2RGDA

Crystal structure of h-rasq61l-gppnhp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGLEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Transformation Efficiency of RasQ61 Mutants Linked to Structural Features of the Switch Regions in the Presence of Raf.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rgdA00
1NVVQ 3FB4A 3FMOB 5LPNA 3ZD6A 5GJWC 3K70D 3NEJA 1N6OA 5G3YA 1K5GA 1IXRC 3FFAA 3PXGA 4PPGA 3UK6A 2EQBA 1R5BA 1XMJA 1MV5A 5J47A 1TF5A 3E70C 4DCSA 3KQNA 3AVWA 3J81k 1S1MA 3PUWA 4BASA 1R0WA 3VR2A 2QA5A 1DOAA 4ZCLA 2FZLA 1UEIA 2BKUA 3B1YA 4ZIRA 5DE3A 3U7FB 1KGDA 5FBQB 5KDLA 2VIIA 3PEUA 1X8LA 4HSEA 3OAAA 3I72A 2RB4A 2ZI7A 3NH6A 3WMGA 5C2JB 1NP6A 5EXTA 1XX6A 2JLYA 4G3XA 1Z0IA 3EC2A 4YONB 3I3SR 3L43A 3WBKA 2PH1A 2XITA 2DFNA 1LF0A 4ZCMA 2BMJA 1CJMA 1JBKA 1E2GA 4YDSA 5C4GB 1IBRA 1R6BX 2O0JA 2ZI6A 4B47A 2J41A 2KI5A 3THOA 4D0GA 3C41J 4US1R 4TL6A 1JR3E 4RKEA 4RD3A 1JJVA 1GAJA 2ZR0A 5CM9C 5FR2A 1UKZA 1G3MA 3SOPA 2WJJA 4E07A 1T5LA 3VKWA 3UIEA 2W6ID 4N0DA 3BC1A 1U2RA 4NHOA 4HZUA 1XTQA 2I1VB 2PT5A 2IUUA 4CW7A 4D80A 5G40A 3GLIE 1VYVA 4RZUA 1NSFA 2OCAA 2P2LA 1YR8A 3MFYA 5F2EA 2PZFA 4GP7A 3EIHA 3QJYA 3VR3A 2JLZA 1PLJA 1Z0DA 5HZHA 4TLAA 2FNAA 1G20E 4M9ZA 2IYWA 3WXMA 3EZFA 3DOEA 4POAA 4TSFD 4QHSA 2NZJA 2R6AA 1GIAA 4A0HA 3MWKA 4AYTA 4DEYA 4O3MA 3QE0A 4A2WA 3L0PA 2ZM5A 3THYB 4DZZA 3B8HA 4A92A 4CT4B 2ZYWX 1KK2A 1I4LD 5KO2A 4LC0A 4JIMA 2NO9A 4TL9A 2QP9X 3HYTA 1VG9B 4XTRA 1KYIA 2IT1A 2CHGA 2VYFA 4PO1A 2IWHA 3IPXA 2IX3A 3EG5A 3ND9A 3S1AB 3W34A 3GJ0A 3TQFA 5CYOA 2EU8A 4KBGA 1KAGA 5DN6A 1J99A 1OYWA 1W0KD 1WDTA 1KJYA 2IL1A 4QBIA 2CNWD 2ZI3A 2G9NA 4D0NA 5KSOA 4S35A 3TNFA 1ZC3A 1XEFA 1UKEA 2C77A 2P5SA 2VLIA 3OEHA 3F0TA 2PMDA 2F55A 5AUQA 1EX6A 4C0HA 2O8BB 1T3HA 2YVUA 1I4TD 4G5RA 1A1VA 1DBSA 2OCPA 1XDBA 2FN4A 4Q1AA 4OK6A 4JT4A 4YMWA 1OSNA 2C5LA 1KI4A 2NTYC 4URUR 3TJZA 5KU1A 3CR7A 2GNOA 1VTKA 2PBRA 3B6EA 2BBWA 2P0EA 3DM9B 4C3ZA 1JPNA 1SXJD 2UKDA 2ZS9A 4EPYA 1XU4A 3I92A 4FMDF 1F2TB 1P75A 1XRJA 4Q4AB 1WP9A 2O52A 4C0SA 2QE7A 3LQRA 4BLPA 5EE3A 4H9GA 3SQWA 4HDCA 4DSNA 2WSSD 1A82A 4O2LA 1KY2A 2EFGA 1KO5A 3EA5A 1NJGA 3MWLA 3LO5A 4HDOB 1E0SA 1E2NA 2X2FA 3QOFA 4M1SA 2WOJA 1X8KA 5IK2D 3FYHA 4G5QA 2BCJQ 3L8YA 1P73A 2ECKA 1E1QA 1US8A 3ZZTA 5DHAA 4FXPA 3PV0A 1YE8A 3A8TA 1UF9A 2ZS8A 2VHQA 2Q3MA 4XD7A 2OHFA 2F43B 3PUYA 4EUNA 2OCBA 2QT0A 5EP3A 4IEIA 1Z6GA 4QG7A 4EPVA 4RSGA 1W1WA 5EZ6B 1RIFA 1SVLA 1GITA 4DLTA 3VKGA 2GEDA 2OM2A 2QAGC 2WWWA 4PZLA 1WBDA 3U7EB 5CDFA 1GNPA 2GETA 3MWJA 2D74A 5KYKA 4B34A 3PENA 1TF7A 2QAGA 1HY3A 1BYUA 1QHHB 2O8EA 3U3JA 5HPYB 1EXMA 2DYKA 2GESA 1RRPA 1JB1A 1KSJA 5KUTA 3B7GA 1NSTA 2B92A 2NPIA 1LW7A 1NN3A 2VTKA 5LB4A 2NQ2C 5JLJA 2FG5A 1U8AA 4MRSA 1ZD8A 2IXEA 3RWOA 3SC3A 2V8OA 4JS0A 5FTMA 3PUZA 2ZI4A 1OJLA 4CT5A 1G18A 3KB2A 3FFBA 5EUQB 3UANA 4KLNA 3SZRA 3WNCA 2VP2A 4FW9A 4V0MA 4PAMA 2HUPA 2GEUA 421PA 1HYQA 3KUDA 3GCGA 1N5LA 4DSOA 1OFHA 4DB2A 1YKSA 2D62A 4V0KA 3FWYA 1AA9A 4HEJA 1N2CE 2EWVA 3X1WA 1GRQA 3MJRA 5K8UA 4HAUA 1OFUX 2CCGA 1EFUA 4KITB 3SNHA 4BFUA 1W0JD 4OQMA 3QBTA 4JLNA 4N3NA 1NBME 5DI3A 5HZKA 1AZSC 4C0LA 1OXXK 3SS8A 3S1AA 4LK2A 2YKGA 2H57A 3IPYA 1G5RA 1ESMA 4JLOA 4PSVA 3ICEA 3DDCA 1R0XA 4QJ3A 1HQCA 2QORA 4KCGA 3C8UA 5IHPA 3U44B 1DVRA 4P4SA 5EUMA 3LBIA 3C16C 4BFXA 2J0SA 1MR3F 3VR5A 4URZR 4TMKA 5JJKA 3FKSD 3L0SA 2WKRA 1UJ2A 2BV3A 5L3SA 5JHGB 3JVVA 4LUCA 4KFRA 4OHXA 2O8BA 4QGGA 3GJ7A 1BS1A 2MMCA 2QPOA 2HF8A 3LVQE 3G5UA 1G41A 1JXOA 2QMOA 4JLPA 4AY2A 3EWSA 4RD1A 2PZGA 2UZIR 4GNKA 1P2UA 3GJ6A 1P62B 1U90A 3MMPA 2Z43A 4I4LA 3W6OA 3WHLA 2FX3A 4X8OA 4UNRA 4DSUA 1F2TA 3VU9A 1FZQA 1S9DA 4Q4AA 3H86A 2VP4A 2CCKA 1XPOA 4BLOA 3TUZC 4EJSB 1XB2A 2QQEA 3AF1A 1A2KC 1L2TA 4DC9A 2IC5A 2YJTD 4PQYA 2CHVA 1Z5ZA 4GBMA 3VX4A 4R71A 1L4YA 3Q8XB 4Q18A 3IHWA 1LS1A 3QF4A 2ZPTX 2J0VA 3REFA 3TMKA 3KQUA 2DFTA 1MABA 3T34A 2AKYA 1GKIA 1AKYA 1S3SA 2KBEA 4B3FX 4LY6A 2A5FA 3RRZA 3A1TA 3L82B 1VDZA 4AKIA 1JAHA 3ASZA 2XSZD 1WXQA 1OHHA 4M9QA 3K0FA 2F43A 2VA8A 5FR1A 3GJ5A 1ZU5A 1AKEA 4EFMA 3TGPA 5AJWA 3AH8A 3HPQA 4D2IA 5H8WA 4AD8A 1FUUA 4Z54A 4FN5A 1T5IA 1Z63A 1Q1EA 1E32A 3AVTA 1T0JB 2XAUA 4KO8A 3GMTA 2GXUA 3GFTA 1J90A 2RGEA 1Q0UA 3AB3A 4UNSA 2B21A 2W2TA 3QXCA 1BIFA 3RS7A 1CXZA 2WPDD 4GFDA 4Q7JB 4ESVA 2ZJZA 4D0LB 3QG5A 2MSDB 1PJRA 3A1SA 5TY0A 5AUOB 1T8UA 2QP4A 3OF5A 2OXCA 1G9XA 3AF3A 3MCAA 2P65A 3A4LA 2ASEA 1P5ZB 4M9SA 1DEKA 3KFXA 3PG5A 5KNBA 5A4JA 4UXJA 2W6JD 3AM1A 4KAXA 4V0NA 3CBQA 4NH0A 4OJQA 3T61A 4WA7A 1EG7A 2BKEA 3KJHA 2ZRJA 3QXHA 4C2TA 2ZR7A 2H1LA 2HXYA 4Q7MB 1IY2A 2FFQA 2A5GA 1SXJB 1SKYE 1ZNYA 4LX0A 4M1WA 2AKAB 4WOPA 3QXXA 2FPKA 3TUIC 2WM9B 3BJIC 1YU9A 3CZQA 3K70C 2AWOA 2AHOA 2X19A 2O0KA 2C96A 1OT3A 3ZS9A 1DAFA 1E9DA 4GZMA 4H1UA 4LRWA 3CWQA 4A0GA 1NVUQ 2QRZA 1GSIA 2GZDA 5C4MA 4URVR 2ORIA 3KTAB 2J0UB 3KL4A 3RS4A 4B76A 3U44A 2QG6A 1GKUB 5EE5B 3RSLA 5AUPB 1CRQA 2YC2C 3ZZ0A 2W00A 3M0EA 5FBVB 2OE2A 1KK3A 221PA 5FOUA 1E1QD 1LTQA 2GAOA 1FW6A 3ND8A 1CR2A 1BYIA 1Z8FA 2EVWX 4NZYA 3IIJA 2C9YA 1KMHA 1MO6A 2GKSA 2PLRA 1CIPA 2ORWA 4M53A 2F9MA 5H70A 1OH6A 