publication title Transformation Efficiency of RasQ61 Mutants Linked to Structural Features of the Switch Regions in the Presence of Raf.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rgdA00
2EVWX 1ZM4A 5CLQA 2YC4C 4OK5A 3THOA 2D2EA 4JKIA 4OK3A 4P4SA 2QBYB 1PVOA 1CRPA 4JL6A 3RYTC 2J45A 3O8RA 3GFPA 4LYHA 1DAGA 2W6JD 1H8HA 2J0UB 5FR1A 5DIFA 1R5BA 2CMKA 3PFIA 1WE2A 1E98A 4LHWA 4M21A 3WMGA 4OQXA 4A82A 1U0JA 3BH6A 4CEHA 4P31A 2C8VA 3TGPA 1XEWX 4DB4A 5C1BA 4EPXA 2GEVA 4MGIR 4EFMA 1FQKA 2WMOB 1FX0B 1DTSA 3IBGA 2D7CA 2H57A 2OXCA 3BIFA 3U5ZB 1P72A 3L2OB 2IC5A 1YKSA 2CJWA 1FNMA 2B92A 3TSWA 1OT3A 4GRAA 4BE7B 2ZE6A 1Z47A 5DH9A 4R2IA 2ZJ5A 4XWKA 3O8CA 3RSLA 1G19A 2ZRLA 2VYFA 4HLUC 1FMLA 5HZKA 4YDHB 1F2UB 1GRRA 3LLUA 3M0EA 4PHHA 2EFGA 5FPYA 3THYA 2FDCA 1PLJA 2DFNA 3IQWA 4Q5IA 4TTRA 2PCLA 2IK8A 3EZ9A 4G5RA 1BYIA 2O52A 1Z6AA 1XTIA 2Z83A 3DKPA 2R8RA 4ZCMA 3B1WA 3FB4A 2HYIC 1DOAA 1SGWA 1AKEA 3FHOA 3VTKA 4PHTA 4FMBB 4B35A 1G8HA 2WICA 2VHJA 4PZYA 1OH7A 5FTNA 3U7HB 4HI0E 4IOKA 2WJYA 4A8JB 2K5UA 2IEZA 5KDDA 3QKRA 4LYAA 4KVAA 2DBYA 3C14C 2XB2A 5D3QA 1E2FA 2ZRJA 4BECA 1WP9A 5B2ZA 221PA 2PZEA 5GVRA 3SFVA 3GFOA 4TMZA 1XCMA 2ZQ5A 4OI2A 1E9CA 3K9GA 3U60B 1U81A 2QSZA 1Z08A 3K0FB 1DO2A 1NL3A 4I1VA 3AP3A 2ZRBA 1NSTA 1XNJA 4Z8XA 5FUWA 2ZRAA 3B7GA 5G3YA 3SYNA 2JLSA 2ZRHA 3EWSA 4PFSA 2QGZA 4Y0AA 1S1MA 3AF1A 5JFGA 1AS0A 2QP9X 3RDPA 5BN5A 4YMTA 1Q57A 2AN9A 1COWA 1P4SA 1OFUX 1NJGA 4O3MA 1UKEA 1CR1A 1U90A 2QAJA 4TMTA 4D82A 3EARA 5HZHA 5KYKA 3SJCA 4D81A 2IF2A 421PA 2OSBA 2QTHA 4BLQA 1TNDA 1BMFA 1BMFD 1KSHA 4N3NA 4ZKDA 2F1RA 4MH0R 1XTRA 4RCZA 4UXJA 2GJKA 1EWQA 5CYOA 1ZNZA 3CBQA 4GP6A 1T3SA 3AKEA 3EZ7A 4G5OA 3NWJA 2WKQA 4NYIQ 2RCNA 3B1XA 3ZZUA 2ZROA 2V6IA 4B3GA 2HJGA 2HCBA 5K8UA 4C0SA 5L8VA 5E7JA 3Q3JB 1ZIOA 3IPYA 3SJAA 2J0QA 4LPKA 4NCJA 3L8ZA 4P33A 5L3VA 1JJVA 2QBYA 2NO0A 1EXMA 2FFQA 2XOKD 3C41J 3D3QA 3K53A 2BVNA 3SJBA 1XJQA 4XH9B 1T5LA 1RC8A 2V1UA 3R7WB 2J0UA 1V43A 2CVFA 2VSOA 4V03A 4B44A 1Z0IA 1XDBA 4O0MA 2DWPA 4UNSA 1U9IC 1MKYA 1Z0DA 4FMDF 1KNQA 3HU2A 4OHXA 3RNLA 4G01B 4Q7LA 2NO7A 3K1JA 2EFDB 1K5GA 2P65A 1NMZA 2DB3A 1FX0A 1R0XA 2P3SA 4LZZA 1OKKD 1PLKA 4Q47A 3NDBB 3EG5A 3EWAA 1WXQA 2P6UA 4N0EA 5G41A 1DBSA 5CB6A 4LJ7A 4BRUA 5CM8B 3BOSA 4X8HA 3MWLA 3RHFA 1W4RA 1F2UA 4LJ5A 3K70C 1KJZA 1W47A 1VPLA 4BPBA 3KTAB 4PQYA 1D9ZA 2P6NA 3B85A 3X1DA 1O87A 1J99A 3ONWA 4URWR 2WJHA 2JAQA 3OZXA 4PHGA 1IJEA 1JECA 4QGAA 4UQOA 4A2WA 4ON9A 1MT0A 5FR2A 3FDIA 2A5GA 4Q01A 1P2TA 1TU3A 4LBVA 1GTVA 3GLFB 2AWNA 4A8JA 1HH4A 4TLAA 3OESA 1G64A 1IHUA 4G5QA 4MKFA 1ZNYA 1G4UR 1FW6A 1F5NA 2IYQA 4NZYA 2IYWA 4X8OA 3U3MA 4JLAA 4FD2A 4M4SA 4RZ2A 4EPRA 1Q1EA 4Z51A 5EJEA 3GLGE 1XEFA 2HT6A 3MRSA 4LJAA 4DWJA 1ODFA 1SKYE 2OFOA 3K0FA 3LW8A 3SOPA 1FOEB 2DWQA 1Q21A 4TTQA 1X86B 2H1LA 4IFEA 1P62B 2R65A 5FTLA 2BHRA 1UBEA 5TXGA 2IS6A 3PEYA 3NC1C 1M7HA 1NLZA 2YHSA 4GOXA 1NMXA 2ZM5A 1WMSA 4W5HA 5BWMA 2N1BA 2IS4A 4RSGA 1R10A 4BLSA 3QSYA 1RFLA 3AVOA 2RGDA 2GJ8A 2DR3A 3CX7A 2QP3A 4EPWA 1S2MA 3H4MA 4AY2A 2J41A 3A4NA 2HF9A 3KQNA 2GAAA 2ZUCA 1KI8A 1XFAA 2GJ9A 1E2KA 5EE0A 5GJVC 2WIBA 5FL3A 4EQ6B 3TW4A 2QG6A 4FCVA 3QVVA 1VG8A 1ZAKA 2GBLA 1M7GA 1JAIA 2IBMA 4DUGA 3GLHE 2O8EB 4DIDA 2B8WA 4DUGD 4DB2A 3A6PC 4G0NA 1CU1A 5FOTA 4ZDJA 2XB4A 3MSXA 4EPVA 3CH5A 3ZQJA 1KKLA 4PZZA 5DI3B 2FU5C 4W5JA 2DWOA 4DVGA 4NYMQ 2XEXA 3KKMA 1E4VA 2ZSEA 3CRMA 3B9QA 4M22A 3PCRB 2ZRPA 4GFDA 2OEPA 5DGXA 5SZJA 4M1OA 2ASEA 3AVVA 1D2NA 2G83A 1S9DA 3KUCA 3U2QA 2XJ9A 3R8FA 5TMPA 2A5FA 2YVUA 2YNMA 4URZR 4XIGS 2VEDA 4JVMA 1XD2B 3U3RA 3TRFA 4EJSB 5FL7A 3KXIA 4F92B 3I5XA 4C7OB 4BQSA 2R6FA 2BBOA 3HYTA 1XRJA 3IIJA 5FOUA 4AKEA 1AQYA 2W00A 3EASA 1ONBA 2GJAA 1UKZA 4Q9LA 2G1KA 4DLRA 3C7KA 2AFIE 4QHTA 3SHFA 1XCGB 1L7VC 4IXNA 3RS0A 3SS8A 1NLYA 2F1JA 5DN6A 3VHLB 5DN6D 1J2JA 1IN4A 1G7TA 1Z6XA 2JASA 4PAOA 3RS2A 3VR4A 3AV0B 2FPLA 2NTYC 4GI7A 1M8PA 1WBBA 2NMVA 1TF2A 2VP6A 4IRUB 4C3ZA 1KK3A 3KTAA 4WA7A 4TMXA 5IT5A 1MOZA 2F1IA 4KHZA 2O8CB 4UKDA 2F3TA 1SXJE 3ZZTA 2G9NA 1N0VC 3P20A 5E95A 1NVWQ 1W5SA 1Q3TA 2GCPA 3TE6A 2DYKA 3EPKA 2YC2C 4G5SA 3A1VA 3OEEA 3LBIA 1E6CA 4L5BA 3LX5A 4A0GA 5K8IA 3GLFA 5EXPA 1YZNA 4L15A 1XPRA 1RE0A 2F55A 5F98A 4Q4JB 2XXAB 1GFIA 2ZJYA 2VO1A 1OXXK 2BMJA 4P4UA 4ACBA 2HF8A 2AFHE 2VP9A 3R8CA 2ZSDA 3WP1B 1KZ7B 3AF3A 1PJRA 1HQYE 1OB5A 4C0JA 4TMVA 1UKYA 1QDEA 1BKDR 1TQ6A 3IIKA 1G3IA 2AD1A 2OG2A 4X8MA 2HV8A 1K5DA 5GJCA 2R6AA 1KI4A 4J0QA 5BYKA 2ZSFA 4LDJA 5HE8A 2ZJ2A 2H92A 1J8YF 1MO3A 5FI1B 1X1RA 4OQFA 3BS4A 4KI0A 1T3HA 1BOFA 1W48A 2W58A 3HU1A 1F3OA 2PJZA 5J4YA 4LJ9A 2ZI3A 1P7CA 4RCYA 1QHNA 2CL0X 1G7SA 2WVJA 4C9BA 3CX6A 3K9NA 3BE4A 4PPGA 3TAUA 2DFKB 4DCUA 1WB9A 1QVAA 3AVUA 1E1RA 2YYZA 4AK9A 2WWWA 2GJSA 5FOWA 3I92A 1JPNA 4FMDB 1HYQA 2IWHA 1Q1BA 5SZHB 2UZIR 4BWYA 4DLVA 2C96A 2DFTA 3EPLA 3DPUA 1AKYA 4ILEA 2C78A 4AC9A 4RJLA 4AD8A 2VHUA 2GVZC 2WWIA 4TQUS 3VNVA 3NH9A 2O8EA 2PMKA 3RC8A 2W2TA 3KXLA 1A2KC 2CHGA 3CM0A 5H68A 2BC9A 1XMSA 2JEOA 5DI3A 1JAHA 1KMQA 3DDCA 5E4FA 3LBHA 2Z4SA 3MCAA 4XD7D 4V02A 1SHKA 5HTKA 4DZZA 5TB5A 1X1SA 