4D4KA 4KVAA 2Y8EA 4M1TA 2F9LA 2IBMA 4QNRA 4MDFA 1S9HA 1TL7C 3KJEA 3W8NA 5E7IA 3G0HA 4PHTA 1Z2AA 3BOSA 5FUYA 1WQ1R 3OESA 2ODNA 2WJHA 2H5EA 3ZJYA 3SBDA 4OHVA 1Q44A 5DNYB 2GJKA 4K46A 3ADCA 1KI6B 3BB4A 2OBLA 4Q48A 5FUXA 2JLWA 4XWOA 4MUAA 3IHLA 4KSCA 4DDWA 1P9RA 5ELXA 1NY5A 3K0EA 3WNBA 1P72A 1E0KA 1ZU4A 4RD2A 3LVRE 4OI2A 2FWRA 3GLGA 1KDRA 1AN0A 1OYYA 3NXSA 3LY5A 3GLHE 3UWKA 2BBSA 4B2LA 2AXNA 2QPTA 2J3EA 5LD2B 4PHHA 5KDDA 2BHRA 3L0IB 3VX3A 4DB4A 2O8CB 4RZXA 2IF2A 3CX7A 2ZSFA 3Q7QA 1ZVQA 2E87A 4LYAA 1E2JA 2JLXA 3A36A 2WTUA 4E22A 5DSZA 4M22A 2F1RA 4DCTA 4V02A 3NBZC 2C99A 4GMXA 4V03A 2QGZA 3H2YA 4R9UC 1L7VC 4PQFA 4DLXA 5JS7A 1OH8A 1Z08A 2LCFA 3FMPB 5A5GA 1AIPA 3CF2A 1JECA 5FFMA 1AQUA 4NPHA 4A15A 1NF3A 1NN1A 2BIFA 2B8TA 4LHVA 2XGJA 4KJZA 4LJ9A 4HI0E 1YRAA 1G8YA 3T06B 4W5HA 5F3WB 2GJSA 2CNWA 4IDNA 1E2FA 2OZEA 3NEYA 1G7TA 4US2R 2NOAA 4BQSA 1EWRA 1P2VA 3VNUA 2P67A 3U3OA 4B35A 3THXB 1KY3A 1MRSA 1KDTA 2ZROA 1QHYA 5J40A 5DISB 2ZYUX 1CJKC 1BH2A 1ZM2A 1OXUA 3ZIAA 1Q1QA 5F9FA 4QNMA 3FHOA 5DYIA 4NDZA 3AF2A 1II9A 4A82A 1K6MA 4TYQA 2NZ8A 4NBSA 2PJRA 2C04A 2FSFA 4AYXA 3C5HA 4GZLA 2H7VA 1Q1ZA 1S0UA 1SHZA 2XZLA 1E2HA 1NMZA 4RKFA 521PA 4D4MA 4MGZR 1D6JA 1SXJA 2VSFA 2IUTA 4GRAA 5KTYA 1UBFA 2L0XA 4HAXA 2VH5R 1UDXA 1SKYB 2P6RA 2CK3D 3NTUA 2H18A 4AURA 3RC8A 3CUEF 4DKXA 4PXAA 5BW8A 2DFLA 2OT3B 2WSSA 4OI0A 4FMCB 2G0NA 3P26A 3KTAA 2GXSA 2J0UA 3I1FA 4W5WA 5AJXA 5IRCD 4TZ0A 3DZ8A 5JSZA 4IFEA 2DB3A 1UPTA 1ZM7A 5IK2A 3W6NA 3NC0C 1FUKA 4AKHA 4LBWA 1E69A 1GTVA 2A3RA 3RS5A 2D7CA 2JDID 3B1XA 3BK7A 3IO5A 4NMMA 3U7HB 1S8FA 3AKYA 4PO9A 2KJQA 1QVAA 4TTRA 1FX0A 3RS3A 2ZI5A 1VHTA 1G3RA 4LSGA 2IYLD 4Q1EA 3RANA 3IQWA 1E9EA 5KDOA 2HCJB 2JLUA 1ZINA 2JLSA 4IOLA 1T3LA 4K81B 4BFTA 1S3GA 2OESA 1LS6A 2FEOA 4Q1BA 3TH5A 5BN4A 3AF4A 2CMKA 2ZI9A 2I3BA 3MLEA 4LWZA 2W0MA 1X86B 4TMXA 3CPHA 1CULC 1KI6A 2CLSA 4ZDJA 3K1JA 3ADBA 1JR3D 2F3TA 3VQTA 4DLWA 1ODFA 1GM5A 3TLXA 2QQ0A 4G5SA 5JI3E 1XJCA 2O5VA 3AVOA 3TUJC 4QL3A 4D4LA 4C2UA 121PA 1V5WA 3K0SA 3K09C 4KYIB 1E98A 2KWIA 4MRVA 2WICA 4Q1CA 3GLHB 2OUKA 4PC3A 3ZLJA 1R5NA 1E2IA 3FVQA 4B73A 3K09A 4AWXA 2WZQA 3NDPA 1MT0A 4JLBA 1F2UB 4OK5A 2IYUA 5AR1A 2Q21A 2JASA 4IW3B 2O8CA 2ZRHA 4Q7LA 1U98A 2VP5A 1OXSC 3LV8A 3LX8A 5HE8A 2GJAA 5EJEA 4FWTA 2FPMA 2AXPA 4AI6A 3SYLA 2REXB 2C9OA 2JLRA 1E6CA 1VG8A 1N5KA 1PVOA 2HT6A 4ZV4A 3LXRA 1VCOA 1HA3A 1ZNZA 4O25A 5EE9A 1OH7A 1M8PA 1Z0KA 4NCIA 4C0AC 3W9YA 1CJVC 4XVRA 2RGNA 1B0UA 2YOHA 2PX3A 3AVVA 1SVIA 4IEEA 4LV5B 2R6CA 1NNEA 2IUSA 3N70A 2QUZA 1UBEA 3ECCA 3VR1A 3P20A 3KB1A 2ZIAA 1DAIA 1YHNA 1J7KA 1E0JA 2OCYC 1S1CA 4IDPA 3N5CA 4GDFA 3THXA 3GEIA 1XXHE 2FOLA 1IJFA 4D81A 3FKSA 1FNMA 3IQXA 4LJYA 1Z6TA 3AGQA 1Q21A 4QBFA 1G8HA 2H17A 4JKIA 3WNDA 1P9NA 4NP6A 2O8DA 4C7OB 2G1KA 3W3ZB 1W2GA 1E9CA 5GJCA 3A6PC 4QM6A 2A7QA 4P4TA 4AK9A 1W5TA 1G3QA 2QMUA 2XZOA 1IJEA 1IN8A 2QGNA 5D3MB 2R62A 1NLYA 2Q9BA 4FI3C 1KO7A 4IOKA 5FL7D 2J45A 2GZHA 4L16A 1KK0A 1E94E 1UDWA 3DEFA 3EC1A 4Q01A 4TT3A 3IUYA 2F1IA 4TTQA 1GFIA 4HLQB 2G88A 3K8YA 3B1VA 2E1RA 4MKGA 1ZD1A 1RKBA 4P0TA 2P5TB 3CNLA 3BWDD 4QGAA 2BMFA 4F7WA 2QRNA 3K0CA 5EP4A 1DE0A 2RGCA 1G17A 4DLSA 3RYTC 1D8TA 3EZ6A 3BAFA 3CR8A 4UXIA 3UMRA 4URYR 2NO1A 2SHKA 3KXLA 3EIEA 1G7SA 2GAAA 2QN6A 3K9GA 2DWPA 1O3YA 1GWNA 1TUEA 2XSZA 1E79D 3DPUA 1OIWA 2REOA 3T5GA 1FQJA 1E2PA 4JMPA 4Q9IA 1C9KA 3SE0A 1OFTA 3AGPA 3MWYW 4JL6A 1P2TA 2ZR9A 4KFTA 3PEVA 3BS4A 3KQKA 4GL2A 4LOAA 3BFXA 2G1JA 4BFYA 2VO1A 5SZIA 5CM8B 2ERXA 3R20A 4JVSB 1ZCBA 3WHKA 4B6EA 2XB2A 1QRAA 4D82A 2RCNA 3KKOA 2XJ9A 4JBXA 4NTZA 4M21A 2ZSEA 2IWRA 4ABYA 2NPFA 2R6DA 3BBPA 5AJYA 2FGJA 2VHJA 1FOEB 3CH4B 4OI4A 3M6AA 4WBSA 1ONBA 2WPDA 3RNLA 1F6BA 4I1SA 1ZD9A 4NE2A 4TLDA 1Z83A 3RDPA 4DLRA 5BN3A 3IILA 5LB2A 4TTPA 2IEYA 2HYIC 1KDOA 2GILA 4QM7A 1FMLA 1SZPA 2RHDA 4RD0A 5EP1A 5EXXA 2A5DA 4CEIB 1E4VA 1F2UA 2W6JA 4JLJA 3I4LA 2ZRAA 3THWB 2I4IA 1GKYA 3D31A 3ZIAD 3EZ2A 3DZDA 3OE7D 3RRNA 1JR6A 1HE8B 1N6HA 4DCNA 5TARA 2ZRLA 3QUSA 1XD2B 2D4HA 4DCVA 4GPTA 3U5ZB 4HLDA 1NMXA 5BYKA 2QZ4A 5E95A 3ZVRA 3V00A 4LV8B 5TXGA 2OAQ1 3O8DA 1X8JA 2V54A 1NBMD 1O87A 3HU3A 2GRJA 2P6UA 3OIYA 3NBXX 2ODEA 1CJTC 1TQ4A 4HZIA 5CYPA 4CF7A 2OEPA 2GCNA 3N2EA 3QXSA 4XSHA 4D26A 2IF0A 3M1IA 1JJ7A 2QEQA 1D2EA 1G8GA 4B74A 4DIEA 4JBWA 3O8CA 1VHLA 1T0HB 2CE7A 1G5TA 1LV7A 2G77B 3BXZA 3CPJB 2PL3A 5EXSA 3V4RA 4N1AA 1XXHB 5FPTA 2ATVA 2HCBA 1OB5A 4IVQA 4RFSB 4C7OA 4IHQA 2OLKA 4BFSA 4C0KA 2FH5B 3ETLA 3I73A 4OQLA 4NKRA 1T6NA 1ZNXA 4ZDIA 4PQRA 4A0RA 3FMIA 5D3MA 1J70A 5AWFC 1QF9A 4B3BA 4JL5A 4FMDB 1G64A 4TN1A 4LBYA 1W5SA 2C03A 2FFAA 3BORA 2ZU0C 1ZYUA 3OZXA 3RSOA 5DH9A 4RZ2A 4F4JA 4QHTA 4UKDA 1G6OA 5GJVC 1W36B 1OPXA 1T91A 4Q9HA 4PZYA 1EFHA 5BWMA 1PUIA 3T1VA 3LWNA 4BEBA 1Z28A 2AWNA 3JZMA 2HJGA 3AVQA 4MRRA 3I32A 2IHBA 4KODA 4TMVA 4DHEA 2J0QA 3GLIB 4NYMQ 4A9AA 4BZPA 1XCPA 3HP1A 1COWD 3K0AB 3OFND 4HB4A 1VECA 3WMFA 5HCNA 1PV4A 1MO3A 1R10A 4PC1A 2GXAA 3D6TB 4RVCA 1XMVA 2AFHE 1HH4A 1MRNA 1P61B 2WAXA 2FF7A 2EFEB 2AN9A 2ZXUA 5KPJA 1G4UR 4TYYA 5HCIA 4C0BA 2IYVA 2UVQA 4LYHA 3THYA 2OLJA 2XX3A 4HB0A 5AUNB 