3VKGA 3GJ3A 3MG9A 2WAXA 2WJVA 3UK6A 3A1TA 3LXXA 3LBNA 1XD2A 1E9EA 2HXYA 2KI5A 4IOMA 5FTJA 4EJSA 5AJZA 2GNOA 5FOSA 4MUBA 1XMVA 3N70A 1CJMA 4C7OA 5BW8A 1Z0JA 1ZM2A 4NKRA 1GITA 4BEBA 3LV8A 4TYWA 1WBDA 4NE2A 4RFSB 1I2MA 2WJJA 5FUYA 5JZVA 1N5KA 1XXHB 4M9ZA 2BV3A 5CIWA 2WWXA 2VP5A 1OV4A 1QHGA 2X77A 2ANCA 3AH8A 3KJGA 3MWYW 1G291 1RW4A 1XMJA 1M1YE 2C77A 5AUQA 1B23P 3UWKA 4MA4A 1TEXA 1GL6A 4KXFB 4ESVA 3NIBA 2JLRA 2KB0A 4M9XA 5CJPA 4EAQA 3MFYA 2OBMA 2X2EA 4HSEA 4QGFA 4MKIA 4A15A 1YR8A 3CF2A 1UADA 1T5IA 3OFNA 4TMWA 1P6XA 1VKJA 4QNMA 1PUJA 1TMKA 3OIUA 1JBKA 4NP6A 4DKXA 1QG2A 4MYUA 3L0PA 4NTZA 1I2DA 4P4SB 3VMFA 2FSGA 3BB4A 2V8OA 2IYTA 4DLUA 1HUQA 4Q9JA 4YONB 5J40A 4ASUA 3GEHA 4HB4A 1KTVA 2XNSA 3PQCA 4IW3B 1LV7A 4LSGA 4Q4JA 3RABA 2XXAA 3NKVA 4BLPA 2FH5B 1AS2A 5JCPA 1E2PA 3SQWA 4UNPA 1CR4A 1GRNA 3QKTA 1XCPA 2Z6VA 2ZYWX 4CEHB 2JJ1A 2YINC 4V0KA 2JJ1D 2ZSBA 3AF2A 4OHYA 2ZSAA 2RGBA 3EC1A 1RPZA 1G41A 1DELA 3WYGA 3BORA 5BYJA 4QJ4A 1IN5A 4MGKR 3T5GA 1HEIA 1AK2A 3QBTA 2PT7A 4A2PA 2JCSA 1Z6GA 3OE7D 4LHYA 3CONA 3FMOB 4WW0A 2FOLA 3F5FA 1TTTA 2KWIA 2YOHA 3AUXA 4TMKA 1XZQA 4OYHA 1QHYA 4PO8A 2QP4A 3TQFA 4A1FA 2WJGA 2ZRGA 3CNLA 5KSYA 3AF0A 3CRQA 5KNDA 1JALA 1E9BA 3GJ7A 5C2JB 3ZS8A 2H7VA 1A2BA 4B43A 3B13B 5JEEA 2FMXA 2JLZA 1KJYA 1TQ4A 3QEOA 4W5WA 3K0SA 3ICEA 2C2HA 4BZXA 3GFTA 3B1YA 3OIYA 2R9VA 4US0R 2EU8A 1Z63A 1I4TD 1JR3A 1QBKC 1N3BA 3WHLA 3DHWC 1JR3D 1RVDA 2KBFA 4BLRA 5DYGA 1X8JA 5KO2A 5LDDC 4JSTA 1MO5A 1W1WA 5FBWB 5HKKA 5JS8A 4WZ6A 4CEJB 1F60A 1GP2A 3FHTA 2REOA 2ONKA 1GSIA 4Q1DA 2IXEA 1HY3A 3S1AB 1JEDA 2X8AA 1C9KA 4R7ZA 1RZ3A 4OI4A 1E0KA 2FX3A 2IL1A 4IXMA 3PR1A 4UNNA 1NNEA 1XJCA 2EFCB 1FUKA 2ZE8A 1OFIA 4JIMA 1OXSC 1ZC3A 1KGDA 4U02A 4V0LA 1P2VA 3GJ6A 3ADCA 3X1YA 4R71A 2ZI5A 2Q3FA 2ZITA 3W9YA 1P3JA 1SVSA 2ZTSA 2IHYA 3QXJA 4TLDA 3LQRA 3OIVA 2FEOA 3MUFA 2OXRA 2HDNB 1X3SA 2B7CA 3TH5A 1G3MA 3EZ2A 4PC7A 1U2RA 2FZ4A 1Z29A 2OLJA 3I8XA 4EKDA 4IOLA 5FUVA 1IXZA 5JHHB 5EZ5A 1D9XA 1RRCA 1HT1E 3AGQA 4PAMA 4RFSA 4EFLA 2OFXA 3CUEF 5JJLA 4Q7MB 2BBSA 1E0JA 3O8BA 4ARZA 5JECA 1ETUA 3GLIB 2ZS9A 2PCJA 4NH0A 1K6MA 3DOFA 1KI6B 2ZI4A 3K0EA 4IJMA 2J3EA 2QN6A 4O2LA 5LD2B 2PZFA 1NVVQ 5JRZA 3KKOA 3K09A 2DHRA 4N1AA 4ZDWA 2QAGB 3SR0A 3BGWA 4JLMA 1SXJC 2IXFA 3TVTA 3MLEA 1NIJA 4GBMA 2R6DA 2D7DA 1RRFA 4PO9A 5JWOA 4NCHA 4HZIA 1A7JA 5K8TA 521PA 1N6IA 4TL9A 1EFTA 2WWFA 1L2TA 2WSSA 2WSSD 1OH5A 1W4CA 1ZVQA 1YZLA 1OSNA 2GESA 3IHWA 4AI6A 2NPIA 2FSHA 2ODWA 5CYPA 4E07A 3VKWA 2W6JA 2W2VA 4M8NE 1S9HA 2QSYA 2CE7A 2VA8A 1UPTA 4TLBA 3EA0A 1Y63A 1QHHA 3HJNA 3E1SA 3UG7A 2BCJQ 1LS6A 4P3YA 1QVRA 2GF0A 2ZE7A 1IAQA 2R62A 4I1OA 3T34A 3LH5A 4AURA 1VDZA 2Q9CA 3VQTA 4BZQA 4E03A 2QY9A 1UBFA 3CNNA 5JJKA 5EP4A 2P0EA 1CKEA 1T0JB 3CRRA 2QU8A 3AQ4A 3U4QA 1YVDA 1VCNA 2HLDA 2HLDD 4D4KA 1DEKA 4XVQA 3UWOA 1US8B 2ZETA 1GKYA 3FPAA 3I32A 1T6NA 2XGJA 2FNAA 5KPDA 3PV0A 3BB1A 4IDNA 1YE8A 3VR2A 4HYYA 3R9WA 2ZJAA 2OESA 3MD0A 1KI2A 3Q8XB 1U8AA 1FNNA 4RVCA 2QT1A 1VCOA 1J90A 2O8DB 4HATA 3IDQA 4XJXA 1CEEA 3AKYA 4LX0A 4URUR 2W0MA 1EFHA 5BN3A 1L4YA 1VYVA 2QUZA 1P2UA 2NGRA 1JJ7A 3A1WA 1NI3A 1UM8A 4IDHA 1GILA 4GDFA 4QC2A 4CEJA 3U3JA 1OFHA 3H84A 3S1AA 1JQLB 4OL0A 1G6HA 2ZRFA 3IEUA 3NTUA 5DNYB 2GZAA 2QL6A 2G77B 3AVQA 4Z54A 3CNOA 1G8YA 3AVTA 1AN0A 1L4UA 1R4AA 5F2EA 4QHSA 3IO3A 4NYJQ 4OQNA 3QKSB 2OAQ1 1ZUIA 2FWRA 2OT3B 4DCVA 3VKHA 1KO4A 2MMGA 3B60A 1YJ5A 4B3XA 3UMSA 3SBDA 1IXSB 2XJ4A 2Q6TA 2RHDA 2LCFA 3H1TA 4MITA 3SU8A 2Q9AA 2RGCA 2RKOA 2QQEA 5J47A 1GM5A 1VHLA 5J4HA 1ZD8A 2D2FA 1GDDA 2AHOA 3CH4B 4LC1A 4OQLA 2RGNA 4B3DA 3WRXC 1UF9A 1BS1A 1W49A 2G3YA 4GOJA 8OHMA 3K70D 3CX8A 1ESMA 621PA 2GXAA 3Q85A 3CF6R 4YQFA 3GLIA 3T35A 1XEXA 1Q3HA 1ZBDA 1KI6A 3BERA 3WXMA 4KYUA 3K0CA 3X2SA 4ZDIA 5BN4A 2G88A 3ADBA 3VX4A 1XX6A 1R2QA 2QAGA 1XP8A 1P73A 3U3OA 2FGJA 1M34E 1KIMA 2XTNA 3QE0A 3LX8A 4Q4LA 3ZZ0A 1LTQA 2ZIAA 4KO8A 4KODA 4URXR 3CRW1 3PG5A 4GT1A 2N42A 4D2IA 5CK5A 4KV9A 1A82A 1IN7A 1OXUA 3HPRA 3MWJA 1BIFA 2BDTA 2PX0A 5DHFA 1NVXQ 1ZMXA 1R8SA 1EFRD 3F3YA 3C5CA 4BLTA 4IOJA 5ANRB 4CIDA 3V00A 1Z5ZA 1KYIA 1SQ5A 2D4HA 4QBGB 3PXGA 3PJRA 2OE2A 1Z0FA 2XOKA 4RD6A 4US2R 5E7MA 1RJ9B 3MMPA 1OIXA 2OM2A 4F7WA 4JL5A 4M53A 3UATA 2ORWA 3CZQA 1II0A 2UVQA 3KXKA 4X8LA 5KSPA 2IYYA 1KAGA 3T1QA 2IYUA 1KO5A 1XTQA 2VP4A 3LRPA 1I4DD 3ND9A 5SZKB 4B75A 1KI3A 1W2GA 4B32A 4BASA 3EA5A 1W36C 1W4BA 2W83A 4KFUA 1N6LA 2ERYA 5EQTA 5IRCD 1Z83A 2O5VA 1E0SA 3FKQA 4MYCA 3IGFA 5K8LA 3GLFE 4CRWB 3PEVA 4QNRA 3Q7QA 1ZNWA 4DXAA 3RS3A 2V6JA 2F9LA 3WRYC 4CT5A 1OKKA 4BFWA 4ZDKA 1KO7A 4M1SA 1G6OA 2CCKA 3A4LA 1US8A 1U99A 2A2ZA 3LO5A 3WBKA 4Z8YA 4A9AA 3TSOA 4UNQA 1KK2A 1LS1A 1GL7A 1YU9A 2QROA 3DM9B 5H70A 3LVQE 1Q44A 2QRNA 4JVNA 2J7KA 1XPUA 4TQAA 3QQ5A 5F3WB 1QRAA 4PQRA 5EZ6B 4RD4A 2CE2X 4HAZA 1UFQA 4PTLA 5CDFA 5HPYB 3ADKA 3PITA 2O8DA 3LW7A 2Z43A 2MMCA 4WZAE 4Z1MA 4Z1MD 1KDOA 1W7AA 4JBYA 3E2IA 1N6KA 5JEDA 3J81k 2D3WA 3W34A 5GVSA 1T8UA 3NH6A 2BMDA 5EUMA 4KSCA 4DSTA 3O8DA 5H1YA 1WCV1 2F6RA 3FGNA 3SBEA 2GTPA 4GZLA 3K9HA 5G53C 4BFZA 4A0HA 4Q1EA 2X19A 4JMPA 4DEYA 1XTKA 3BRWD 