2WBLC 1MO4A 2YINC 3AP3A 4RCZA 2BJWA 5CJ2A 1NG9A 4Q5IA 4BECA 4ZDKA 2BDTA 2OFOA 5BXQC 2OXRA 3UMFA 4Q1FA 4ZKDA 1E9BA 4A6XA 5KNDA 1ZMXA 4B43A 4S2EA 1YZLA 1GILA 1WCV1 2H92A 3GLFE 3EPJA 1G3IA 1NI3A 3OIUA 4GP6A 5B64A 4R2HA 2Q0HA 2Z6VA 5G41A 1KTVA 1RYHA 3WRXC 4EFNA 3QVUA 3T35A 3TKLA 1JAIA 5FPYA 1KIMA 5DLQC 1SVWA 5EZ5A 3DHWC 3NVAA 4X8LA 4A8JB 3CNOA 3AKCA 3QG1A 4CEIA 5EE1A 3BERA 4TMTA 3E2IA 4Q9JA 1P4SA 1OF1A 3FHCB 4B2PA 1FNNA 3ZS8A 5JCPA 2PCLA 3B2EA 3AVYA 2ZAOA 2ZE7A 2GJ8A 4NCKA 3R8CA 4B48A 5EP2A 5IT5A 1E2KA 1XD2A 4DDUA 4MQBA 3OIVA 2ZE8A 1E9SA 4MKHA 3BFKA 1GDDA 1SVSA 4HLUA 2JAQA 2BBOA 4DRZA 3LLUA 1XMSA 2CK3A 5JMTA 4U7DA 4TQAA 5TDHA 3R9IA 5JEEA 2ERYA 4PPFA 4X8HA 3WYGA 4TT3D 2XTZA 4RD6A 1OIVA 3EARA 3RC3A 3IO3A 2IYYA 2J87A 4ARZB 4W7SA 2X1VA 6Q21A 5JECA 4HB2A 1H8HD 4BPBA 2PX0A 1E9AA 1KZ7B 4DLVA 2JDIA 2ZSDA 3P4YA 3C7KA 2NO6A 2VSOA 5C18A 2OFXA 4Q4JB 2DR3A 3LQQA 1Y3AA 3C5CA 4GT1A 1JNYA 1KI7A 3A4MA 1TU4A 4OKSA 4OHZA 2WIAA 2ZRGA 3Q72A 3Q9LA 3RRYA 1ELOA 2CJWB 2DBYA 1U9IA 4B32A 4IJMA 3LXXA 3CM0A 4MH0R 1OB2A 1G6HA 2J7PD 4KLZA 3LNCA 1EFRD 1GNQA 1RZ3A 3Q5EA 2IK8A 4Q02A 3W90A 4E09A 3I8XA 4YDHB 1QHHA 1G291 1JR3A 1OE0A 1RVDA 4NONA 3T1TA 3CRRA 2OBNA 3I8SA 3SBEA 1C4OA 2QROA 2DPXA 3CRQA 1FL9A 1X3SA 5JJLA 4LJ8A 3B1ZA 4QRHA 1EWQA 5CK4A 1DO2A 5G3ZA 1B23P 4HAWA 1I2MA 4PPNA 3LBHA 4M8NE 2DY1A 4QC2A 3GLIA 3EZ9A 3UPUA 3QQ5A 3K0AA 4GSYA 3TK1A 2X2EA 1IN4A 2ZU6A 5JBQA 3K9LA 2JJ1A 2ZRBA 2ZUCA 2O0HA 1XEXB 2ANBA 3O47A 4E5UA 1G7RA 3P4XA 3IDQA 2CDNA 1CTQA 1NKTA 1Q57A 1R4AA 2ZTSA 3DVLA 3OEEA 3WBJA 4BLRA 3TE6A 4XOIA 3CZPA 4N0EA 3TVTA 1QDEA 1TQDA 4B6FA 2ZRKA 4HATA 1Z29A 1KSFX 3LLMA 1N0UA 1QHIA 4XH9B 4H1VA 3UATA 2IYRA 2ZJAA 4DVGA 1II0A 3IIKA 4YMUA 2WJIA 2D3WA 2QTFA 5AJVB 3C4JA 2NMVA 1YZQA 4JLMA 3OIWA 1OLOA 2CHQA 1NMYA 1OFIA 4HAZA 4Q4HB 3GLFB 3X1ZA 1J2JA 2Z5FA 3CF6R 2W2VA 2OBMA 4Q66C 2GEVA 1IN6A 2YWHA 3BH0A 3EPHA 2F7SA 4JZKA 4G5OA 4PX9A 1G16A 4A8JA 2CXXA 2FE4A 3KJIA 3Q3JB 4TMZA 3B9PA 3VHXA 4NCHA 4W9MC 1IY1A 1CLUA 3U3RA 2EYUA 1M7GA 1JXMA 5G53C 2G83A 1KZGB 3E5HA 4OI1A 4NYMR 1TEVA 2DCUA 3CRW1 1G21E 3IIMA 1ZIPA 1W7AA 5A0FA 2B7CA 5M04A 4L9SA 3SQXA 3A1WA 2X77A 3FKQA 4EPTA 2ZRMA 3PFIA 2J59A 4GOKA 4PFSA 1JQLB 5FL7A 3HDTA 3UXMA 2GJ9A 3NBFA 1KI9A 4JVNA 1N6KA 4G5GA 1R5OA 3CONA 4KVGA 4EJSC 1K8RA 1Z0FA 2ZJ8A 4HDQB 3TRFA 1ANKA 5JRZA 4I1UA 2ZYTX 4Q19A 5L3QB 2XJ4A 5J4LA 4G01B 2AFIE 3GEEA 1ZUNB 2VQSA 4LYJA 3TR0A 4EJSA 1U0JA 1Z2CA 2D2FA 1ZUIA 2ZJ2A 4PSAA 1NIJA 2WKPA 1FTNA 1P60A 2HF9A 1WF3A 5BQ5A 4ARZA 2R9VA 1S96A 1ZM3A 3NC1C 4IXMA 4EPXA 3EIQA 1AK2A 1KI2A 4Q1DA 1XZQA 2Z4RA 1BO6A 1U0LA 1FP7A 2A5JA 1GL6A 2V3CC 4I99A 2AD5A 3KKQA 3B78A 2Q3HA 1G5PA 4QKQA 1E79A 1HQYE 3F5FA 1RRCA 1NN0A 4IFBA 4YXWD 5KSYA 1DAGA 4ACAA 1FFHA 4AG5A 2QM8A 4JLDA 4DJTA 2R44A 2FMXA 1U8ZA 2IXFA 2KE5A 4MA4A 3FTQA 3RVBA 4PC7A 1FMJA 3DL0A 3CF0A 3BFVA 2F3RA 3RS2A 3X1DA 1QZXA 4YC7A 1RJ9B 2ZITA 1CF4A 1WB9A 3QBVA 4A6PA 4MRPA 1U99A 1EFCA 721PA 2YWGA 4JKYA 2EFCB 3IKJA 1UKYA 1I4DD 1NL3A 5DYGA 3E1SA 3MG9A 3KKNA 5CK5A 4ZKEA 2XTNA 1W4CA 4JL8A 2FEMA 3MJHA 2BM0A 2D06A 1AZTA 2GK6A 3B60A 4CZ2A 5BN5A 3SHWA 2YC4C 3RLFA 4DT1B 4Z1MA 2Q3FA 4ON9A 4XJXA 2FJUA 4P32A 2JIZA 1XMIA 4Q9LA 4ASUA 3FHTA 4F93B 1VCIA 2RKOA 1JEEA 3B82A 3SJAA 4TZ6A 4MYTA 3KZ1E 1DTSA 3LBNA 4FCVA 5SZHB 3NBYC 4LHYA 4U5XA 4M9XA 1XEXA 1ZRHA 3TW8B 2V7QD 1L8QA 1IONA 3FDIA 3OE7A 4B3CA 4ZDWA 4URXR 2CLCX 4F92B 3PUVA 1P7CA 1SXJC 2V9PA 3DKPA 2PMKA 5JCZA 3GJ8A 3TVDA 1KSGA 1KI8A 2EFHB 4Q4LA 1Z0AA 3A58B 2NO0A 3A1VA 1XBTA 4DIDA 5JEDA 2IS4A 1M6NA 4MYUA 3SI7A 3NKVA 3BRWD 1NBMA 4NU0A 1EK0A 2FDCA 3T5DA 1E1RA 4LJ6A 3ZYCA 3WP1B 1XFAA 4FINA 4IKEA 4ZIRB 2F1HA 3UKDA 4IDQA 1HV8A 2JGNA 3LH5A 1RE0A 3N2IA 1KAOA 2BJVA 2PCJA 1IXZA 2JA1A 3BE4A 4QXAA 2FV8A 1JQJC 2YWEA 2GCOB 4CYMA 8OHMA 3MSXA 5CDFE 2CEAA 5J4HA 5EE0A 3WYFA 1UBGA 4HUQB 1YZKA 4EQ6B 2C9CA 3I62A 1S2MA 2HT1A 3VNVA 5L3RA 2VRWA 4OQFA 2W58A 1CRPA 2V1XA 1JALA 1AGRA 4XSGA 4BUJA 1VG0B 1G8FA 3I5XA 1VYTA 5C1BA 2QENA 4LJ4A 2VPPA 5GJBA 5L3QA 3QPVA 2XB4A 2ZUDA 5KPDA 1E2EA 2ZVPX 2WV9A 5C46F 4P33A 1W36D 4OQXA 3RRMA 1FTSA 3BGWA 3TQCA 1IXSB 2J9RA 3R7WB 1GVNB 3QPUA 1TUIA 1PLKA 4LI0A 2Z4SA 3PJRA 4JBYA 4ESHA 1BKDR 5LD2C 1VPLA 1DARA 4NYIQ 5JWOA 2GBLA 3PVSA 1COWA 5TMPA 3ZVLA 2A9KA 2PEZA 2J46A 2WJYA 2G3YA 1U81A 3OFNA 3AKEA 4DDTA 1J8YF 3ZVNA 1OV4A 2A2ZA 3HU1A 2JEOA 4AYWA 2BVNA 5CB6A 1LB1B 4CEHB 4KFUA 2JJ1D 3H4MA 1H8ED 2ZJOA 4MRNA 5ANRB 1FPMA 4QHYA 5IF9A 1P9WA 3OEED 2WWXA 3B13B 4BRUA 1D9ZA 3DO6A 3MUFA 3RHFA 3AF0A 5P21A 1XPUA 2AK2A 1F60A 3B85A 2RGNC 4JYCA 4LCBA 3CW2A 3L2OB 5H68A 3FGNA 1XTIA 1G4AE 3QKSB 2FPLA 1GRNA 3SR0A 1CR0A 1GUAA 1NVWQ 2XNDA 1LF5A 4BGDA 4MDEA 2QI9C 2N46A 2GF0A 1GG2A 2VF7A 3QSYA 4URWR 3Q5DA 3B1WA 4J0QA 4F4IA 4HLCA 4ZPXA 1UFQA 3P27A 2QY9A 4JYBA 4DBLC 2QP3A 3RS0A 1IHUA 1VYUA 3PITA 1CEEA 3ICQB 1KK1A 4UNNA 5EQTA 4D25A 4PSKA 1QVRA 4M2LA 4PTLA 5J4YA 1ZM4A 2XOKD 4I1OA 2ZEJA 1F48A 5JHHB 2J1LA 1N6PA 4DCUA 2ZRCA 2ZRIA 4M1YA 1SGWA 2AL7A 5HR5A 4B44A 2CCJA 1Z3IX 1E2LA 2I1QA 2OO7A 1NLZA 1TMKA 2JJ2D 1UBCA 1UKVY 5UKDA 2IA5A 2ZETA 3CRVA 3HYRA 1G8PA 