3RLFA 3RRYA 3FWYA 5HE9A 2ZR0A 3AM1A 2ZU6A 1M6NA 1TF7A 3B6EA 2KSQA 4LC0A 1EGAA 5FI0B 1U8ZA 2AD5A 5LBIA 1ANKA 2VQSA 4IVPA 2GXSA 2QMHA 2TMKA 3G0HA 3ZH9B 1ZP6A 3QKSA 3EPHA 1NVUQ 2SHKA 3W8RA 4B34A 5F9FA 2JLYA 1DS6A 5J5CA 3NBZC 1Z8FA 2QT0A 3TSZA 3P4XA 1TPZA 1XWIA 4HLDA 4JLKA 1NN5A 1FPMA 3WMEA 3AKDA 1E2JA 4JBWA 4LHZA 3UPUA 1E2HA 3CB4A 3KUDA 2BCGY 4L4UA 2BOVA 1S3GA 2V1XA 3KB1A 4KBFA 4HDCA 4WIAA 2ZANA 3U7GA 3F0TA 2VBCA 2JJ2A 2OBNA 4IEIA 2GEUA 5GADl 2JJ2D 5CLLA 2JLVA 1RYFA 5LPNA 3EZ6A 1G7RA 2ZI6A 3NBYC 5CJ2A 1NN0A 4KAXA 1IY2A 1ZM9A 4PPNA 4DLTA 3GPLA 4F38A 1ZIPA 2FPMA 4L9SA 3FTQA 2QTVB 2IWRA 2QNRA 4NCNA 3RS5A 1CLUA 3EIQA 4N0DA 3B1ZA 3QXSA 4AKHA 5FBVB 1Z07A 1PLLA 1R6BX 3A4MA 4DRZA 2QGNA 1HQCA 1GKIA 4MRPA 4CDGA 4QKQA 1R8QA 3CPHA 1P5ZB 4GMDA 2A30A 1LW7A 4DDVA 2IX3A 3VR6A 3ZVMA 1RJ9A 4LYFA 4TYYA 3CPEA 2XZPA 3LY5A 1KO1A 4DCNA 1CR2A 3CPJB 1MABB 3TAHA 4BUJA 4C0BA 2IYZA 3TVDA 4OKSA 4LJ6A 4L9WA 4IVQA 3FMPB 4A2QA 2GXQA 3EX7C 2GWHA 4Q66C 4FI3C 3T5DA 1HV8A 3QVUA 4A8JC 4B2LA 4C0KA 5JWHA 3BWDD 2QQ0A 2FJUA 1UEIA 1S4QA 5AJWA 2A5YB 3GQBA 5E3HA 2GETA 1TQDA 1EK0A 2WV9A 1M2OB 4LRWA 1E2DA 1E79A 3I1FA 4G5GA 1TL7C 1E79D 4M1TA 4D80A 4U7DA 1G3UA 5F9HA 2F43B 2VIIA 2RHMA 2AK3A 2ZJOA 4MRRA 1EX6A 5TARA 4OI1A 3VR1A 3X1WA 4K8OA 2IF0A 2NIPA 4MRNA 2A3RA 4JYCA 3JZMA 4M1KA 4QRHA 5A5GA 3BH0A 2RH5A 2GCNA 2G6BA 3TLXA 3PEWA 4RZUA 4OHVA 2ODEA 3DL0A 1W0JD 3ZYCA 1Z2CA 5AWFC 2JLXA 5JWRA 1G5PA 1Q20A 4R2HA 1TU4A 1NJFA 1FZQA 4KLZA 2JDID 4QFMA 4V0OA 4BGDA 1R0ZA 2PJRA 2ODNA 4E5UA 1OYYA 1GAJA 3KFXA 2PX3A 4FIDA 4O25A 2BKEA 1NG1A 1D5CA 1GNPA 2ATVA 4ESHA 2H18A 3AVXA 1T0HB 5D3MB 2ZI7A 1NG9A 2IW3A 3A58B 3GCGA 3E70C 2ATXA 3FFAA 2Q3MA 3Q5EA 4JS0A 1OIWA 5H8WA 2PEZA 2XSZA 3CLVA 5CIQA 3UANA 3I61A 2XSZD 5DSZA 1JR3E 4JVSB 1U8YA 4WOPA 2GBLC 4BFXA 1NSFA 2ZRKA 4RD1A 1YRBA 2LWIA 2H8KA 2OAP1 2WKRA 3SNHA 2GZHA 4IVRA 4QM7A 1U98A 1KKMA 1UBCA 1E4YA 5L3QB 2J87A 4QL3A 4RY2A 4LV8B 4OQMA 2F1HA 1XPOA 4LPSA 4ZPXA 2OHFA 2BKUA 2CK3D 2IXGA 5J4LA 1RRGA 2RGGA 4YMVA 1HA3A 3CWZA 3SHWA 1KDTA 4IDPA 1NLFA 1ZU4A 1RKBA 1CJKC 4GSYA 4MGYR 1CRQA 3IUYA 2WKPA 3W3AA 4LJ4A 4C0QC 1XU4A 1CJVC 4LY6A 5AR1A 1X8KA 3Q7PA 2ZYUX 4F93B 1FTNA 3LA6A 4F91B 2VHQA 4MYHA 1JNYA 2D74A 1KJWA 4FCTA 2ZU0C 3RSOA 3VNUA 4QG7A 4PPQA 2HYDA 5B58C 4E09A 1BYUA 1DG1G 1JXMA 2ZPTX 3C16C 4JT4A 4HAWA 3UKDA 2XITA 3JVVA 4JBXA 4CF7A 5IK2D 2O0HA 1Y3AA 5CK4A 1KK1A 1WRBA 3P1JA 1E2EA 1CXZA 2I3BA 3P32A 1E9SA 4CZ2A 1XXHE 1KO8A 4TT3A 4AIIA 2FFBA 2DPXA 4KLNA 2VH5R 4TT3D 2E87A 3LWNA 3D6TB 2O8FA 1E2MA 1W46A 2R6GA 1KAOA 1NBMA 3AB3A 4XD7A 1JQJC 1NBMD 3HPQA 4S35A 4EUNA 1Q12A 3U44B 1KZGB 2GHIA 1XTJA 3LAWA 3MAAC 4XWAA 1MABA 4GL2A 1CS4C 4DDTA 1CIPA 3HWSA 5ELXA 2C98A 2BBTA 4JKYA 3AVWA 2A5DA 4I1UA 2AX4A 5B64A 4V0MA 3K8YA 3TUJC 1T3LA 4HEJA 5CB8A 5C46F 2FFHA 2NOAA 1MO6A 1FQJA 3RWOA 4CW7A 1N5JA 2OILA 1EX7A 3KQLA 1G1MA 1W0KA 5JSZB 1W0KD 2FF7A 1FP7A 4A0RA 4JLDA 5EE1A 2QEQA 2FPKA 4A0FA 4ARZB 1R7RA 1KI1A 4HDQB 1ESNA 3ASZA 1OFTA 1E2LA 2F43A 3TNFA 2HXSA 4AWXA 1KOFA 4JVLA 1AZSC 4KYIB 1E2QA 3LQQA 3OHMA 3P26A 1TX4B 1F48A 2V4ZA 5CM9C 3B5JA 4B76A 2L0XA 1K8RA 1TAGA 3FKSD 2JLWA 1TUEA 2XZOA 4Q1BA 5JHGB 1E9FA 2J9RA 2FA9A 1KDPA 4TZ6A 3NBFA 2CLCX 4OK6A 5TV2A 4JL8A 3P27A 1N6RA 3ZLJA 1IQPA 1XEWY 2GVDC 4HAXA 2RB4A 1NF3A 1W5TA 3QPVA 1J7KA 3MWKA 1OIVA 3QI2A 2YWHA 1OH6A 5GJBA 3L8YA 2Q9BA 5KPJA 1NRJB 5D3MA 5C4GB 1QHHB 5BXQC 3B82A 3HR7A 3I72A 3BH7A 3UXMA 3DOEA 3QPUA 2JLUA 3T1VA 3WHKA 1E9DA 1GZSA 3QENA 1W44A 4OHWA 2DCUA 5KU1A 3GEIA 1LB1B 4Q1FA 4LCBA 2VF7A 3L0OA 3T61A 1SVOA 3QKUA 4ERNA 1KDRA 1A5TA 1Z0AA 3OE7A 3FE2A 2CL7X 4II7A 3OIWA 3K0AB 5JCZA 4Q4AB 5DYIA 3U4QB 3A36A 5FOXA 4UXIA 5JLJA 5L3QA 3X1XA 3LXRA 3E5HA 1P61B 3UG6A 1GUAA 5DI9A 1OW3B 3T15A 4DCTA 1R5OA 4LBWA 1CULC 4GMXA 3NXSA 5KNCA 4DJTA 4RFVA 2RAPA 1UJ2A 1UBGA 4MYTA 3N5CA 2V55B 4QM6A 3QXXA 3H0KA 4PX9A 4W7SA 3X1ZA 2QPOA 4EJSC 3WNBA 3W5JA 1ZUHA 2C9YA 1ZCAA 3G5UA 4LUCA 4XSHA 2ZJ8A 3NC0C 2FSFA 2ZI9A 2DFLA 1OB2A 4HAVA 4XTRA 4KVGA 2QE7A 2BEJA 4Q02A 1QHIA 5UKDA 2QE7D 3VX3A 1ZM3A 1IM2A 2ZUDA 3W6NA 2QA5A 3SC3A 3NHAA 1KY2A 1AJEA 2AKYA 4LI0A 2PH1A 3TJZA 1JR6A 1LNZA 3GLIE 1UAAA 4I99A 4YMSA 3TMKA 2FGKA 3PUYA 2REXB 4FMCF 4NYIR 2EWWA 1N6NA 3ASYA 5DLQC 3QJYA 2ZXUA 1VG0B 4LYJA 1N25A 1YZKA 2BMFA 3U44A 4BFSA 1MR3F 3QF4B 1YZGA 4Q1AA 3VAAA 1NKSA 1MV5A 4DHEA 1SKQA 1DAIA 1GG2A 1VECA 2PEYA 4B71A 4O2RA 3KZ1E 4LJ8A 4ZCIA 1T8TA 2AKAB 2JA1A 4M2LA 3CF0A 2D62A 4DT1A 5JJIA 1VG9B 5IDVA 3AUYA 2ZS7A 2PT5A 3PIRA 3N2IA 2VRWA 3BFVA 2ZR9A 1R5NA 4HLUA 3ZGXA 2BEKA 5JSZA 3K70B 1OH8A 1Z2AA 1G17A 4XOIA 4IHQA 1KSGA 2P6RA 5HCNA 3BK7A 2A5JA 4PO1A 1XEXB 1LF0A 3WP0A 3EW9A 1FTSA 1N5IA 2ANBA 2BIFA 4YLGA 4JJZA 4DSUA 3QG5A 1QF9A 1G3RA 3DZDA 5M04A 1P9WA 2XZLA 6Q21A 1TEVA 4MDFA 1XJ0A 2GRJA 1Q1ZA 1JB1A 2VPPA 4KSBA 2PZGA 3MGCA 3SJZA 5JS7A 5AK0A 4XVUA 1XB2A 1O3YA 3GJ8A 3NDPA 4M9QA 4Q1CA 5KDLA 2YZ2A 4HLQB 3NEYA 3LDAA 1HTWA 2A9KA 2HT1A 2GXUA 2J59A 3WYFA 3TUZC 1KSJA 1S3SA 4US1R 1SVWA 5DISB 4QBIA 3I73A 2PMDA 2YJTD 4B3FX 2PLFA 3IIMA 3U6BA 3FOZA 4R9UC 4HB3A 3RC3A 2A7QA 3A1UA 3QEJA 5CDFE 