2GDJA 4RCYA 3SYKA 1W47A 5HTKA 3O8BA 1Q1BA 4A2QA 3P1JA 4LHWA 3K0CC 2ZJYA 4HAVA 1AS2A 1US8B 3EWAA 4LPSA 2W83A 1Q3TA 4C0JA 2AR7A 4LBZA 2QNRA 2BWJA 2LWIA 1H8HA 1PZNA 2QTVB 5DI9A 1MO5A 1E2DA 1T9HA 3K9NA 1JI0A 1Q22A 2GCOA 3QI2A 2WWYA 2QT1A 4WAUA 4F38A 4HUQA 4D6PA 4EAQA 3AP1A 4EQ6A 4KXFB 4MUBA 3WP0A 821PA 2QAGB 4TL8A 3MD0A 5DO9A 1MOZA 1KNXA 5HKKD 2O8EB 3LA6A 3QF7A 2JLQA 1FP6A 1NY6A 5JWRA 3CX8A 4R7ZA 2IS6A 2ZE5A 621PA 2P6NA 2WWFA 4FD2A 2J7PA 1EFRA 4QBHA 5FUVA 4P3YA 4XVQA 2AD1A 1NKSA 1Z06A 1OKKA 4TQ9A 1RFLA 2N1BA 3IBGA 1E2QA 1DPFA 2RHMA 3R7WA 3KQLA 1W44A 1XD9A 1V43A 4AC9A 4BRWA 5E7MA 4FIDA 5F9HA 4Z1MD 3ZH9B 2ZJBA 4XWAA 3IBYA 1XTKA 1Q12A 2JIZD 2LKDA 3PCRB 1M34E 4ASUD 2OV2A 3GLHA 4YQFA 5JWHA 2W2XA 5JI2E 2IS1A 3VMFA 4U00A 4IRUB 3SJCA 1SVOA 2WAYA 3B5JA 3BB3A 1QHSA 3CWZA 2A5YB 5DI3B 2G0TA 3AQ4A 4CEHA 2GZAA 4CEJB 1SQ5A 2FSIA 4LC1A 2YHSA 3CKLA 4RJLA 3UG6A 4OHYA 2RGXA 1LVGA 4JJZA 3VR6A 4QJ4A 3AUXA 1G19A 4QGHA 3AVXA 3EW9A 4A2PA 1E9FA 1DS6A 5CITA 3ONWA 1A2BA 3V4FA 2Q6TA 3GFOA 1ETUA 2QBYB 4UJ3A 4NCJA 3FOZA 4Q00A 3QIAA 4P4SB 4PC2A 2BEJA 1Y63A 2NO7A 2PZEA 4FMBB 1G1MA 2VF8A 3MRSA 3QKSA 4GOJA 3TSWA 1GRRA 1N3BA 3W5IA 2V1UA 3EASA 1N6LA 4R98A 5TB5A 3QEOA 4MITA 4ERNA 3K9HA 5D3QA 4IVPA 5L3SB 3AP2A 1E1RD 4KV9A 1NRJB 5TV2A 3KJGA 2MSEB 4FCWA 3UWOA 5FOWA 1DAHA 3IGFA 4EFLA 2GVDC 4KYUA 2GCPA 5JJIA 5FUWA 1ZCAA 4JLVA 1N6RA 1BMFD 1N5IA 2NIPA 1D5CA 4KFSA 4NYIR 3F3YA 3EZ7A 2WVJA 4QBGB 5GVRA 1XTRA 1OH5A 1RW4A 1T4GA 2REBA 2KBFA 1ZNWA 4MYCA 3VU9B 1PUJA 1MKYA 1VCNA 3ZQJA 2FGKA 3KKMA 3LFUA 1E96A 2BEKA 4G1UC 2F6RA 1SULA 4DDVA 3DOFA 5FH9A 2WMOB 4PZZA 1U94A 5FOTA 4Y0AA 2HJVA 3GLGE 2BMDA 4GOXA 3QF4B 4L4UA 2RGAA 4LJ7A 2B8WA 3TW4A 5IDVA 4DUGD 1RPZA 4Q47A 4QFMA 4UNQA 1MABB 3LD9A 1E2MA 4W5JA 1RYFA 4FCTA 2CE2X 3GEHA 3O8RA 5FTNA 2QL6A 3KUCA 2FSGA 2GHIA 4BFWA 3U6BA 3CO5A 5FI0B 3U60B 1AJEA 2YZ2A 2HLDD 2F1JA 4C0QC 1Q20A 2IYZA 2OILA 3K0FB 3ZDQA 4WXPA 1Z6XA 4WZBE 3WY9A 3FMFA 1X6VA 1HE1C 3CIOA 3U6KA 1YVDA 4OBEA 2WKQA 1GP2A 3GD7A 2VHUA 3VFDA 2UZ3A 3GP8A 5CLQA 1XWIA 2CL6X 1R8SA 1N6NA 1TQ6A 3PQCA 1ESNA 4I1VA 4LDJA 4YXWA 2R6FA 1ZP6A 3RABA 4L9WA 1KO4A 3ZD7A 2ZRNA 2ZQ5A 1KO1A 2GXQA 5CIWA 5LBIA 1H65A 1TU3A 3CRMA 1M1YE 3NHBA 2QMEA 1DADA 1P2SA 1UEJA 2KB0A 5KNCA 1KNQA 2YNMA 1NVVR 3VKHA 4ITRC 3R8FA 3V9PA 1OW3B 3U61B 2IXGA 3BH6A 5JRJA 1TAGA 4C30A 1KMQA 3SDZA 2GTPA 1QG4A 2WWGA 2YOGA 1QBKC 4PO8A 1KHTA 1II8B 3EX7C 2XNDD 4Y0VA 1T3SA 3T12A 3Q85A 2VEDA 3PIRA 1YZUA 1I2DA 1N25A 3BH7A 4ZI3A 3HPRA 2EYQA 2V6JA 1CKEA 2ORVA 4EIWA 2ZRDA 5FOXA 3UMSA 3CB4A 1SXJE 4KU4A 2OG2A 4YMSA 1FQKA 1E4YA 2WIBA 4M1KA 4KBFA 3K53A 1GOTA 1E9RA 1TPZA 4TLBA 3EPLA 1KKLA 2J7KA 2V7QA 4US0R 1KO8A 2E9SA 3SHFA 3THWA 2D7DA 4CEJA 3QY0A 2CL7X 2VSXA 1RRGA 4F4CA 4HLUC 4P31A 4DLYA 3K70B 2QBYA 1AQYA 4HB3A 1DAEA 3IEVA 4L15A 2QSZA 1C1YA 2HEIA 4A0FA 1E3MA 1K5DA 3BB1A 1W46A 4Q21A 4IXNA 1G3UA 4WVFA 4BLTA 1CP2A 1AGPA 2GWHA 3FE2A 1Z6AA 4P4UA 3A4NA 1A7JA 1NG1A 3DKVA 1VIYA 1QHXA 4OL0A 1U8YA 5E4FA 1UAAA 3PEYA 3C15C 4NYJQ 5FPKA 3OAAD 1KMHB 2RGDA 4ACBA 4Q9KA 5JFGA 4GI7A 4JLAA 1UADA 2ZJ5A 3L0OA 1ZAKA 4L8GA 2RH5A 1XXHA 1N5JA 2GK7A 2N42A 1LNZA 5J5CA 4BFVA 2ZS7A 1R0YA 4GMDA 4RFSA 2C78A 4D4JA 5KHOC 3RAPR 1X1SA 2JLVA 1XZPA 1U9IC 5K8IA 4BLSA 3W8RA 3WMEA 4G0NA 2DWOA 4LPKA 4U02A 4B33A 3T1OA 4HAYA 1PLLA 4NL4H 2CVFA 3GQBA 3GLGB 1KDPA 1W36C 2KSQA 3CLVA 2ZUBA 2FFHA 3KXKA 3TIFA 1RRFA 3LAWA 3HR8A 1A5TA 1HTWA 2CL0X 2R6GA 1GL7A 1YQTA 3GJ4A 3DMDA 5CLLA 3W6PA 1OKKD 3D3QA 4TLEA 2X8AA 4XVUA 1D2NA 1XPRA 4TYPA 2DWQA 3TSZA 2ZRPA 4YMVA 3LW8A 1KSHA 2B7BA 2IEZA 4RY2A 1YZNA 2AK3A 2YOFA 5EXPA 3QKRB 4Q7KA 1Z07A 2MMGA 2J5XA 4UQOA 3M4YA 1IN5A 1SHKA 3H1TA 3C14C 3HU2A 4WIAA 4PR0A 5K8LA 1T8TA 2FA9A 3SJBA 1VMAA 2ZYVX 5FTKA 4CIDA 1SVMA 1H8EA 3WRYC 1WMSA 4M1MA 4UNPA 1NN5A 1RC8A 5DN6D 4AKEA 1XEWX 4LYFA 4B2IA 2BMEA 1Z47A 1IM2A 1IAQA 4KHZA 3VR4A 2ATXA 1TQ2A 4O2RA 5SZJA 3RWMB 2IYXA 2WMNB 3CNNA 1CS4C 1LY1A 3D8BA 5SZKB 1II8A 2VHCA 4EKDA 3I61A 2HXSA 3JVUA 2PJZA 4TQUS 3ZVMA 1TNDA 1S4QA 4KSBA 3OEHD 3PR1A 4CVNA 5B58C 4HUTA 1Q3HA 1TADA 4A8JC 4TLCA 2IYSA 3AVPA 5CJPA 5AJZA 4ZCIA 1WE2A 1QG2A 1ZC4A 1EFTA 4DXAA 1AS0A 1KKMA 4YLGA 5GVSA 1J8MF 2DFKB 5AK0A 4AKGA 2XOKA 3CPEA 1YR7A 5FI1B 4YMTA 4LHZA 3TBKA 1TEXA 5FOSA 4Z51A 1N6IA 1DO0A 2A30A 1F3OA 2DHRA 2RAPA 2VP6A 4K8OA 4PC6A 4TMWA 2JATA 2VBCA 1QHGA 3GPLA 3SU8A 1R8QA 2QE7D 1R0ZA 2LKCA 3NIBA 4DLUA 2WJGA 4LBVA 4NCNA 4DEXA 2JJ2A 4TYWA 2ZE6A 3Q7PA 5JSZB 2WWIA 4O0MA 3U4QB 2WHXA 4MGKR 2D2EA 2XXAB 2ODBA 3KFVA 4L5BA 4ILEA 5HE9A 4EPWA 2O8FB 1NIPA 2BCGY 2Z83A 4F91B 4LZZA 3OHMA 3QKUA 2QPAA 1E99A 4TL7A 1Z0JA 3QVVA 2XTMA 1EESA 1FX0B 1OXVA 1CR1A 1HEIA 4R2IA 2NGRA 1XCMA 4XD7D 5L3VA 2YYZA 1SVKA 3GFPA 3ZQ6A 2IYTA 1XD8A 4B71A 3PUXA 3A1UA 4OJKA 1BOFA 2XEXA 2V4ZA 1M7BA 4WZAE 4JLKA 1KI1A 4M0LA 5FL3A 4A4DA 1TTTA 3KQHA 4DLZA 2IYQA 3QXJA 1KI3A 2CBZA 4Q4JA 1OXTA 1DAMA 2YWFA 3TSOA 2A78A 2QM7A 3GJ3A 3U3MA 1R2QA 1WRBA 2BC9A 1P6XA 3L8ZA 5HKKA 3MGCA 4JSTA 4X8MA 1IN7A 1VCMA 1TX4B 2MSCB 2CLDX 1A4RA 1JPJA 2BBTA 2C8VA 3I5YA 2YV5A 3U3KA 2W6IA 2CJWA 1DELA 3SN6A 3T1QA 3X1XA 5FBLB 