3CR7A 3KKNA 1E94E 3ZVNA 2JIZD 4NONA 4B2PA 3VFDA 4B3CA 3QXHA 2I1QA 4NL4H 5FTMA 1LF5A 1KI7A 4UXHA 2ZVPX 4PC3A 2QPTA 3K0AA 4Q4AA 3KJIA 4KBGA 2GA8A 5JI3E 1H8HD 5EP2A 1IJFA 3DEFA 2I1VB 4RZ3A 1NKTA 1SVLA 3U7FB 2VHTA 4TYPA 3KFVA 5IF9A 4DLXA 3CW2A 2NZ8A 5AUNB 1XMIA 4K46A 1VG1A 4A6XA 4F4JA 1Z22A 1Q1QA 4QBHA 2Q3HA 4Q21A 1G8GA 2FEMA 3WBJA 2F9MA 5DO9A 2V9PA 1S1CA 1DAMA 1FFHA 3R20A 1XBTA 2UKDA 1R0YA 2R44A 4B73A 5JRJA 2ORIA 1AS3A 1CTQA 1VIYA 2VSFA 5A4JA 3UMFA 2H5EA 4BRWA 4YMUA 1XD9A 1TF5A 2J5XA 2NO1A 5J4VA 5FPTA 3QG1A 3VHXA 4URVR 2WM9B 2VSXA 1UDXA 4D25A 3I5YA 4KCGA 3RS7A 2WHXA 4HLCA 2WWHA 3W90A 2QTFA 4LHVA 4YMWA 2GDJA 4EPYA 1E99A 1DAKA 1IOZA 4LV5B 2ZRIA 5HCIA 1A4RA 1G18A 2Y8EA 3M6AA 3BC1A 3RVBA 3K09C 4DSOA 3T1TA 3ZD7A 4C0AC 4JT2A 3DMDA 1U9IA 5L3RA 2CCGA 3ZIAA 2YWGA 3KJHA 1TQ2A 1MRNA 2CCJA 3RRZA 1IY1A 3ZIAD 5B30A 2D06A 2RMKA 2CHVA 4YC7A 3OF5A 1W36D 3QF4A 1G3QA 2B8TA 3DMNA 4NYMR 1II8B 3PUWA 1OYWA 2J0VA 3GD7A 3PUZA 4BZPA 1D8TA 4JLJA 4LGMA 2IYSA 3T1OA 3EC2A 1JPJA 2AXNA 2J0SA 1YHNA 3FHCB 4M0LA 1FL9A 1ZUNB 1LY1A 3VR3A 3U61B 1E2GA 2OV2A 2N46A 4I1SA 1E0AA 1M7BA 2W0SA 1VYUA 5KOYA 4TZ0A 2FZLA 5FPSA 3TK1A 3RANA 2FG5A 3KDSE 1VTKA 1CJTC 2MSCB 3TUIC 4DSNA 4B74A 1ELOA 3HDTA 3CRVA 3QY0A 1RYHA 1ZC4A 4A92A 4BFVA 5JBQA 4RKEA 3NVAA 3I62A 2OFWA 3P4YA 4JSYA 2EFHB 1COWD 3RS4A 2AXPA 4IKEA 4GPTA 3NG1A 4PC2A 1DE0A 3AEZA 4FN5A 1P75A 2O0KA 1G8FA 3EAQA 1T9HA 4C0HA 1D6JA 2GAOA 1EFRA 4DLZA 4RZXA 2KJQA 3EPJA 4GOKA 1IN8A 1LVGA 3UMRA 4NPHA 3IQXA 1OXTA 1A1VA 4TQ9A 2VHCA 4B6EA 1IXRC 1PUIA 1TADA 3H2YA 4PHFA 2AK2A 1AIPA 3AKCA 2VF8A 4NCIA 3CO5A 3GMTA 4D0NA 2YOGA 1F2TB 3F8TA 1NIPA 1E96A 1G21E 2GCOB 4JYBA 3ADDA 2C04A 4PC6A 3AP1A 2OO7A 4M1MA 1G5TA 5L3SB 2JGNA 2HCJB 4TYQA 4U5XA 1DO0A 5CITA 2KE5A 3BBPA 5FFMA 3SEAA 3SE0A 2OCPA 2AL7A 4ZV4A 5J4KA 4QJ3A 1Z06A 4NU0A 3VR5A 2ZVQX 1EESA 1IY0A 4DDUA 5LB2A 4DC9A 4F4IA 1NY6A 1ZRHA 3QBVA 3KQKA 1NN3A 4P32A 5AJYA 2IHBA 3SZRA 2YOFA 1AZTA 4FMCB 3UIEA 2IS1A 3REGA 3ZJYA 4D0GA 2QMOA 4DLYA 3MJRA 2WJIA 5G40A 1P9RA 4HUQB 4IEEA 4JLOA 4TL7A 4DLWA 2QRZA 1ZW6A 3TW8B 3G82C 1HE1C 1WF3A 1N6OA 1XF9A 4XSGA 1D2MA 4TWZA 2WOOA 1QG4A 4B47A 4KFRA 2BBWA 2PL3A 2OUKA 3RRMA 1ZYUA 5IHPA 2CDNA 1H65A 3GP8A 1ZINA 2IUUA 1BO6A 1QHSA 4MDEA 4PANA 3PEUA 1VYTA 3SN6A 2NQ2C 5B57C 1SHZA 2CL6X 2G0NA 1UDWA 2RGNC 5SZIA 1E32A 1VHTA 3WY9A 2G1JA 2J7PA 4QHYA 2J7PD 1DPFA 2DY1A 3O47A 2WIAA 5G3ZA 1G16A 1KI9A 1DVRA 1N6HA 3K0CC 4D26A 5LD2C 1U94A 1SVMA 3KKQA 2ECKA 1Z6TA 2C99A 1OPXA 1ZM7A 2FFAA 4ZO4A 5FOVA 5P21A 2NPFA 2QAGC 1YR9A 3ZQ6A 4JLPA 3FVQA 5EE3A 3W3ZB 2CXXA 1GIAA 4C30A 3LNCA 1XD8A 5A0FA 1GVNB 3KQUA 1EFCA 1YRAA 3ZS9A 2BM1A 1II8A 4MKGA 4ZKEA 4PC1A 1E2NA 1EFUA 4KITB 1NY5A 2VTKA 4FXPA 4RD2A 4GP7A 4UJ5A 3L0SA 4TL6A 1OHHA 3ETLA 1NBME 2CNWA 1OHHD 1P2SA 2CNWD 3B78A 2W2XA 2XX3A 2P5SA 3QUSA 1G5RA 2GF9A 1P9NA 4RD3A 4AG6A 2B7BA 4V0NA 4B48A 2WBLC 3L0IB 4Q7KA 3W6PA 2J1LA 4P0TA 3REFA 4BEJA 1EG7A 3KX2A 2ZJBA 3I3SR 1NMYA 5TDHA 4W9MC 4V0ME 2QM7A 2ZEJA 4TSFA 2XTZA 4TSFD 3B9PA 2IYVA 1IONA 4Q48A 4DEXA 2IA5A 2OCYC 1S0UA 2OCAA 4Q9HA 4HB2A 2ZUBA 2ZR7A 5EP3A 1OLOA 1E3MA 4QXAA 2O8FB 1QHXA 3GLGB 4CVNA 2HJVA 3AF4A 3W5IA 3CR8A 3DO6A 3D31A 3PUXA 2Q21A 1BH2A 1SKYB 4WXRA 2PBRA 2V3CC 4TL8A 3ZD6A 3DZ8A 2XNDA 3OAAA 1AQUA 2XNDD 3OAAD 1GNRA 4PQFA 4D4JA 4CEIB 4Q19A 1F2TA 3AGPA 1G9XA 2GCOA 3LD9A 4Q00A 1VCMA 1M74A 5TY0A 2IUTA 2VP0A 4WAUA 3B8HA 5L3SA 1MO4A 5FBLB 1QZXA 2VL7A 3R9IA 2YKGA 2IS2A 4CT4B 1FMJA 1GWNA 2RGEA 4HZUB 1Z3IX 3C15C 1G20E 3EZFA 3TR0A 721PA 3KB2A 2ERXA 4B3BA 4DDWA 1Z6YA 1JXOA 1ZJ6A 3FYHA 5KDOA 2HUPA 1H8EA 1H8ED 1U0LA 5TVKA 2F7SA 3R7WA 2ONJA 4OJKA 3WYAA 3W8NA 1AGPA 2YWFA 5EUQB 5FL7D 4A4DA 1R0WA 4HUQA 4URYR 4D4LA 2IYLD 2YWEA 5EE5B 1AM4D 4JLVA 5KNBA 2Z4RA 1W0JA 1N5LA 2A78A 1AGRA 1D2EA 2BJVA 2NO9A 3GLHB 3K9LA 4XVRA 2QORA 5KHOC 4NMMA 3IBYA 3JZAA 1MH1A 4PAQA 4D4MA 2GKSA 2ZREA 2V7QA 3BAFA 2V7QD 3GJ5A 2H17A 2JDIA 3CIOA 4PPFA 1CR0A 3WNCA 5FPKA 3C4JA 2NG1A 3HR8A 2O8BB 1X6VA 2JJ8A 4BFTA 1W4AA 1SZPA 3I8SA 1AA9A 4RKFA 2ZS8A 4A6PA 3RRNA 4M9SA 4NHOA 4Q4HB 4Y0VA 3AVYA 1DADA 4L16A 1YR7A 2LKDA 4CGZA 2X1VA 1V5WA 2YV5A 4Q03A 4DBLC 1UKVY 2PLRA 3C5HA 1KK0A 4M1YA 3AP2A 2IUSA 3C8UA 2KBEA 5JI2E 3OEED 4G1UC 2QZ4A 2FE4A 1ZCBA 1KSFX 4YXWA 3SYKA 2XTMA 1DARA 4YXWD 2J46A 4PZLA 1IBRA 4Q7JB 4JJKA 4WZBE 4ABYA 2CK3A 1MRSA 2O0JA 3VU9B 2P5TB 4BLOA 2QM8A 4LHXA 4I81A 2GK7A 4B2IA 4AYWA 3MJHA 4AKIA 2NO6A 4BFUA 2P2LA 1JEEA 2BMEA 4LBYA 4OJQA 4L8GA 2FSIA 1OE0A 821PA 3IILA 3NEJA 3HU3A 5GJWC 1SXJB 1WDTA 4IFBA 1N0UA 4M1WA 2I4IA 2EYUA 1ZU5A 3IKJA 5AJVB 3RAPR 3D7MA 3FMIA 4KJZA 1CP2A 3EIEA 2EYQA 2QENA 2ORVA 5KSZA 1HE8B 3LLMA 2P67A 5IK2A 1II9A 1ZNXA 4PXAA 4DIEA 4QGGA 2GZDA 4LWZA 3TR5A 3QOFA 1NVVR 5AUOB 1E69A 1E1RD 2WSMA 3GJ4A 4CYMA 4S2EA 2C9OA 4PSAA 4UNRA 4F4CA 3U7EB 1VIAA 3ZVLA 1F6BA 2V54A 2Q0HA 3GLGA 2W6IA 2W6ID 3IPXA 1FP6A 2ZRCA 5AJXA 1KHTA 2MSDB 1TUIA 4EQ6A 2ZYVX 5FTKA 4E22A 1GNQA 1P60A 1C4OA 5EXTA 4HUTA 3HYRA 2ZE5A 2Z5FA 4OBEA 3M4YA 4U00A 4ZIRB 4CEIA 2IYRA 1L8QA 3D8BA 4R98A 2OZEA 3ICQB 4DT1B 1XTSA 5EXSA 5C4MA 4FWTA 1HT2E 