4E03A 3U7GA 3DM5A 3JZAA 4BE7B 3ZZUA 2QTHA 2JCSA 1XF9A 4B3XA 5B30A 5KSZA 2QMHA 4PHFA 5J4VA 4TWZA 1VKJA 4BZXA 1GNRA 2CVHA 2R2AA 4WZ6A 4MGIR 4IVRA 4TSFA 1CBUA 3SJZA 3NDBB 2ANCA 2B6HA 4II7A 2ZSBA 4IOMA 2GA8A 1DG3A 1GL9B 3AEZA 1DAKA 1ZJ6A 3DMNA 4OHWA 5FTLA 3F8TA 1M7HA 1EX7A 2XNSA 3AKDA 5KOYA 1ZW6A 3QKRA 5E3HA 4Z8YA 4NYJR 3R9WA 4JSYA 3BIFA 5L8VA 1CJUC 4LJ5A 4BFZA 4PAOA 1L4UA 2FSHA 1HT2E 3HR7A 4QGFA 2ZVQX 2VL7A 1W48A 4V0OA 3LW7A 5CIQA 3GJXC 4I81A 3TAUA 2VP0A 2V6IA 4OQNA 4OK3A 1IOZA 3KX2A 1W0KA 1X1RA 2EW1A 4RFVA 2ODWA 2ZANA 3HWSA 5FPSA 1QHNA 4DSTA 4JT2A 4RD4A 2ZREA 1XJ0A 3LDAA 1MH1A 4FMCF 3H84A 3D7MA 4XWKA 1OIXA 4JJKA 2C95A 1KOFA 3VTKA 2ZRFA 2C2HA 1W2HA 2BM1A 1XNJA 4MKFA 4Q03A 1D9XA 4MGYR 5JS8A 4WXRA 2WWHA 4BEJA 1AM4D 5FTJA 4AG6A 1WBBA 3ADDA 2IS2A 1KJWA 3GLFA 2FFBA 4Q4HA 2O8DB 4B3DA 3ZGXA 3AUYA 4BZQA 4EPRA 3EA0A 3EAQA 5DGXA 5H1YA 2QAJA 3VHLB 2AX4A 4EDHA 1XCGB 2C98A 1M74A 5FBWB 4IDHA 1N0WA 4OYHA 5FOVA 4BWYA 1AS3A 3SEAA 2G6BA 1BMFA 3VAAA 1UM8A 1ZBDA 4LJAA 5DHFA 1JEDA 3IEUA 1YJ5A 4FWIB 2HV8A 5B2ZA 2H16A 1HUQA 2W0SA 4V0LA 2VHTA 4A36A 2EWWA 3QPWA 2IW3A 2RGBA 2P3SA 3X1YA 5CB8A 4C9BA 5BYJA 3CH5A 2QU8A 1WA5A 3QKTA 3R9XA 1N0VC 3AVUA 4AIIA 2R65A 1YR6A 1M2OB 5LDDC 5JZVA 1W49A 4HZUB 3NG1A 4DWJA 3U4QA 4DUGA 3G82C 1YRBA 2XXAA 2IHYA 2ONJA 1W4AA 2QSYA 4PAQA 2H8KA 1VG1A 1TF2A 1XTSA 5DIFA 2O8FA 2TMKA 4UJ5A 3NWJA 2EFDB 3W3AA 3SYNA 2PLFA 3SFZA 3W5JA 4V0ME 2HLDA 4A1FA 2ZAMA 4RZ3A 3B9QA 1Z6YA 1VIAA 2GF9A 4M4SA 3PEWA 4MKIA 4IOJA 4CGZA 4QOSA 3MAAC 1OHHD 2FZ4A 2FU5C 2GBLC 1D2MA 1CU1A 2VP9A 4JVMA 4Z8XA 4BLQA 3H0KA 3P32A 2Q9AA 3TAHA 5GADl 1XEWY 4C4PA 1ZM9A 3BD9A 1U0HC 2R8RA 4PANA 3LRPA 4QJ5A 2JJ8A 4LHXA 1NJFA 1P3JA 3ASYA 1F5NA 4KI0A 2Z0MA 3KXIA 2HDNB 4B75A 2BOVA 2PEYA 5TVKA 1ZUHA 1IY0A 2Q9CA 3CX6A 3QEJA 3KDSE 4PPQA 1NVXQ 1Z22A 3WYAA 3AV0B 4B3GA 1W4RA 2RGGA 3FPAA 4JVLA 4PHGA 5KSPA 3REGA 4M1OA 1YR9A 4IDOA 4XIGS 4CRWB 3NH9A 3ADKA 4WW0A 1R7RA 1RJ9A 4CDGA 4LGMA 3U2QA 2GVZC 5J4KA 2WSMA 2PT7A 1LFDB 2ONKA 1CR4A 1YZGA 3KKPA 4HYYA 2OSBA 1EGAA 5B57C 3EXAA 2WJVA 5FPHA 4XTCS 3NHAA 4ZO4A 1HT1E 1KJZA 1YZTA 2V55B 1HURA 1XJQA 3SFVA 2ZSAA 2XZPA 3QENA 3A37A 4DT1A 4UXHA 1SKQA 3QNUA 5E7JA 1XTJA 1NLFA 1ZIOA 4ZI2A 5F98A 1G7CA 3LX5A 3T15A 2OFWA 4LV6A 2HYDA 2RMKA 1E0AA 1W0JA 4TYNA 2WOOA 3EPKA 3HJNA 2OAP1 3TR5A 1GZSA 5K8TA 3X2SA 1XP8A 5FBRB 3UG7A 2NG1A 1IQPA 2K5UA 4MYHA 1W4BA 1DG1G
chains in the Genus database with same CATH superfamily
1NVVQ 2ZTHA 3KQYA 4I5FA 1K2WA 3DDNA 3WNQA 5LPNA 2X9GA 3NHRA 1PF7E 2VJMB 4YK7A 1JEJA 3UXYA 1Z5UA 2HCFA 2XAAA 5DFAA 2I7VA 2EQBA 1R5BA 2CMHA 5I8ZA 3OVMA 1MV5A 5B36A 1SG0A 4YMIA 2IODA 2R87A 1VLJA 1WXFA 3H13A 2V7EA 1BFDA 3OC0A 2VJAA 4YGYA 4S12A 3T6KA 3V2HA 1R0WA 4BASA 3J81k 1DOAA 2FZLA 1UEIA 3HLKA 3B1YA 3DWGA 2PVSA 4ZIRA 4MPDA 5LM3A 1KGDA 5KDLA 2VIIA 4LY3A 2Q6KA 4R41A 4HSEA 4RXTA 4C3OB 5AK5A 2ZI7A 4GZ3A 5CXXA 2YV3A 1NP6A 3VR0A 3IP7A 2R6R1 3L43A 1CUCA 1UBSB 2XITA 2M1ZA 2PZBA 4WGGA 3EGWA 3LQ1A 2RHJA 2GN1A 2BMJA 1CJMA 1J06A 1JBKA 1PX2A 2DUNA 1IBRA 1R6BX 1O6BA 3PT5A 2P2SA 4R16A 4UREA 5ALOA 3CY6A 5AM4A 2KI5A 3THOA 3TZBA 4D0GA 4EBBA 5LN1A 2JZCA 3ZWMA 3GT4A 1CY7A 2YASA 4EHAA 3ZD8A 1GAJA 3NHWA 4CMGA 2Z30A 4XFKA 1UBRS 1XDWA 1CB0A 4N49A 4WY5A 2UV8A 1GPLA 1TO1E 3CVVA 1VJTA 3AR7A 3EXFA 1T5LA 5DP2A 3VKWA 1AUVA 1E18A 3UIEA 1RKQA 3WLKX 4N0DA 4BN4A 2H2IA 2PN1A 3EZYA 1DMRA 3E23A 3Q9UA 3DP7A 3A0RB 4GVLA 1ZJJA 4JI1B 4IZHA 1XNQB 1EM6A 1DQSA 1NSFA 3JU3A 2I62A 5AKJA 5JCJD 3MFYA 4IS2A 4GP7A 4ZOLB 3B5IA 4BVFA 5BV0A 4F2HA 4BNYA 4ZVLA 3A3OA 3VR3A 1Z0DA 3AFIA 1FUEA 4HXGA 1PEDA 1BXZA 4RW0A 4WFIA 4UUNA 1P4JA 1UFKA 2LIPA 1S02A 4J7CA 2MWMA 4TKLA 5D87A 1QYXA 3W77A 3WGMA 5D7NA 3U0VA 3WXMA 4F3YA 2Y4NA 3R77A 4UU0A 3LECA 3MJVA 4OX9B 3VHQA 1YE5A 2I8LA 3QXGA 4ZTZB 5DEIA 3MWKA 5TPWB 2D1RA 4GC9A 3QE0A 5E9QA 1P45A 1RZRA 1SUWA 1W88B 1NR1A 3THYB 4DZZA 4TRJA 4A92A 1HDIA 2BRUC 4CT4B 4D9GA 1GPH1 1PEAA 2F8TA 1XSEA 5C1IA 4AJLA 5KO2A 4NU6A 4TL9A 2JIPA 1S2GA 2IZOA 3ZHOA 4PO1A 5FHRA 1ODSA 2QXYA 1TK3A 1JNXX 3IPXA 1JN0A 3S1AB 2IX3A 3QSGA 3GJ0A 1I0ZA 4E5VA 5JAOA 3TQFA 3ZZNA 3W6ZA 1OYWA 1AV7A 1W0KD 1Z4JA 2Z95A 3P0EA 4KQXA 1BQ4A 1CNMA 2ZIXB 4MS1A 4QBIA 2BMAA 1A9XA 3DUFA 1DUVG 2G9NA 1U8XX 4U2BA 3DFUA 4YRTA 3L7NA 1MHPA 3HK2A 1PD1A 4P98A 3Q87B 3QPDA 1Y7TA 1XEFA 1V8FA 4X1KB 5KWEA 4EMTA 3HSSA 1BX3A 1KA9H 1X38A 1H2BA 3MTDA 2P5SA 4NU8X 3USCS 5GQSA 2PMDA 3IXQA 5INTA 3QFSA 2QLBA 1T3HA 1V95A 1FRVA 1XHFA 2OCPA 4Q1AA 5CB4A 2H06A 3AJAA 3GXOA 4JT4A 4YAKA 1CUHA 1OSNA 2NTYC 1C4WA 4IDBA 3FZEA 3LPMA 3MOIA 4WK0B 3TJZA 4Z49A 5DNWA 6NULA 4QLAA 4I66A 2JANA 1J39A 1BDMA 2JIQA 1WPRA 5HDQA 3FA2A 2GPWA 1IDN1 3DBRB 3QWBA 4FMDF 5AJUA 1F2TB 1XRJA 2CJXA 3WIVA 4H6XA 4DR5B 4C0SA 2ZKLA 3WIBA 4QODA 4WNAB 5EE3A 2FSVA 5CXSA 2WSSD 1A82A 4B0PA 4NQRA 4O2LA 1KY2A 5JZ9A 1PYGA 1VPDA 5CVCA 1BWSA 4MDYA 1E2NA 2X2FA 3BHNA 1VP3A 2VCYA 4KREA 3T99A 4LMAA 5IK2D 4G5QA 3LNTA 2EF1A 1CUUA 4AWBA 1G8AA 3L8YA 4YEDA 1OY1A 2OB2A 3GD5A 1NQ5A 3ENWA 3PE3A 3W78A 3QELB 3FNFA 3ZCRA 1V96A 1V6CA 3JQAA 5NULA 1N5RA 3B5EA 4JJAA 1UIRA 3GWGA 4MVJH 2ZS8A 1UAGA 2X8BA 