2C9CA 1PV4A 2ZJZA 1VCIA 4D6PA 2CHQA 3EXAA 4HZUA 4JZKA 4MQBA 3THXB 2FN4A 2G0TA 1N6PA 4C2UA 3BXZA 5FH9A 4B6FA 4C2TA 2BWJA 3IEVA 2OBLA 4B33A 2AR7A 1CBUA 2CLDX 3V4FA 2IYXA 2ODBA 3IO5A 3THWB 3TQCA 3KL4A 2ZAMA 1E9AA 5JMTA 5DE3A 4MRSA 2VLIA 3FKSA 3SYLA 2E9SA 1KY3A 5EP1A 2QPAA 4ACAA 3GLHA 4IDQA 5EE9A 2C5LA 2R2AA 3H86A 4DLSA 1UEJA 4PSVA 3T06B 4AYXA 1EWRA 4UJ3A 4A36A 2ZRNA 3DM5A 2BJWA 5FBRB 2R6CA 4P4TA 2LKCA 3ZVRA 1W2HA 1NP6A 3JVUA 3U6KA 4RD0A 2WTUA 3DVLA 3SFZA 3GEEA 1CJUC 2OLKA 1WQ1R 1GL9B 4TYNA 1GKUB 2O8BA 2C03A 4I4LA 3GJXC 4XTCS 1N0WA 5C18A 1YZQA 4EIWA 2ZRDA 4NBSA 3CWQA 1YQTA 4Q4HA 2CEAA 3Q9LA 3HP1A 4WBSA 2O8CA 1OXVA 3A1SA 4C0LA 4ITRC 3SDZA 3BFKA 4ZI2A 1S8FA 2REBA 1KMHB 3LFUA 3OFND 2IT1A 2HEIA 5FPHA 3OEHA 2CBZA 3OEHD 2IEYA 4TN1A 4ASUD 3IHLA 4MRVA 4QJ5A 2GILA 1GRQA 4FCWA 4HAUA 2EQBA 1C1YA 3ZDQA 5LB4A 2EWVA 1U0HC 4EPTA 1SVKA 1YZUA 1B0UA 2E1RA 3B1VA 3Q72A 4HB0A 4NYJR 2WWYA 1PZNA 3VU9A 3QPWA 4MGZR 2BM0A 5BQ5A 4LOAA 3BJIC 4KFTA 1Q0UA 3BD9A 4ZCLA 2CVHA 2CLSA 4MKHA 1ZD1A 3ECCA 4Q9KA 1VMAA 2ZRMA 1E1QA 3NBXX 1E1QD 1SXJA 3PENA 3TBKA 2GK6A 1SXJD 2CJWB 3QXCA 3FMFA 3L82B 4YDSA 2WWGA 4AG5A 1IN6A 2VP2A 4NCKA 3U3KA 2UZ3A 5KSOA 2QI9C 2ZAOA 3AVPA 2Z0MA 3GJ0A 4H9GA 3SI7A 5AUPB 3THYB 3EIHA 2OCBA 4EDHA 4EFNA 3V4RA 4AYTA 4XWOA 4GNKA 2JATA 4WXPA 1OF1A 3TKLA 1I4LD 3PVSA 1E9RA 3BFXA 4G3XA 1FUUA 2AWOA 1E2IA 3PUVA 4JLBA 4POAA 5FBQB 3RWMB 2H16A 4AKGA 5E7IA 3QF7A 3WMFA 3FFBA 4H1VA 1G8PA 3QIAA 1W36B 1RIFA 4LBZA 2WOJA 3KKPA 3NHBA 4D0LB 1T4GA 3QKRB 4WVFA 4LV6A 4ZIRA 2GEDA 5HR5A 5HKKD 4C4PA 3L43A 4Q18A 1LFDB 1OJLA 3W6OA 4IDOA 1XZPA 2MSEB 3LVRE 4FWIB 3R9XA 1RRPA 5KTYA 2NZJA 4QGHA 3T12A 2WAYA 4DCSA 2B21A 4LJYA 2EFEB 1JI0A 4BFYA 1G7CA 2FV8A 3THXA 1YR6A 4OHZA 1N2CE 4OI0A 4MUAA 4ZI3A 3B2EA 1SVIA 4PSKA 4JLNA 4TLCA 4GZMA 2XAUA 2WMNB 3BB3A 5DHAA 1S96A 4PR0A 3THWA 2EW1A 3KJEA 121PA 1CF4A 3I4LA 1SULA 1DAHA 1DG3A 3V9PA 4QOSA 4FINA 5FUXA 2F3RA 1KNXA 1YZTA 4K81B 3A37A 2WZQA 3CZPA 4LK2A 2QMEA 1J70A 1Z28A 4KFSA 3ND8A 2JLQA 1XXHA 4HAYA 3SQXA 2RGXA 3WNDA 1J8MF 3QNUA 1GOTA 4TLEA 2C95A 5KUTA 4HDOB 3TIFA 2X2FA 3CKLA 2QMUA 4QBFA 4FW9A 1HURA 4H1UA 3M1IA 1DAEA 1Q22A 1T91A 4KU4A 2WPDA 1Z0KA 2ZYTX 2WPDD 3DKVA 1WA5A 5EXXA 3Q5DA 3N2EA 4Q9IA 3A8TA 1G4AE 2B6HA 1NN1A 1DAFA 1X8LA 2RGAA 4NDZA 4TTPA 3KQHA 2JIZA 1KMHA 1ZD9A
chains in the Genus database with same CATH superfamily
1KH2A 2EBFX 3EGDB 4HGPA 5DM1A 5CLQA 4BEWA 5TIIA 4OK5A 1BZYA 4DOMA 5CNJA 4JKIA 3HABA 2KLHA 4IQ0A 1M67A 2XE6A 5ALKA 3RYTC 1IEVA 1MZVA 4K5QA 1GT91 3VU3A 4EMUA 3B3JA 5BSMA 3AESB 5TPZA 3FGPA 4PXSA 1H8HA 5FR1A 1IHDA 2ADMA 3R41A 5DIFA 4AFNA 1EP1B 3MCVA 4GVXA 4MDYA 4LHWA 1OAOA 5DBIA 3ULKA 2G5TA 2C8VA 2QZSA 3TGPA 2R00A 1YA8A 2ZYSA 2RH9B 5I8ZA 1AQNA 2IYNA 4MB6A 1DEHA 1E5VA 2C5SA 1B00A 3LI2A 4DS3A 4MGIR 4QUBA 4Z7JA 4LXIA 4EFMA 1KP3A 2D4AA 3KPUA 2WMOB 3SR4A 4YLEA 3SKYA 3ZDEA 4F4HA 2OXCA 4NBLA 2HIGA 4E5MA 1HXHA 3U5ZB 1YKSA 2AN4A 3BDVA 3QVLA 1FNMA 1JWBB 2FZKA 4I4TB 3RUIA 4WKGA 1HPLA 5FUMA 3GJTA 5G4KA 2X13A 4NJMB 3DP9A 1FP4B 5C3UA 3RRJA 3FF4A 3RFXA 1X74A 2ZRLA 4RMGA 4ZGGA 1OLSB 1R6DA 3EF0A 3GLTA 4AQYB 1FTYA 4H0NA 3EAGA 1JH9A 3GC6A 4DV5B 3AF5A 3L9XA 3M0EA 4PHHA 4G84A 9MHTA 1JQEA 3EXG2 1RLTA 2CC2A 4LX8A 4Q5IA 1DTEA 3T3OA 2IK8A 4Y9SA 5D7NA 1QZZA 2Q7DA 4FT4A 2O52A 4I36A 4G1BA 2YR0A 1YDGA 2Z83A 2A67A 2VSQA 3BMNB 3DKPA 3H99A 5FX2A 3B1WA 2E5WA 3FB4A 4KGDA 4A73A 2HYIC 1JPVA 4ESEA 1LLUA 4BAUA 5H16A 5JDCA 2WICA 2RHWA 2GVNA 3BZWA 2WJYA 2COKA 1CUHA 2V7TA 2IEZA 2R1VB 5KDDA 3QKRA 3S28A 3A6DA 3G2QA 2DBYA 2GMWA 1FXWA 3C14C 4W7IA 1PSWA 3VKFA 1AX9A 3GIWA 4ER0A 1TRKA 1KPIA 3OA2A 2ZRJA 4D9HA 2J6CA 1DHTA 5DLDA 3UCEA 3WRYA 1Y8CA 4FYWA 5DX1A 4N5IX 3VM6A 2PZEA 4CMJA 3K4PA 1I4OA 2M1ZA 2OGSA 4TMZA 1PFWA 4YVFA 3PPWA 2C2WA 4PYOA 5E8RA 4KR9A 2W71A 5TVGA 5T6MA 3K9GA 1U81A 3K0FB 3WGYA 3OLWA 4AP6A 2AOUA 3KQSA 3IUEA 1RI4A 3AP3A 1JHYA 1T10A 1ZXXA 1JN0A 3SQNA 5FUWA 4RZHA 3O4RA 1I0LA 1BWSA 2JLSA 2NP6A 3EWSA 5FULA 1O95A 1SCQA 4MVJP 4Y0AA 1E3EA 3AF1A 5JFGA 1GVHA 3SYRA 3OFJA 2VTDA 2DCMA 2JGAA 1WPXA 1P19A 3OBIA 5ALIA 1A72A 1WHTB 3RF6A 3S2EA 3SOZA 4YMTA 1GUZA 4ER5A 4O3MA 2X0EA 4FS8A 4N5HX 4R3NA 3GGDA 3N7AA 2CYAA 3RUHA 3K92A 2O14A 4O4IB 5KYKA 3DE5X 4WKBA 4A7PA 5T4HA 4UU0A 1K4YA 1JUDA 3DE2X 2OSBA 2WUDA 2VSNA 3M33A 5HIKA 4PSCA 4R8SA 3EGXA 2P1DA 3MRXA 2HKIA 2QRJA 2Z58A 2F1RA 4MH0R 1PFQA 2H51A 4P98A 4YR7A 4FHGA 4P1ZA 4ZXFA 3DEYX 3VTFA 5CYOA 5REQB 1N1MA 1YI8A 2XYQA 3CBQA 1T3SA 4WOCA 4F7DA 1PR4A 1UJ5A 2WKQA 1IXKA 5FWYB 2FPRA 3KWLA 3ZZUA 4DWWA 3IEKA 1EUYA 4FFVA 1XR3A 1D04A 3Q3JB 4J4HA 4Y98A 4YP0A 5FAKA 3BDIA 1C2YA 4IIBA 3FYSA 5L3VA 1F8XA 1JJVA 1QWOA 1CB7A 1BNCA 3T0IA 1EXMA 2FFQA 4P3NA 3D3QA 4KO3S 5AICA 2BVNA 3PEFA 4MV7A 4DE5A 4UPEA 3F73A 4XH9B 2Z6AA 1LK5A 2V1UA 1EUQA 4GX2A 2P1ZA 4ZT6A 1SBZA 3R7WB 1ZSYA 3DZKA 4V03A 1J21A 2B30A 4YHHB 4B44A 3GFSA 1BDJA 3COZA 1GG9A 2DWPA 1TJYA 1IRIA 4NU6A 1MKYA 4S1WA 4DPMA 2BPOA 5EA2A 4MOWA 3IXMA 4PLCA 3RC7A 4YH1A 4BNXA 3GR6A 1NQWA 5E3JA 1SNYA 3EJWA 5ICEA 4N3AA 4E46A 4Q3OA 3G0CA 1GLNA 2Q3CA 1NMZA 2C59A 3VU1A 1FX0A 4EF6A 1B93A 1G98A 2SKEA 1CUIA 1D7AA 1E8NA 1FRVA 3D7SA 1TKAA 3NHKA 4UPVA 1EA5A 5ALPA 3BHNA 2P3SA 1Q0LA 1T2EA 2FMFA 1P81A 5L4NA 3KPWA 1OKKD 4Q47A 3V34A 3NDBB 1XV5A 3U7IA 4XCQA 3NR2A 2BFFA 3EWAA 3Q1LA 2JIPA 4N0EA 4KIGA 1DBSA 1JT9A 5CB6A 2AX3A 4LJ7A 3NHWA 2YXLA 3EEQA 1NQVA 5ALYA 3MWLA 1F2UA 1KJZA 2Z56A 3H9EO 4TS3A 1VPLA 2E0IA 5B4TA 3KTAB 2C3UA 4RWZA 3HQ4O 4R40A 4UTRA 1AV6A 3ON5A 4AM8A 1JKIA 1TT5B 3PL5A 1MDBA 1XI2A 2ID8A 2P6NA 1CY1A 1O87A 3ODPA 3EW7A 1J99A 3FNRA 3ONWA 4X41A 3OZXA 2OHVA 1A5AB 3C1UA 3EWIA 4QJIA 4ZZ2A 3MJTA 2HF2A 3KYJB 2WM2A 3QTBA 5FR2A 4LOHA 4C5AA 1W34A 5CCXA 1A9RA 3DR3A 2C7OA 4MB0A 3JVDA 4H4DA 3PNYA 1EG2A 3OT1A 2RE8A 1GTVA 1N77A 3QFSA 2AWNA 2Y1XA 1KMMA 2Q28A 2XKBA 3BMQB 4QU5A 4TLAA 3OESA 1QR6A 4LNHA 4V0SA 3FYTA 3AHGA 4G5QA 1N2SA 2W6NA 3ICOA 4MKFA 3L3BA 3BQ9A 1G4UR 1F5NA 4BMOB 2Z5GA 1JIVA 4JLAA 2DJ5A 3VA7A 1YB2A 4ZAGA 1YS7A 2OAEA 2P3LA 2XTJA 1QYXA 4Z51A 1GDTA 2AF4C 2HT6A 5JXJA 1POWA 1QQ5A 4DWJA 2QTGA 2OFOA 4KWIA 5TQ2B 1FOEB 4TTQA 3ADOA 2VJKA 1AA6A 4MVJI 1X86B 3HEBA 4L95C 2M6KA 4EHBA 5AM3A 2NZYA 3BRCA 5HKAA 1HNZB 1AD2A 4EHKA 3KT0A 1C0IA 4G4GA 4KO1S 4H7JA 4WZAB 1UBEA 4GGPA 4DQLA 1FU7A 2K7ZA 4ECAA 4PSDA 3NC1C 1M7HA 3I5MA 2AI1A 2CFRA 3SKVA 4GOXA 3WZ2A 3TI7A 4OBXA 1MFZA 4Q3NA 2M9MA 3M3DA 4W5HA 1QUEA 1K66A 5HF8A 3MERA 3Q3EA 2N1BA 3QTTA 2ZR8A 3DEZA 4BLSA 4DLNA 3PNSA 1RFLA 3QSYA 5K8JB 2JHFA 2NLOA 3AVOA 2GJ8A 3IP1A 2JGDA 3ZE9A 2B35A 1S2MA 3A4NA 2HF9A 3K2BA 4HDRB 2QLJA 5M7EA 4HEA1 4CR8A 1KI8A 3KBBA 1SH7A 2GJ9A 3ND7A 4N6OA 1Z0UA 1VLZA 4E4RA 2WIBA 5FL3A 1YFLA 1U11A 3PK0A 1N8KA 3S5UA 3OTQA 1C4XA 1S2OA 4JCCA 4A6DA 4CFZA 2QG6A 2QVGA 3O91A 1ZL2A 3QVVA 1XHEA 4FCVA 3LOPA 4QDOA 3V8QA 4KI7A 1M7GA 1RLUA 3I1JA 5LLDA 1A9XA 1UMCA 4PHCA 3HXPA 4FFRA 1X9IA 3ZKAA 4AL4A 5ARBA 4REQB 4XVHA 2ORYA 2YYYA 3FTDA 5KBYA 4MMXB 3FSGA 3H2SA 5DI3B 5DB4A 2GS9A 4ZT3A 2DWOA 2VPZA 3FZNA 4DVGA 3WNZA 4J1QA 5IJWA 1KPHA 1E4VA 2ZSEA 3CRMA 3USZA 3PCRB 2ZRPA 4GFDA 4R1TA 4ZQFA 4CDNA 4CI0B 1GR1A 1UEXC 2BSQA 1QFXA 4YWHA 4C87A 3SM9A 2XJ9A 4PCAA 3ZLVA 5HIMA 2YWJA 3H3JA 5TMPA 1SWWA 1PGOA 1XMOB 4GKVA 2YVUA 3M6XA 4OHFA 3ABSB 3TPCA 1OBOA 3U3RA 2IZZA 2WZCA 3U48A 2WYWA 2X8LA 2Z5VA 5FL7A 3ZIDA 4EZIA 2X4GA 5I9IA 2NUAA 3ZX4A 3L01A 1NXSA 5C8YF 3CZAA 4AJNA 4QYIA 4NNJA 4WKNA 3EASA 1UKZA 3OWXA 5CVUA 4YUXA 1YE3A 3FI0A 3JQAB 3OJXA 4OREX 4WGFA 4JD5A 1YL6A 2VXOA 2ZULA 4XKJA 4GUAA 5I7AA 3I04A 4GMFA 5J1TB 2OXTA 5BT9A 3OO0A 1FUYB 5K4AA 3VHLB 5AKYA 5DN6D 1IN4A 2VCEA 3GEGA 5KYUA 5JO9A 2NMVA 3OT5A 4QASA 3ZY3A 4BNYA 2C9DA 4MYRA 5AI8A 3N86A 1KK3A 1KEVA 4BJ6A 5JAMA 3W1EA 4B6OA 3ROKA 4LNUA 3PT5A 2QSUA 3SQOA 1MOZA 3IOCA 4KHZA 4DNOA 3A32A 3I4CA 2GZSA 4M38A 4PX5A 5IUJC 4KRFA 1SXJE 3AFIA 3M9LA 2XT0A 2NTJA 3TLMA 2G9NA 1N0VC 3P20A 4NCXA 1W5SA 2I2WA 3G88A 4UVGA 3S40A 4BIIA 1Q3TA 3V9AA 2IXDA 1WXWA 5TC4A 4EY6A 3A1VA 3OEEA 4MVJE 3LBIA 3E0QA 2D0OB 5DHSA 3RYFB 3G5TA 5A06A 3PI7A 4Y18A 1MQ9A 2VJCA 1XPRA 5CYFA 2F55A 4Q4JB 2XXAB 1BW9A 1C3XA 2CEKA 1GFIA 1OXXK 2IY9A 3PQ6A 3NDJA 1RU3A 2VK4A 5H80A 3UYLA 4CLOB 4H59A 1IHPA 2XW6A 1TDJA 4TMVA 1ZEJA 1BKDR 5FA6A 5DLPA 3ONNA 1N9GA 4H6WA 1O5TA 2IZ6A 1XYGA 4Q3AA 3V2IA 4MPPA 5HE8A 2ZJ2A 2AUTA 2BEVB 2GK3A 3BS4A 2BSAA 1BOFA 2GYWA 4WV3A 5C7IO 3K31A 4HVLA 1XGKA 5K3OA 1F3OA 1KF0A 1LLFA 4UPDA 5T3YA 2HQBA 1JEQA 3IJPA 3ZCSA 5CRIA 2BD0A 2ZI3A 1X80B 4G1FA 2CL0X 1V6AA 2YWBA 4KMOA 5I9TA 1EFAA 2WAOA 1A5ZA 3F1KA 1JAYA 3G0DA 4RCVA 1JZQA 2HK9A 2DFKB 2NU7B 3DHYA 3TAUA 4DCUA 3AVUA 3L0DA 4O4LA 4NMXB 3KSBC 4GVLA 2HZBA 3I92A 5K3FB 4NE9A 1XZIA 2E5LB 4MTLA 4OVKA 4BBPA 3OE4A 1Q6YA 3I1IA 4KQMA 1TECE 3KZKA 4ZOLA 2A0WA 2G4CA 2JFVA 2WNIA 4O63O 4LYEA 1RS0A 2H4FA 1OCEA 2C96A 4IFIA 3RTDA 1BMDA 3V8BA 2LIPA 3IVGA 4RL4A 4RJLA 4JGGA 3GCXA 4TQUS 1KEPA 3M6IA 3QBEA 5JMOA 3N0RA 1E4EB 5KNLA 4INJA 3P0FA 3ER6A 5CA1A 1A2KC 3E9CA 3I9NA 4H6VA 2CHGA 5FNZA 3P2JA 1VRCA 1M1NA 4XB2A 3FIUA 5C31A 3TLYA 3EF1A 3BJRA 1SK9A 3HCOA 3ORFA 4ZMRA 3MQ4A 1IDOA 4MIOA 4N3GA 1YB5A 3LDGA 4CTJA 2Z4SA 2CGEA 1K3FA 1YI1A 1W4ZA 2OCKA 2Z8YM 3ZGLA 4V02A 2GLUA 1H9AA 3E22B 3W5HA 2DPHA 5FV4A 1ISGA 1IEWA 4IDDA 2WAXA 4QEDA 1U6IA 2ACKA 2IEGA 2WJVA 4FZJA 5SYAA 1U7UA 3I6ZA 5AJHA 2G1AA 3LBNA 1GNLA 2A1UB 3LBAA 4EEXA 3Q6IA 1E2UA 5FOSA 2GNOA 1UXJA 2WABA 1HDYA 1XMVA 1CJMA 1DLJA 2WIKA 3G6WA 1FIUA 3QNMA 3IUSA 5BW8A 4EFKA 3B7PA 5ECGC 4JBGA 4QECA 5DPMA 1ZUWA 4UW9A 2YVQA 4NKRA 1GITA 3HGMA 4BEBA 5JRDS 4YO8A 1YB7A 3X2FA 1KMCA 1NBWB 2WJJA 3NANA 1RAHA 4MQEA 2C82A 4TVSA 2WWXA 2VP5A 4PCLA 3VU0A 3SIWA 5JDIC 4YQEA 1OTYA 2X77A 3ZWOA 4A91A 3DW1X 2IOHA 1MAWA 4TRMA 3KJGA 2IGBA 3L6BA 4XUCA 1NW8A 1XQ6A 3BWEA 3D81A 3UWKA 2KLBA 2NV0A 5BRNA 4LZOA 4ESVA 2C1ZA 2JLRA 3NIBA 5CJPA 1Q1GA 4DTCA 3MFYA 1J06A 1O7JA 4L5JA 2X2EA 3NMUF 4M98A 4OHRA 4QGFA 1XPJA 4A15A 2WWRA 3CF2A 1MEOA 4FLEA 1T2NA 1JU4A 3S7ZA 3W7BA 3KSDO 3K15A 5JG7A 5BRJA 1T5IA 4X62B 5AHRA 4UM9D 5JH7B 3PSAA 3KQOA 4YAEA 3LPAA 5AI0A 3RFVA 2IPMA 1YULA 4QNMA 1PUJA 1ZK0A 4R3WA 1G63A 3PXAA 1FXUA 4EKYA 1LC0A 3BB4A 4DLUA 4Q9JA 2OQRA 3E2MA 5EIOA 1Z36A 4KQEA 1N0HA 4U3JA 2Z2XA 4PVCA 1S89A 5AQ1A 1M5TA 4BLPA 1KBQA 