3N6RA 2OSVA 5IXJA 3PUYA 4EUNA 2OCBA 2QT0A 5EP3A 2VNJA 4YR9A 3H99A 4YT5A 4QG7A 4EPVA 4RSGA 4C4ZA 1Y8CA 5BUQA 2W6MA 5EZ6B 2NW6A 4QPDA 5KU7A 3NEAA 2J3IA 2OM2A 2QAGC 2WWWA 4IJ5A 2HHAA 1V1MA 6YASA 1P7ZA 1CDEA 4EX7A 3Q7TA 1GNPA 1R1DA 2GETA 4MK4A 1PEKE 2D74A 3F6RA 4WCDA 3SFTA 4YT8A 5TQ0B 5BQ3A 1LX7A 2FJPA 1SBZA 1MIOB 2QAGA 2GD0A 4UTRA 1BYUA 5JU6A 1T2VA 1ULTA 2WHQA 3VZQA 4N12A 4ZI5A 2X2PA 4QATA 5HPYB 2HNKA 1KSJA 4AJKA 5D1NA 5KUTA 3P2KA 1VHJA 4K1XA 4GS5A 1NN3A 1JVBA 4UZFA 1ZOSA 2A92A 1AKWA 4MRSA 1K75A 1HNWB 2VF2A 2W6ZA 2XCQA 2W4IA 4ZOAA 4R8SA 3RWOA 2V8OA 5DRTA 2V5UA 3U48A 3BIJA 1RM3A 1EM8A 3M70A 3OZFA 2FW0A 1G18A 3DPSA 3B6JA 3FFBA 2W7TA 3RVMA 2ZBFA 4QT0A 1OMOA 2XGSA 1BGWA 3WNCA 3NHJA 2VP2A 3I8OA 4FW9A 3KDPA 4V0MA 2H3HA 5KVVA 1JLKA 2HUPA 3C43A 4CR6A 5KJ1A 1G20B 3EEBA 3NBQA 5FORA 2PMFA 4ISBA 3DB1A 1N5LA 1QGDA 4C08A 1MPXA 4HC4A 3EVFA 3HY6A 3DBOB 4FR2A 5ALLA 4E70A 4AZVA 2CHFA 3NUQA 3K6SA 4OBWA 2RHOA 4MWSA 3X1WA 1GRQA 1NJ6A 1YBFA 3A25A 4HAUA 1F14A 3OO1A 2YXBA 1OFUX 2C92A 2MCFA 3JYOA 3SNHA 3JYPA 5GZ6A 1M34B 2PZLA 1LBSA 3IDSA 1RI5A 4N3NA 1NBME 3IOEA 4FDLA 1QCCA 3AUJB 2PX2A 5EPEA 2EHDA 3SS8A 4AP5A 2L69A 4LK2A 2YKGA 1ZMOA 4OPMA 1P19A 3CYFA 4PSVA 4WVLA 1JDPA 2GFHA 1L4KA 3JWJA 3ANLA 4MUKA 2WF8A 1HO3A 3D8HA 4KO1S 1ZHHA 2P41A 1L0BA 3CQ9A 4PYMA 4QJ3A 3E9RA 5EMJA 2H2HA 1T9BA 5IHPA 1CE8B 5TF4A 2WDZA 5JUWA 1QV6A 1CIJA 2FXVA 4M3NA 3A31A 5AD1A 1I9CA 1E1MA 2CKMA 2P9ZA 1U80A 1C3OA 1U7XA 2CFSA 1TIBA 3EIUA 3WRXA 4R7GA 5B1DA 2UYOA 4U1RA 3EB9A 4URZR 4TMKA 4PYLA 3FKSD 1N4DA 3GRYA 3L0SA 4RJIA 5HDBB 3THSA 4EVQA 5JZSA 2NU7A 5JHGB 1THGA 1F06A 2O8BA 3ABSB 1HL7A 3I9FA 2VDQB 1VA4A 2H4WA 2QPOA 3AEUB 1K6EA 3JAWB 1O0CA 1K27A 3LVQE 2J5QA 4Y1FA 2V58A 2OCKA 1G41A 5G0SA 1YL6A 5HF8A 5E38A 5DM1A 4B40A 1JJIA 2EAUA 3BXOA 3LQYA 2PZGA 2D7JA 1K7XB 3BHMA 3MPOA 2FWIA 5L4SA 3NIFB 2FEWB 4NG4A 2FX3A 3IAEA 1KEEB 4X8OA 2EG5A 3UUFA 4XVHA 4XYBA 3UPDA 2O7SA 3M3PA 1U11A 3VU9A 5ER9A 1FZQA 4BNDB 4Q4AA 4DV4B 1Q0PA 4DMCA 2Z6UA 2D0IA 1CVIA 2VP4A 2YXDA 4H15A 1XPOA 2WIDA 1VZ2A 4EJSB 3TUZC 3N2KB 3OA0A 1K06A 3IP6A 3VGJA 1QOPB 1N9GA 2IC5A 2ISQA 2JFUA 4XDYA 1PJ8A 2CHVA 1Z5ZA 4GBMA 2IPOA 3HDVA 2IQ5A 4IUYA 1KDYA 1I51A 1BXKA 1L4YA 4R71A 2HA7A 3SK0A 2ZULA 4ES6A 1Y3DE 5AXDA 5HKLA 3REFA 3PGKA 2P77A 1P7YA 2CL5A 2P2NA 5KWIA 4AJOA 4WH0A 1GKIA 1AKYA 1AT1A 2V74B 5JTUA 3LHIA 3RRZA 2Q1WA 4DMKA 2PZJA 2YJNA 3FRIA 4YYZA 1K66A 1GTJ1 2WR8A 4MX8A 1VMDA 1WXQA 3D0OA 4UE3S 4FFBA 3UV7A 1BJTA 1MQ8B 3DCYA 1GFSA 3COVA 4RF3A 5FR1A 4C4XA 5F35A 3SXJA 1ZU5A 1AKEA 5CNJA 3RS9A 1YQDA 4CFYA 1DRJA 5SICE 1FUUA 2Q6VA 2P5YA 2QRMA 1U02A 1I33A 4F56A 1T5IA 1VQ1A 3AC0A 4BMXA 4CKCA 5ALJA 1IY9A 3U49A 1GGFA 1R00A 4KMSA 4YHBA 3WJ1A 3QUBA 3ZHVA 3ESZA 1Y48E 5TQJA 1VHWA 2HPVA 2XAUA 4KO8A 4CM3A 3OHSX 5I9SA 2GSWA 3UJPA 3GFTA 4QOFA 1YTLA 2IZ0A 1J90A 3LUDA 5DBFA 3ZNPA 1ESCA 5HS4A 5JQWA 1N57A 2EXXA 1UBHS 3FGOA 3L0YA 4ITUA 5IVDA 3V46A 5LVAA 1VKZA 1XLUA 2QRGA 1ND5A 1ULSA 4L7VA 3MXOA 3HCOA 2DQSA 2R79A 5EESA 4DANA 3RU3A 4GFDA 1GR0A 1UOQA 2IKSA 4A2CA 4RJJA 1PJRA 3QVWA 5AUOB 3HDJA 4JBLA 1T8UA 1P4AA 4GQBA 3AF3A 2UUPA 1R6TA 4W1SA 1W52X 2FDXA 2OFFA 1PP4A 3PG5A 4OQDA 2I55A 2RD2A 2A14A 2XKBA 1ZHFA 1QYIA 1HE4A 1XVUA 1QGUB 4QGAA 2FMUA 3CBQA 3C39A 5ICFA 4DC0A 4OXXA 5B7GA 1X42A 5EJ9A 4S2UA 3T61A 3O21A 1WZEA 4WA7A 1EG7A 3CKYA 3IJPA 4RBNA 3NIDB 2BKEA 4MINA 4GLFA 1LLDA 3QXHA 1BS9A 1MVOA 3S68A 3BJEA 3EMBA 2PH5A 5JD6A 5IJ0A 3ROFA 4NK4A 2O2IA 1SFRA 2FFQA 4IRXA 1F8GA 1Q1NA 1QH8B 1WEHA 2C54A 3QXXA 5JVDB 3TUIC 4D1YA 1ULHA 2C61A 2OZPA 4RLHA 4DUZB 3O8QA 2ZIGA 1R6DA 3OWHA 5HOEA 4EYGA 3CUVA 3MT0A 5KJFA 1E9DA 4L5CA 1SCUB 5G4LA 4A0GA 2HW8A 1IYZA 2BN4A 3CVOA 4I5GA 3FYCA 2A1IA 2QSUA 5A9SA 3KZXA 4R2WA 3KL4A 4MW1A 1FDOA 4ZQFA 4MW6A 5FI5A 3IE2A 2HKIA 2QK4A 3T8YA 1LQTA 4JVOA 5G4KB 3NO4A 2R5WA 1Y33E 4XYMA 5EE5B 4C04A 3AERB 4RX1A 3T9DA 4EF5A 1D4OA 5CFMA 5JC8A 2CT8A 2YC2C 5JANA 1TAUA 2AE2A 3M0EA 4FP9A 1ADYA 1NJ8A 5K0LA 3DEJA 1OBVA 2GAOA 1NDQA 1QFYA 5FUQA 5HIAA 1QTRA 3FUCA 5LXTB 2Q9UA 4UUOA 5CLHA 1R3UA 2H5JA 1L5MA 4KGDA 1BYIA 4UM5A 2X22A 1PR3A 3FZQA 2GKSA 1CIPA 1U4OA 4M53A 5H70A 2XE6A 4AJ4A 3D2AA 4GNRA 2RGUA 2OVBA 5I4CA 3TGLA 2ISCA 2IBMA 1T5TA 4QNRA 4MDFA 3TQSA 1UZMA 4BBZA 1HDOA 5E7IA 3G0HA 2HRCA 3OPVA 1J5EB 2ZZMA 2BP7A 2WJ3A 2ZUUA 3OESA 3UV3A 3KT8A 5CUQA 3ZJYA 1MAAA 4RSMA 3TTXA 4OHVA 2LW7A 1JIIA 5DNYB 2PUDA 2AQHA 4CMKA 1OT5A 3BB4A 3G2LA 1G2OA 1TRKA 4H3KB 3OX3A 4GD3Q 3V2UA 4ENTA 4OP3A 2BGNA 3MM4A 4I9NA 4MUAA 4Q7EA 3NASA 2XDWA 4XGNA 4BIMA 1PTJC 4X60A 5ELXA 1NY5A 3FRHA 3RUPA 1FFXB 1N5MA 4JKOA 3M9WA 1J0CA 4IHJF 2FWRA 4LHSA 4EGJA 4MGEA 1OYYA 3K4QA 1MOPA 1TLFA 1QAOA 3GLHE 3H5WA 3LY5A 3R5JA 3GW8A 3UWKA 3K0HA 2ENUA 3ZV7A 1HE3A 4MQEA 5I4IA 1DP4A 4L5AA 4PM4A 4PX3A 1UJCA 5KDDA 3FSGA 1Q91A 4FNAA 5AKXA 4G0WA 4RXUA 3VX3A 4ZJYA 5LIPA 2X5JO 4DB4A 2O8CB 3KYCA 2IF2A 5IT9A 2ZSFA 2ATIA 2O2DA 5JE8A 2QN7A 1E2JA 1B14A 4YGXB 4AFNA 1A96A 1DLJA 1UT6A 1XU7A 4BP3A 2F1RA 1VSVA 1WV0A 2RI6A 4UU8A 1A7KA 1KQNA 4GMXA 4F9FA 3NVKI 4EMUA 2ZDGA 4ZVVA 1V2HE 2FRDA 2QM0A 3HY4A 4OLFA 3WK5A 5B7QA 1F0PA 3O95A 2G40A 