1N2OA 1CDEA 4XPZA 1SOWA 3PNKA 4EZBA 5IZCC 2UYCA 2J32A 3NB0A 4L0QA 3QKTA 4B3TB 4N7RA 2ZYWX 4CEHB 1TM5E 5J58A 1WUKS 1Y9EA 2I33A 1PYDA 5EHZA 4EYKA 1EVEA 1TYBE 2JJ1D 2QTNA 3GPIA 2ZSBA 1JTFA 2IUEA 4EY4A 3GVPA 2NV6A 3FPEA 5KIAA 4HDNB 4F8EA 2DUUA 3IDAA 4QJ4A 3T5GA 3VVMA 1VDMA 1LPPA 3GUZA 4JROA 3JS5A 1EHCA 3QBTA 1D6NA 1Q15A 4PYKA 2JCSA 4B6GA 4UZEA 3ZG6A 3JCZA 2FOLA 1C1DB 3F5FA 3ROGA 1XZQA 4UAJA 2QP4A 1A04A 4M0MA 1GZUA 1TLLA 2WR8A 4IJ6A 4O4JF 4A1FA 2WJGA 3CNLA 2Q3EA 3NO4A 5K0CA 1UBMS 1G38A 3AF0A 1O94A 3HKDA 4C78A 4W6QA 4HDKA 3KWFA 3F7NA 4Y6PA 3VZQA 1SKUA 5GM1A 3FCAA 3TZEA 1PFGA 1P29A 2YXBA 3NYIA 1B15A 2H7VA 4L6AA 1GKKA 4WOKA 2JLZA 3H5WA 5K20A 4OXQA 3P2MA 2RHJA 4BZXA 2G5PA 2WB4A 4EJMA 5BMVB 1KXZA 3B1YA 5F21A 4UTNA 1U9JA 1YS1X 2JFXA 5FWDA 5I47A 1QBKC 1N3BA 1X7HA 3VSAA 5TQ0A 4EMBA 2KBFA 4BLRA 4IHJA 1X8JA 5D3ZA 4RTLA 3I12A 3V1UA 5LDDC 5HFNA 4X1OA 1K8XB 4MCHA 3U7QA 2WAAA 2C57A 2FW1A 4HVTA 2AJ8A 2I6UA 4K9PA 5F52A 2H4HA 3AEQA 3CO0S 2REOA 4MVCA 4KE6A 4QTTB 5HQ3B 8ABPA 4KPYA 3DWEX 3L04A 4PLFA 2R86A 4FJ0A 4W9NC 1MAAA 1E0KA 1A4XA 3FWPA 5ALQA 1NNEA 4GLFA 2I91A 2Z4TA 1XJCA 2NSDA 5FBHA 1IVSA 3CLUD 4YEDA 1O5IA 2ZYHA 2G7ZA 2HMWA 4ITVA 3ZCVA 5MFPA 4KDEA 2OXFA 4OUDA 1DIOB 1L7PA 3A7EA 3CLHA 4C4YA 1ENOA 4HDAA 2OORA 5LU8A 2YZGA 1K63A 3GJSA 1THTA 1C80A 2QN3A 4TLDA 3OIVA 2C00A 3NVKI 1AH2A 3ZV7A 5U1PA 4B7ZA 4AY5A 2PV7A 5MN5A 3TH5A 1QMPA 2B25A 4C04A 3MWFA 4PYMA 4UOEA 2FW9A 4PC7A 2OLJA 1Y1TA 1M1XB 2FPSA 2W2LD 1PNRA 3GPCA 1N3LA 3LUJA 5LMUB 4FBLA 4QGBA 4IOLA 5D6NA 2A4KA 1KTIA 5EZ5A 1LDEA 1HT1E 2IDJA 1LW6E 2VDWA 1Y4SA 3CXUA 1VKRA 2NQ8A 2OFXA 4EFLA 1YOBA 4IIXA 1YZHA 5K9ZA 4OFBA 2HNKA 2JVKA 4Q7MB 3U4HA 3KKKA 5C5DA 1N4DA 1J9ZA 1T5TA 3K1ZA 2O07A 2YQ4A 2ZS9A 3E4DA 2RJNA 4NH0A 4QU0A 2VT2A 1QAOA 2BP7A 2GD1O 1SJ9A 2ZI4A 2ZT8A 4UU1A 1KWKA 5LD2B 4KPUB 2PZFA 5JRZA 2K6GA 2DKFA 3JATB 5MFZA 2DHRA 3QWBA 1YC5A 2QAGB 3BGWA 4DUYB 1GFSA 1HO3A 4IKOA 3PR2B 2GF2A 2B8NA 4P3OA 1SXJC 3MLEA 4HBZA 1NIJA 5EG5A 2QD1A 5DWQA 3DBOB 4MUXA 1WJGA 5JISA 5MHTA 1BTOA 2P6OA 3ZY4A 1P1RA 2J9XB 2H07A 4HDMB 1AUXA 1HQDA 2V8BA 521PA 4HWRA 4TL9A 4QBKA 2WSSA 1EE1A 2WTEA 3HN6A 3RVLA 5JH7F 1OH5A 4FFMA 1CS0A 2G80A 2I2CA 2ZWMA 1UH5A 1Q5PA 1ECJA 3HMKA 3AY7A 2CT8A 1FMTA 1SB8A 4G4SP 3J7AC 4OD0A 4ROTA 1S9HA 1JYFA 2VA8A 1I3CA 4RKQA 2AEMA 3TLBA 4C0WA 5IC4A 3E35A 1Y63A 3RG8A 1QHHA 5KTTA 1ISHA 1SA0A 3HJNA 2WM3A 3GOHA 1LS6A 2OGZA 4P3YA 4LVNA 4WK0B 1TC2A 2ZJFA 2VCHA 2CDAA 3AB7A 4M0EA 1XXLA 3AM4A 3QMWA 2HMTA 4RULA 2ENWA 1VDZA 5GONA 1SBHA 1T2DA 1VXRA 2IP2A 3AFNA 4BNVA 4Z9AA 4BZQA 4TMFA 4YP9A 2V5UA 3V7FA 4E03A 4WLFA 1J5PA 2BGKA 3UWPA 3F5MA 1XZFA 3ZGNA 5EXEA 5EP4A 1NQXA 4B8ZA 2P0EA 3TIXB 3AIOA 1T0JB 2H1FA 4O5OA 2ISQA 1XAJA 2JFUA 3AR7A 3FPCA 5FQNA 2Z6UA 1VCNA 4YRAA 1M54A 3Q0TA 1CUSA 3KV3O 1DEKA 1ZVJA 4AUKA 3FPAA 3M49A 1KVQA 2Z2ZA 2FNAA 2GPNA 3U37A 1CZKA 5KPDA 3WBJA 4FHFA 1BOOA 3BB1A 3FLBA 3V6MA 4IDNA 4URHA 3FYDA 1NF9A 3VR2A 3R9WA 5NLLA 3OUZA 4GD3Q 3DBLA 2PYZA 3LUKA 1J00A 1KI2A 1PNQA 2BMWA 2OSVA 4HSGA 2QGFA 1RAEA 3AINA 2Q8PA 4YJGB 4N6GA 1F1BA 3ROEA 4YUYA 4G65A 2O8DB 2OTCA 5EZQA 1AOXA 2NV2B 3D4NA 3PDCA 3WIOA 3IX7A 3LOUA 3TN7A 1L4YA 3D1LA 3PJFA 4Y2RA 1WR8A 5E1MA 1G8AA 3BCUA 3ED5A 3FR8A 3K05A 4Q9KA 3G5MA 4D97A 2HTEA 2NZWA 2VRCD 2Y05A 2V6FA 3WKBA 1UM8A 4IDHA 4XDHA 3TXYA 4UHEA 4GDFA 1K88A 4R1OA 1I3OA 2FK7A 2VWGA 4H77A 2VKTA 2ZIWB 2FWIA 3OQ6A 3QE4A 5JTTA 4D9CA 3NBAA 3H83A 4Q6BA 3S1AA 3KS9A 1G6HA 2D1TA 1Y5LA 3NTUA 1U80A 2ZBQA 4FVTA 4EG1A 1NVDA 5DNYB 1XP5A 1X7GA 3GN1A 3JQ9A 2ZBRA 3B3QA 1EB8A 4Z54A 3AVTA 1AN0A 4TTAA 1FJXA 3ILXA 3KDPA 4B0OA 1GD1O 4YRCA 3RJ9A 1R4AA 1VKOA 1OA1A 3WTCA 1BCRB 3IO3A 5K3EA 4OQNA 3VPAA 2QTWB 5HJ2A 2FWRA 3GUUA 1YJBA 1KO4A 4DXHA 5KYWB 2MMGA 1NYQA 1YJ5A 2NZXA 4MK4A 1Z15A 3G7NA 1QLWA 2XJ4A 1P0QA 1WTCA 6CHYA 1QFYA 2LCFA 4L74A 3H1TA 2H2WA 3SU8A 5LUAA 4ENRA 1GM5A 2W6PA 4AN0A 4FHZA 4MB2A 1OZAA 1M66A 2ZB8A 1UUFA 1PYOA 1ZD8A 1TM1E 1GDDA 2D2FA 5I48A 2AHOA 5JMPA 5AKHA 5J1SB 1YACA 1OGYA 2BKAA 3SK0A 1MC8A 1RQPA 1UF9A 3WRXC 3HRIA 1BS1A 1SFRA 4GOJA 4ZVOA 4NG5A 4E2ZA 3K70D 1WG8A 1JQDA 2J08A 2O7NA 3X2EA 621PA 2MWMA 1ZGZA 3Q85A 4YQFA 2P9TA 4D42A 1RJFA 1YFZA 3TNJA 1VP3A 1XEXA 4ER7A 1ZBDA 3BERA 3FY4A 1PX2A 1RQXA 5AI9A 3WLEA 3K0CA 1JFFB 1SBTA 2JGKA 3D3JA 3KLBA 3X2SA 3RADC 1ISPA 3VX4A 1THGA 1T8SA 3JY6A 1XP8A 3LT4A 4WNIA 1WMAA 5EHQA 2FGJA 1M34E 2WLSA 3TQTA 2XTNA 3U3OA 3H2JA 3IPAA 4IYJA 4YJHB 4KODA 3CRW1 5AJUA 4UARA 4GT1A 4AX8A 4C7BA 4RHTA 4D2IA 3R76A 1EXWA 4TRNA 1WNTA 4U2KA 1S2GA 2BGUA 2VS1A 2BFWA 3EVAA 1BIFA 3MWJA 3PNVA 4LVOA 1NVXQ 1ZMXA 4E4TA 2GAFA 5BVGA 1EFRD 1HFEL 4L8LA 3E1KA 4IOJA 2VN8A 4KRGA 4Q24A 4QBGB 1SQ5A 4AUNA 4BLTA 1FX1A 3SIXA 1Z0FA 2XOKA 4LVUA 5CGZA 4CLEA 1GGKA 1OIXA 3Q87B 2SBTA 1L4LA 1O6ZA 3UATA 5C8XA 1MIOA 2NU8B 1XU9A 2FLWA 4DA7A 1YB6A 2UVQA 2ORED 3W2IA 1SUSA 5ILQA 3YASA 3GUVA 1SIOA 2A1TS 1XQXA 1T1GA 1VRVA 2NSLA 3TLKA 3S2GA 1QTNA 1KO5A 1XTQA 3D5EA 3ESAA 5B55A 3LRPA 1DXOA 1VPEA 2XKAA 4IIYA 2AEFA 5SZKB 1W2GA 1WOYA 1XCJA 4R9SA 4B75A 5LQRA 4CL0A 1W36C 2W83A 2EP8A 2W4IA 3NHLA 2WHPB 2BEUB 3D3EA 4JB8A 1IMOA 1Z83A 4KAAA 1L5HA 3HN2A 1Q2UA 3FKQA 2DKOA 1RYNA 4M37A 2ZOSA 4MYCA 4PRLA 5K8LA 2XMCA 5IXYA 2W2NA 3CGWA 3HNPA 2YJ5A 3VR0A 5BNIA 2ZW9A 3QVGA 3RS3A 1N8TA 2V6JA 3EZXA 5KSYA 1YQEA 1QH1A 1SQSA 4OQPA 4A2CA 4BFWA 1XHLA 5KU7A 4NMHA 4AZ3B 5EGSA 3JASB 1HFWA 4FEEA 3WBKA 3TSOA 5FJIA 4M1ZA 3G2KA 4POOA 4KH0A 3GRRA 5H70A 2N1MA 2FCRA 4IO1A 2J7KA 1IUNA 3ABZA 4WECA 2V74B 5F3WB 4DV1B 2F67A 2FUCA 4PQRA 4RAQA 2O54A 4RVGA 3GMSA 3CNHA 4MLPA 5TEVA 3E18A 3W9SA 3ETCA 4AG3A 1YF3A 1OZ0A 5CDFA 1JEJA 3KUUA 1QV7A 2VPWA 3ADKA 3MD9A 3PGXA 3PITA 4A03A 5HPYB 4BNWA 4D4GA 4Z1MA 3CN7A 4MS4B 5L6MB 4OXKA 3Q8LA 5JEDA 4NJOA 3NH6A 5BVHB 3ELWA 1P18A 1FYVA 2UVPA 4Q39A 2KW5A 1OBHA 1HDOA 2VJDA 3EXIA 1DKPA 1WCV1 3O8DA 4MARA 5I9SA 1YRQA 2AVDA 3SBEA 4GZLA 5G53C 3UJDA 1JQKA 2I4OA 2X19A 3ISVA 3OZUA 2HPVA 4LYYA 1XTKA 3FLEA 3UEOA 4UTVA 4TV8A 4F96A 5CVTA 4H4EA 3AM1A 2Q5CA 3NLLA 4L22A 3S0JA 1SOUA 5FI0B 4B40A 2DZDA 4I8IA 1ZD2P 4Q3KA 1UBUS 3K32A 3DEAA 2O2IA 3C0KA 5LBIA 1EUCB 2HM7A 4IGFA 2GXSA 4CM8B 4OLHA 1YBVA 4UUQA 4EHHA 1UMDB 1CE8A 1P6QA 2HA0A 3P0JA 1G5QA 3QKSA 4C21A 4EBFA 1ODCA 3EPHA 2XUJA 5B58T 1J2UA 4PCVA 3W8RA 1HKUA 2V4UA 1NVEA 2R87A 3VU8A 4ZHQB 4JV5B 2CNNA 3LECA 1VJRA 3NBZC 2QT0A 4Y2UA 3RBAA 2BGRA 3P4XA 3TSZA 1RXIA 4CCWA 4F1KA 2XADA 1IL0A 2XHEA 4HLDA 1FYWA 4JLKA 1KPGA 3BSSA 4JQZA 4XB6B 2H2DA 4JBLA 5KYVA 4P34A 4QZVA 3FLAA 1NVMB 4QGSA 2RH4A 1XJ5A 3GH1A 3EBLA 3NATA 3VHRA 2NTVA 5BV7A 1WCIA 1V2GA 4V0QA 4CIXA 4ND1A 5DNUA 3DF9A 1IC6A 4LWOA 1KE2A 1S3GA 2V1XA 3QLTA 1B6SA 2QLNA 4HDCA 1Z7GA 5AO9A 4EZEA 4KQGA 1YDHA 1RAAA 3Q3HA 3PNMA 2JIQA 1NURA 4RHCA 1H1DA 1KJ8A 4YJKA 4IEIA 1JYEA 2OBNA 3QVWA 5CLLA 4HNAA 2J4FA 3H5RA 3FVRA 1EDZA 1WF6A 1G7RA 1NUSA 2ZI6A 3EZ6A 3NBYC 3T9CA 3BDAA 1J0EA 4Y1RB 1IY2A 3WK5A 4DLTA 1H4SA 2JKZA 5BNFA 2QRUA 1JLMA 1C8LA 4KTTE 2FPMA 4RXUA 1TZ2A 3MJDA 5JYBA 3K0KA 3PLAE 4NCNA 1JLRA 5AHXA 3D4OA 4OATA 1CLUA 1P5RA 2QTCA 2PRYA 4UTZA 4A2WA 4DA6A 4E94A 1NJ5A 3E7WA 5ITZB 3LTNC 1ISRA 4J2HA 1E1LA 3ORRA 5BSKA 2Q1SA 3GDOA 2AF3C 3A4MA 1HQCA 5CXQA 5AT1A 4RTRA 4GLLA 1CQPA 2HR1A 2XBMA 4AO7A 4NJEB 4I50A 4GMDA 1I2BA 3H87A 4Y2TA 2AR0A 3VR6A 1H0HA 3I52A 4TYYA 1K3TA 4NS1A 4I3HA 3IT3A 2A84A 3V46A 2H63A 1WQ3A 1MABB 5TPWB 3GHHA 4BMDA 4QIHA 4WINA 1T24A 5LMZA 2GHRA 4C0BA 1JTEA 5A6SB 4F97A 1E3JA 4Y6OA 4C14A 2QW8A 2EP7A 2FPOA 1Z3CA 2Y0CA 3L7AA 1IY9A 1PBTA 1H94A 1Z4OA 3TM5A 3RVMA 1SWVA 1N3YA 2GXQA 2VHYA 2YCLA 3L8MA 3TTXA 1IVNA 3IDFA 4A2QA 3T5DA 4EHLA 4S1OA 2A9OA 4P7GA 4JY7A 3CSDA 3LPCA 3WXBA 4C0KA 3G1UA 1V9LA 4UATA 3ZTWA 2FJUA 3IVMA 2A5YB 3LPLA 4F8YA 2LW7A 3OVMA 4ZICA 1WIWA 1XL1A 3CVJA 5DNEA 4WQMA 1E2DA 3PGKA 2V7EA 1PNOA 2R6ZA 3I1FA 4G5GA 1SQ0A 4X60A 4D80A 1G3UA 2VH1A 3KZVA 2F43B 3DD1A 1X1QA 2RHMA 4G24A 1ZOPA 2AK3A 4L4YA 5TARA 4OI1A 3WRWA 3FZGA 2EAUA 4L5CA 3QLJA 4GX0A 3R0XA 4IS2A 2HRDA 4IZHA 3SICE 2A3RA 4JYCA 4QRHA 3LX6A 4W7HA 1OREA 2NVWA 1KQPA 1C8VB 2G6BA 2GCNA 2H2FA 4RZUA 3IUQA 4D4IA 3FTEA 1AZLA 2PO7A 1Z2CA 4Y9DA 5BWNA 4KR3A 4L5IA 4FLMA 4P80A 5IX8A 5KWVA 3H42B 4K1XA 4ALNA 4E12A 4ZT7A 4UMVA 4V1CA 1WB6A 3WL3A 3N6RA 1QCYA 1REQA 3O84A 3KZMA 4KLZA 4MWDA 1A76A 4YWJA 3DHVA 2QQ5A 4PTZA 2WVAA 1DP4A 4ABTA 2HJRA 2PJRA 2IH2A 2BDEA 1GAJA 3KFXA 4FIDA 1DAPA 2Z04A 4X7MA 2ZP1A 3T0FA 3TOVA 4KO4S 4FILA 1T2FA 2ATVA 1KQOA 5CEEA 3AVXA 1T0HB 3JV7A 3TS1A 2IW3A 1J42A 4BQOA 5LQKA 3G3EA 2XIQA 2C2OA 5AW4A 5E38A 2HGZA 2EERA 2HJWA 2B7LA 2Q3MA 2FTKE 4Q9DA 4RE6A 2ZIXA 3Q5EA 1OIWA 3PC3A 4GE0A 5CIQA 4HTFA 5B2FA 1U65A 3B3AA 1UMBB 4C88A 1H4QA 1OILA 4E1BA 2I6SA 1M2KA 4WOPA 1EZZA 2XUDA 4R8KA 4KGXA 4X20A 3LYAA 1VLMA 2LWIA 3CEJA 5E4TA 4BB5A 3FOFC 1I2CA 2YHAA 4G1CA 3SNHA 4GXRA 4HQOA 4P83A 3DOHA 1DKMA 3S4YA 4QOEA 2J87A 1CQJB 4P86A 2F1HA 2VK1A 4LPSA 5DDIP 1OYVA 1A9SA 1RZUA 1JG3A 1SCUB 2I65A 2IXGA 2RGGA 2HIAA 3CWZA 3SHWA 3HCWA 4YJ2F 4EVIA 1CJKC 2QRKA 3I76A 1GUDA 5FEUA 2QUBA 3V3KA 1Q74A 2D3TA 4LJ4A 2X1HA 3EOBI 4HNSA 4KE8A 5KTNA 1F0PA 3ACBA 3O94A 3IODA 4OO3A 1ZR2A 4RJ2A 1M8JA 2OYSA 3E9ZA 3IXLA 3L18A 3MUOA 5DWVA 4FCTA 1JH8A 2G76A 4PYNA 2ZU0C 1T5DX 2VUSA 3O4VA 1DC4A 3TOXA 4EWLA 2HYDA 3I2KA 4X45A 1YHZA 4E09A 1BYUA 1DG1G 2EL7A 5FXMA 3UKDA 3F46A 1F5SA 4JZYA 3JVVA 3Q9NA 4MR8B 4CF7A 3MJSA 4LFCB 2CWDA 3S8EA 2O2HA 2J5QA 3O4GA 4GQIA 5IAAA 3P32A 4G4JA 1E9SA 4CZ2A 2AE1A 1XXHE 2LNDA 3KVYA 2P9CA 4ERXA 4IVNA 4TT3D 5KX5A 2E87A 3WZLA 3OLXA 1SD2A 1LLCA 3D54D 4LSZA 3U4GA 3GYBA 1GYRA 1JQJC 4JU8A 4NCAA 4S1PA 1PFKA 1BE6A 2B1GA 4BRZA 2GHIA 1XTJA 4EG6A 2CVOA 3WYBA 3ANMA 2DH6A 3AILA 1LFAA 3DA8A 4WCDA 5HIAA 4DDTA 1JA1A 1V4VA 2BRUC 4ECEA 3AVWA 1DJPA 4OXNA 4EL0A 1EHIA 1N8NA 3BXHA 3PFCA 4HQNA 4V0MA 4U9UA 2A9QA 1CUWA 4QOGA 4BQNA 3EOZA 1FQJA 4I55A 3MQFA 4YJ3A 3QI7A 4C7JA 1VHWA 3PJDA 4CW7A 4WXEA 4QPZA 1OLXB 3R5JA 1W0KA 2IOQA 5JSZB 4MI3A 4EKGA 4JLDA 4A0FA 2QEQA 4DY6A 1M2OA 2RGWA 1O97D 1XN1A 3M1AA 1KI1A 1YGYA 1ESNA 4MS3A 4UBMA 5GAJA 3O9VA 2QLMA 4XARA 2OA0A 3ZE2B 5EYPB 3D8UA 3TLJA 3ZIUA 3GBVA 2YJGA 3OU6A 1KYWA 5DBEX 3QUAA 1LBIA 1O58A 2G40A 2CLIB 1BE0A 3N28A 1AKMA 1GZVA 2H59A 2VDLB 3U4IA 4QO8A 3P26A 4EI8A 4BVAA 1J5EB 4B76A