2Q5EA 2W6NA 3H9BA 1FU7A 3OOWA 3PQ2A 4X85A 3VYTB 5ABPA 5FFMA 4X66B 4NPHA 5B3KA 1H0HA 2BIFA 2AG8A 1T9GR 4LHVA 4KJZA 4KQWA 4PWZA 1H2XA 3EXHB 1G8YA 2XUQA 3L8CA 5F3WB 1TM1E 1IY8A 2JGFA 1SQFA 5EZYB 3IOCA 2OZEA 5D5HA 5LP6C 1C8KA 3V97A 1LLCA 3ESQA 1TOAA 2VJOA 3ONEA 3QVKA 2P67A 1TVMA 3U3OA 1MC8A 3THXB 2CJPA 1KY3A 5BR1A 5JCOA 5LP6A 2HRDA 4FLEA 3IUQA 5DISB 4D8UA 2H4FA 1YQXA 3VR5D 1MA0A 3SHQA 1ZM2A 1ZITA 1OXUA 5F9FA 3CRZA 4MUIA 1B8UA 1OWOA 4PZAA 3D0QA 1V3TA 1CY1A 2CFIA 4HHEA 2FLVA 3DZJA 4INPA 3WMRA 2C04A 2FSFA 2H7VA 3HUUA 4ER3A 1MT3A 3CLSC 1SHZA 5KYYB 2R8ZA 4J9UE 4K9NA 4RKFA 2V0GA 4DR6B 3P97A 3RFCA 1IL0A 3BEDA 3T1NA 4EX6A 5JATA 2WHRA 5KTYA 1YVPA 1TB4A 2X3UA 3GEMA 5TS3A 4R1MA 2J9GA 1SKYB 2CK3D 4RLQA 3ETCA 3NTUA 3PNPA 4E0BA 2YWDA 2P9YA 4TS4A 4PXAA 1YOVA 2X0NA 3HJRA 3RCBA 3UHJA 1KJNA 4TTJA 4FMCB 3RI3A 5AFSA 1T25A 2G0NA 3HCCA 3CEHA 3UHFA 5BWOA 3R7LA 3WDSA 2Y1WA 4UATA 1CZUA 1MN6A 2EZTA 3O93A 4IFEA 5JSZA 1JR4A 1UPTA 3FVVA 3ICOA 4BLVA 5A5EA 1SCIA 3VBEA 1D1QA 1A04A 1LJUA 2XYVA 1ZM7A 3DCJA 3RS2A 4CJXA 5JNUA 5D2CA 1OVGA 1U8FO 3NC0C 3ZWVA 3ZY4A 5L4NA 1R9NA 2AOTA 4B4VA 3O5AA 1GTVA 2RHLA 1CVLA 3QEBZ 1T6ZA 1YDWA 2JDID 4NMMA 1K7EB 4BO3A 2CUKA 4TTRA 5IKXA 3WOHA 1ZRNA 3RS3A 2CXHA 5AK4A 4ZYXA 5JJBA 2IYLD 4Q1EA 1WPGA 4E2FA 4YPOA 5FWDA 4ZWNA 2JLUA 3Q1LA 5DWQA 1T3LA 5GOZA 1KOGA 3R4VA 2WRZA 2IXAA 4Q1BA 2ZT8A 2CMKA 5CCDA 2YV4A 3IAS6 2GUGA 3GOHA 2BJHA 1X86B 3TGWA 3WO0A 5JH7A 2XADA 3CPHA 3NS7A 4KNVA 3NR2A 5AKIA 2REQB 1VRVA 1RI2A 4N7RA 4TTTS 2AOVA 1JR3D 2HAEA 2P9BA 3VQTA 1ZR4A 3KSBC 1P1BA 3TLXA 4G5SA 5JI3E 5K0GA 5EINA 1LQ2A 5YASA 4XVCA 3MWEB 4NXNB 4Y6RA 3TUJC 2NSLA 4OOEA 121PA 4F5DA 1QKIA 2X1HA 2II6A 2DPLA 3L7MA 4KYIB 1E98A 3AUAA 3H65A 5B6PA 5IM4A 4AQ7A 3UJHA 2OUKA 4I9GA 4LDNA 1REQA 1O95A 2VRCD 4G37A 3RPEA 4QELA 5KAPA 5MF6A 4TT8A 4JFAA 1F2UB 1Z6PA 1QAQA 4JLBA 3EGVA 4HDRB 1THZA 4KLRA 2I0FA 4OK5A 5CEEA 2HIHA 2ZRHA 3RO7A 2EFYA 2GDZA 3OMXA 1E2BA 1USVA 4Q7LA 2VP5A 3LV8A 4FWTA 2GJAA 3PTZA 2C88A 4GC5A 3T7CA 4MVJA 1RLIA 4UEQA 3SYLA 1B2LA 4AI6A 2LDXA 5L9AA 2JLRA 4KJXA 1N5KA 2O3SA 3A7DA 1VCOA 1HA3A 1L5FA 1V7QA 2A84A 4WLEA 1M2VB 3A2MA 2OAEA 3FN4A 4JJ6A 5B5SA 5JV5A 4J3JA 1SCBA 1IULA 1ESZA 1TM3E 2G36A 2GFIA 4NLLA 2OXIA 2XA2A 4XGRA 2PX3A 3AVVA 5CLFA 3PWZA 2VSYA 1SVIA 4IEEA 4LV5B 2C2YA 2D5CA 1N3LA 1VSQA 2IUSA 4NBVA 5K51A 1N9KA 2ZTUA 3WSTA 1QO0A 3KB1A 5IULC 4ZOEA 1DAIA 1P91A 1U28C 1E63A 3IUMA 1E0JA 4YJFA 2PRSA 5AVKA 2Q5IA 3GEIA 3ZHYA 1Y7LA 3WAKA 1YS2X 3CGGA 1O4WA 3SXPA 4D7AA 1U28A 4LJYA 3AGQA 5IP5A 4QBFA 3VSDA 3ZBQA 1WJGA 3WNDA 3FPJA 3KOZA 4NP6A 1QJCA 4OHRA 3NETA 4ZZ3A 1Y6FA 2IEDA 2PZMA 1G0OA 1RJGA 2OMKA 5GJCA 1ECBA 2A7QA 3PGMA 3QY9A 4B46A 1CUEA 1DIAA 3ANNA 3AFHA 3AHFA 5IYZB 2XZOA 1Z7BA 1DRUA 4LZAA 2QGNA 1ZN2A 3T7EA 3AF6A 2Q9BA 2Y1FA 5CR9A 2IFTA 2W6QA 3T7KA 4D96A 5ICEA 3ERCA 4TXMA 3TG2A 3ECAA 5T3YA 2G9UA 1MFZA 4TT3A 4UVIA 1LJLA 2IPMA 2V9CA 4MPTA 4GPIB 1QG6A 3K8YA 3H1EA 4KH0A 1MAVA 4YACA 4BYGA 1T6YA 4JC4A 4UD2A 5WRFA 3BWDD 5MGBA 1GAQA 4OQ4A 5A7GA 3GUYA 3DL4A 2X41A 4MZDA 4CF6A 5F21A 3OOSA 4EHJA 1MPTA 1QGAA 3GVHA 3HJHA 3KHTA 2GYWA 2G6TA 1GWNA 1TUEA 3N0VA 1FDWA 1E79D 2YZGA 4L75A 1VJRA 4PCUA 4GBJA 3TJMA 3V2IA 3LE8A 3A04A 1GTG1 1C9KA 3SE0A 5A2QA 1K8ZB 1VZ3A 2I3DA 4KX3A 3ESXA 1G5IA 2NADA 4Q3BA 1N1MA 3RSCA 4JL6A 4XJSA 3D2CA 3BS4A 4PYKA 4RY8A 3ZU4A 4YRMA 2YBEA 3NRJA 4LOAA 2PANA 5CB0A 3HP7A 2VO1A 4U9HS 5EJ6A 3OLCX 3R20A 3SYMA 2VQDA 3X0DA 4PSCA 5K09A 4B1FA 2XB2A 1QP8A 2EW8A 3DYIA 4IZOA 4HQ6A 4G8JA 3TRJA 3KKOA 5JDCC 4ZAZA 4JBXA 4ZYLA 2ZSEA 2R3SA 4PCVA 1NDUA 3I9OA 4RH0A 3RSGA 3SXUB 4F84A 1LKZA 3TAXA 2R25B 1Y3BE 3V4LA 4W6QA 1TYAE 3PHGA 4POOA 1ONBA 3FLAA 5BSTA 3JQBC 4I1SA 1ZD9A 2EW2A 3RNLA 1Z83A 2G9ZA 4TV9B 1DC3A 5FFNA 1C4XA 3RTGA 5BN3A 3IKTA 4QFDA 4DYHA 2EV9A 4M9UA 2AMFA 4DYVA 3O84A 3JQBA 5FV4A 4QM7A 5BSHA 4BUZA 1N2OA 2C7GA 2A5DA 1M67A 2JI4A 1VE5A 4LXXA 2XVYA 1E4VA 1OX5A 4RGVA 2XUJA 3DQZA 2ZRAA 4PXYA 3DVRX 3ESDA 4IDFA 1YIDA 2FPIB 5EIEA 4RM3A 3D8SA 2SCUA 1EWVA 3OE7D 3RRNA 3WA7A 4C78A 4EKYA 2ZRLA 1XD2B 4ISCA 3C98A 3U5ZB 3GCDA 4L0MA 1R6XA 1D0IA 2DM6A 2Q6OA 4XFJA 1EZZA 5SYNA 2F59A 3WRWA 1VLLA 4L5IA 1KS2A 2VDMB 1HKUA 4B6QA 2XA9A 1QO9A 1ZD3A 1X7XA 1ZPDA 2ZIVB 4AUKA 4EZBA 3EEFA 2G06A 1G98A 4FEEA 5AK6A 1GUYA 1PFKA 2QRJA 1JHQA 3TX2A 1XVTA 3KTOA 3HL4A 3OMWA 4ROSA 2I80A 4IH9A 1BKSB 2P6UA 3B6IA 1RPJA 2LRHA 2H7XA 3K4PA 3KR9A 3ITEA 2BDUA 1OV6A 3VJLA 2C4MA 1PK8A 4KQCA 3BTUA 3RREA 3OICA 1JJ7A 2QEQA 3F5MA 4QUGA 4D9HA 4OM8A 3O8CA 4DIEA 4JBWA 3DVAB 3IELA 3ORSA 4W4TA 4DEVA 2CE7A 3H7AA 1ZG3A 4RTMA 3V4RA 3NHSA 2G76A 2UYGA 3QV1A 4N1AA 4NPAA 4DF3A 2HHLA 1W4LA 2PD3A 3HEAA 4C7VA 1HZZC 1BC5A 3RAJA 4PYOA 2HCBA 3A9CA 3IIIA 3TR6A 4C7OA 2AV6A 2P9GA 3C7TA 4BFSA 1R6VA 4YO7A 1RRKA 2HMTA 4HEHA 4F72A 3JQFC 3OJLA 2P1ZA 2A6PA 1Z35A 1HZZA 3ETLA 3X2EA 1PJCA 4I14A 4NKRA 1ZNXA 3OJFA 1KARA 3LVFO 4PQRA 3UK7A 1OWNA 3LUHA 2FWNA 5D3MA 2QIOA 1QF9A 4UZSA 1XRSB 1XR3A 3DAPA 4FCCA 4FMDB 3S5JA 5E6SB 4LBYA 4IX1A 2BM8A 1FJXA 2FFAA 4GPEA 2I22A 4UEOA 3WLQA 4B4WA 3OZXA 3BIWA 1FW8A 5ALUA 3C3AA 4F4JA 2H2WA 1T91A 1CY2A 1UT8A 1CUWA 4PRYA 1PFVA 3RFTA 3MJTA 3TRDA 4QYIB 4WLUA 1EFHA 2D5IA 3L4BC 4N9WA 4UMVA 1Y34E 2RI0A 4HN4B 4BEBA 1RLJA 4EM6A 3OQOA 2ZBPA 1K6IA 3P5BA 4MRRA 4JXZA 1QMGA 2H07A 2OAGA 5C5IA 4TMVA 3RC9A 1HLFA 2O3QA 2DT5A 2OBYA 2XXBA 4NYMQ 2HBRA 4BZPA 4UPEA 5ARCA 4YWHA 4AMYA 3IFSA 3K0AB 1H4VB 1Q77A 2PA0A 4GYWA 4RPLA 1QWSA 1YI0A 1PV4A 1MO3A 3FWZA 2DUUA 1DOZA 2FB9A 1HH4A 3QV2A 3MCZA 3KD3A 4BNMA 3F67A 3PR2B 2L2QA 2AN9A 5DX0A 1G4UR 5KYUB 3ROKA 4C0BA 2IUEA 1PRYA 4LYHA 2UVQA 3SS9X 2OLJA 3ZWNA 4FZ3A 4YT2A 4MARA 4TN5A 2WBLC 4AN4A 1G0NA 2W22A 4Q5IA 3RJ5A 3CZCA 4MYSA 2BDTA 4BECA 3QWAA 3CH7A 2OXRA 1Q1AA 2IXBA 2W2LA 3HA3A 4A6XA 4ZKDA 3NAQA 4Q0MA 4B43A 4S2EA 4TS9A 1PQPA 2H92A 3NJRA 5KX5A 2VQEB 3KLMX 4YALA 4M1QA 3CUTA 2JGLA 3L07A 3AR3A 1TFUA 3ZKAA 1B43A 1L8LA 3W7AA 5G41A 1ID1A 2BKVA 4RIIA 5LLTA 4Z4IA 4YCLA 5B7NA 4D4HA 3DMTC 1JAIA 2QX4A 3EAGA 3L8EA 4U2EA 3S1SA 1KIMA 1SVWA 2XY4A 3GU3A 4HVCA 2VDWB 1NQUA 1BJKA 4FZVA 4TMTA 1Y82A 3DMTA 2XMZA 1T10A 4XCQA 4Q9JA 1P4SA 4XE5A 5A4MS 3OOEA 3NHUA 3QEMB 4NVRA 4B7AA 1T5OA 1FZTA 3ZS8A 2ECFA 2ZE7A 1V1JA 2JA2A 3R8CA 4B48A 1X1BA 3SKVA 3DZKA 1TA4A 4EY4A 5BMOA 5AIAA 3GGDA 5IT5A 3I9KA 1XZEA 1SKUA 1UMKA 3AB8A 3UAZA 4MQBA 2ZE8A 1E9SA 1Q2XA 1MW8X 2VLBA 1ONPA 1Z7YA 4ZT5A 1SVSA 1E0DA 3GHHA 3MCUA 1GFZA 3VVBA 1L4HA 4HDKA 2JAQA 2RBKA 3E1GA 4MAAA 1UP4A 1XMSA 3LLUA 5TSDA 5BORA 2WI8A 1RBYA 2PKYX 4U7DA 4TQAA 1SELA 3R9IA 3KDAA 3VPDA 3BE8A 5CDUA 4OQZA 1ES9A 2YMLA 4OGWA 1CRZA 1N77A 5AP9A 2X4IA 5EJ5A 3GOQA 1VJGA 2JFQA 1CLEA 3H5RA 3UHPA 1VPTA 4R1NA 2Q8PA 5E8JA 4NZZA 3EHEA 1NXXA 1OIVA 3D1VA 4RD6A 1SA0A 4XEUA 3ND5A 3O0TA 1E6UA 2J87A 4ARZB 4HWOA 5J2UF 2O5EA 2H1CA 2H65A 3FG9A 3W2TA 1C1DA 4DV7B 1V4BA 1CZOA 1E9AA 3N76A 2V7VA 4IQ4A 3GWZA 1KZ7B 2ZB3A 4QBTA 3MQFA 4BZWA 4ZEVA 3HVJA 3JALB 4BJ6A 2ZSDA 5LNK1 4MRAA 4RORA 2VSOA 4J1NA 4BWGA 1IEXA 4DCCA 3ITDA 2DR3A 2R47A 1OASA 1OLSA 2W37A 2BLNA 3ZZ1A 2WYHA 3OQBA 1O5IA 3NP9A 3QA9A 4GT1A 4JP1A 1ULBA 1N2EA 3DEKA 5LKRA 2ZRGA 3KVYA 3Q9LA 4MOWA 3RRYA 1ELOA 2CJWB 4FDAA 5LYJF 1EGQA 1U9IA 3PC7A 2P2DA 4PFQA 2I3GA 3R3XA 4IJMA 4CLDA 4JI4B 4Z7JA 1KYWA 3GDOA 4MH0R 3ADPA 2E5WA 1G6HA 2PUVA 3HDYA 3LNCA 1DUSA 1NVGA 2DY0A 2HPZA 1TZ2A 1GNQA 1NRXA 1G8SA 3O38A 4Q02A 3W90A 5K03A 3BDAA 1YBHA 1QHHA 1XDUA 2P7HA 3CZAA 1GYQA 3IYLW 3IESA 1RVDA 3IV9A 1ADBA 2GEBA 3CRRA 1UWKA 4EG1A 2OBNA 4Z3KA 3SBEA 3VC7A 2A1UB 2IYPA 1C4OA 2QROA 4JODA 4OMCA 4DIBA 3CRQA 1FL9A 2ATCA 4NBTA 1EA5A 1MIHA 3ZK8A 2BEWA 5JJLA 3B1ZA 3FDZA 4QRHA 4WD3A 5EMLA 5CK4A 5JMPA 4WZZA 5G3ZA 5EEHA 1UBMS 1JF8A 2JF0A 1Y0BA 4XAQA 1I2MA 4PPNA 4QC2A 4M8NE 1U7OA 4I55B 1SZDA 2R96A 4W1RA 3V7NA 7ADHA 1L5HB 3DTVA 3PDHA 1LLFA 5B7PA 2GHQA 3QQ5A 4GSYA 1Z8DA 3OX4A 2GPYA 4C7BA 1QQ6A 1IN4A 5K3DA 3GRRA 2ZRBA 3OA2A 1KL7A 2IJGX 5CX1A 3T3PB 5E6UB 2JLBA 4NJOA 1S5PA 3IDQA 1ZH2A 4EG3A 1P17A 2CDNA 1FY2A 2ZTSA 4NFHA 4DG5A 3ZE9A 4IQGA 1KYTA 2JFBA 3CZPA 3NANA 4XOIA 3TVTA 1QDEA 4BLRA 3WRYA 4B6FA 1T24A 4I46A 1QHIA 4N65A 2BFFB 1C80A 4H1VA 3UATA 3KZOA 3S6JA 3GP5A 1PKXA 5KC9A 2R1TA 1JDNA 1PL8A 3TIXB 3DEHA 1II0A 4OGLA 4BV8A 2Q3EA 5KI6A 4F8JA 2VWQA 1ZI9A 4K40A 4U6NA 3EXEA 1N0HA 5AJVB 1P39A 3FLBA 1YZQA 3F8WA 3HA2A 2HWXA 1C8BA 3N2NA 3OZWA 4JLMA 4JSRA 4YUZA 2IIQA 4HAZA 3BPSA 4Q4HB 5EXDA 2VTBA 3COYA 3X1ZA 5K99A 2WUEA 5I7HA 2NAFA 3EPHA 5TR9A 3JWGA 3RT9A 4Z4FA 1U1GA 3JVIA 4PX9A 5IVKA 2HTFA 1QK5A 4A8JA 2CXXA 1DHTA 3FDJA 3KJIA 3B9PA 5THKA 4NCHA 4NABA 3WHIA 3S1LA 3U3RA 4GKJB 1MG5A 2P5UA 2W4MA 2XBUA 3MF4A 3ZU6A 4X3CA 3L5OA 4NJEA 5K0CA 4OI1A 4H0CA 1TEVA 2DCUA 4FSXA 1U1CA 4F5WA 4R0VA 1T2DA 4EZIA 3RRJA 3Q98A 4L9SA 1XHLA 2X77A 1A9TA 1Q0LA 2O8NA 3CURA 4PINA 1ZH0A 3SHTA 4R9SA 1A8SA 3R9XB 2W9XA 2BSAA 1UT5A 1IUNA 3GFVA 4PFSA 4XPIB 1MRZA 3F6YA 1S7GA 2HF2A 3E61A 1ISIA 1KJQA 1KE1A 1GN9A 4BFCA 2ZJ8A 3GRFA 3AJ9A 4MZXA 4J16A 3MMSA 4H4CA 3M9LA 5J4LA 4G01B 4QTZA 5KQSA 3PGLA 1SHTX 3HFGA 4EEZA 3LC1O 1VB3A 2H52A 2ZJ2A 3EDCA 4P1ZA 1NIJA 1U7PA 3N6VA 1FTNA 4E5SA 1B1CA 4MPJA 5D85A 3WGQA 3SR4A 3NC1C 4IXMA 4UVGA 4Y6OA 4B9AA 3EIQA 4C5BA 1KI2A 2IUFA 2Z4RA 5H02A 4BJHB 3HNRA 4DTIA 1CQIB 1F1BA 5IVHA 2QTAA 2BFOA 2C2WA 2V3CC 1V7ZA 1E64A 2OP0A 3B78A 1G5PA 1W96A 3EQZA 3IDOA 4ND3A 4P0QB 1XPJA 2DBZA 2XHEA 1NN0A 2J3JA 4YXWD 5KSYA 1DAGA 4O08A 1T2EA 2FMXA 1E3EA 4X45A 2KE5A 3R7NA 3WNVA 3KTDA 1ML3A 2LUOA 1KFKB 3AUSA 3PIIA 4DG9A 4TTVA 2VPIA 2BR5A 2ZR8A 4O2BF 5CTAA 4A7PA 1UXIA 5E2AA 2YJ3A 1S2OA 4BP1A 1CF4A 3H4IA 1L1RA 3KEQA 1EPUA 4DR3B 1H69A 1N32B 4MWOA 2EFCB 3IKJA 1N3IA 1UKYA 1XALA 4LMPA 3SJUA 4YJ2A 3ZV3A 2X5XA 3KKNA 2PGXA 2SNIE 3M82A 3W79A 1QANA 4JL8A 4BVLA 1WMAA 2BM0A 4IHJB 3GIWA 3RUCA 4CZ2A 4DT1B 1AQIA 1ESEA 4C5AA 10MHA 4ZJZA 1OWPA 5KYWB 4OX9Y 1XMIA 3FHTA 1H2RS 4H3SA 2RKOA 4J9VA 4IIFA 2WB2A 5EKSA 3SJAA 5I6DA 1FTWA 5CA1F 4IDCA 2QRUA 4H4EA 4MYTA 3LBNA 3E22B 4B0OA 2XZTA 2XQGA 5SZHB 1H5NA 4OHOA 4BMZA 1E1DA 2OHIA 1A88A 3HH8A 2P4UA 2ZDQA 2ZSUA 1L8QA 1IONA 3RTEA 5LQMA 5B4TA 5DF1A 2BEVA 4DRXB 5J58A 3G6WA 3PUVA 1SXJC 3GYGA 5ALDA 4EELA 1QV9A 1MB4A 5JCZA 5ALIA 4FVTA 3QU7A 3DV2A 3GFGA 1KI8A 1KSGA 3RSQA 4RJ2A 1Z0AA 3A58B 3WGIA 1PR4A 3A1VA 4GXTA 3NTVA 3STYA 3F90A