2RGDA

Crystal structure of h-rasq61l-gppnhp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGLEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transformation Efficiency of RasQ61 Mutants Linked to Structural Features of the Switch Regions in the Presence of Raf.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
molecule keywords GTPase HRas
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rgdA00
2PBRA 4G5RA 1II9A 2W83A 2NGRA 4JLBA 2ZIAA 1VCNA 4ZDKA 3C4JA 3M6AA 2OM2A 5CLQA 3WP0A 2ZRHA 1JR3E 2MSCB 5FTMA 2QMHA 4JKYA 4URUR 4DJTA 3KJIA 2O8EA 2D74A 2CHVA 4GZLA 3X1XA 3I5YA 1AN0A 2QTHA 5LD2B 2RCNA 1N6KA 1P9RA 3CWQA 3ZS8A 4Q66C 1KI4A 1Q3TA 3K70D 3Q5DA 2BCJQ 2HXSA 2VBCA 1SKYE 3I1FA 1TQ2A 1KYIA 4MGYR 3W8NA 3H0KA 3SE0A 4QOSA 3I4LA 2PJZA 2GNOA 4H1UA 4V02A 4DVGA 2QTFA 5FTJA 1ZD8A 2RKOA 3D8BA 1AJEA 2RGAA 3AGPA 2NZ8A 1W36C 1NIJA 3BAFA 4F91B 2XSZD 1RRGA 2FFAA 1R7RA 3TRFA 1KGDA 4TQ9A 3VR2A 1VG1A 1Z06A 3BB3A 5FOWA 1MABB 4ESHA 1FP7A 5CK4A 4V0LA 3H4MA 1NN0A 2XTNA 5TVKA 4EPXA 2QQEA 2H5EA 3IPXA 2BC9A 1VYUA 4Z8XA 4JBXA 4OQMA 3O8BA 5K8TA 2OG2A 5JJLA 2A9KA 5EZ5A 4TMVA 3KKMA 1F2TB 2IHBA 1FP6A 3K0AA 1XTSA 2YZ2A 2FMXA 3DL0A 3B7GA 4Q4HA 4DIEA 4M9QA 3AM1A 1GFIA 3F3YA 2QRZA 4TT3A 2ZJZA 2DCUA 3HPQA 1NY6A 2FA9A 1J7KA 4P0TA 2O8DB 5A4JA 5FUXA 1P6XA 4C7OB 1CS4C 2F6RA 4YXWD 4F38A 5HE9A 4ZIRA 2REOA 1WQ1R 1SXJA 1KDPA 1L7VC 3QVVA 4QBGB 4C0SA 2QZ4A 4L4UA 2KJQA 1KAOA 3TR5A 3I73A 2ZQ5A 1JEEA 3K9HA 3V9PA 2VHCA 1Q1BA 3HU3A 1U94A 1R0XA 1B23P 1RYFA 3QIAA 3T1TA 1U2RA 2MSDB 4C0BA 1HE8B 2FNAA 1P9NA 1YJ5A 4TYWA 3VX4A 4PO9A 1BH2A 5LPNA 1QHNA 3C15C 5BYJA 4ZKEA 3CF0A 3WNDA 1DS6A 4JBYA 2IYVA 3GQBA 1XTKA 4P3YA 2IYZA 4DLYA 5FPKA 4IXNA 4BFSA 5DI9A 3K0FB 1YHNA 3WNCA 3ZZTA 2A7QA 1RJ9A 3U3JA 2QTVB 4PAMA 1T8TA 1F2UB 1HA3A 1WA5A 2RMKA 3R20A 3P4XA 4NU0A 3PENA 5A0FA 4PC6A 4ZCLA 4BQSA 3SZRA 1GRRA 4CF7A 1G17A 3K0CC 3CRQA 1HUQA 2GXSA 3AKCA 3U3MA 3U7EB 4TYYA 3WBKA 1YR9A 4D0LB 2ZU0C 3JZMA 1PV4A 2NIPA 4A82A 2HLDD 2V8OA 1G64A 5JHHB 4N3NA 2QA5A 1HT2E 2CVHA 4QM6A 3DDCA 4LX0A 3FFBA 3T1VA 4XTCS 4PTLA 1JI0A 2ZI4A 3GLGB 2IEYA 2JJ2D 3MMPA 3NXSA 1XP8A 4XOIA 5EE3A 1N6RA 1Z6YA 4X8LA 1J90A 4B48A 5BQ5A 1W48A 4QBFA 2O0HA 2CXXA 2BBSA 5TB5A 5HPYB 2I1QA 4UNRA 4FCWA 5ANRB 2QM7A 4OHWA 4C30A 2ZJ5A 4PHHA 3WHLA 3HPRA 1UF9A 5FPSA 4P4SA 2C8VA 3QXHA 2H92A 4MYCA 3TW8B 3KKQA 5L8VA 2WZQA 3W3ZB 4IOKA 1KK1A 4EPVA 1NI3A 3AVYA 2GCOB 2QGNA 1Z2AA 4JSTA 3RLFA 3REFA 2R62A 4PO1A 221PA 3IBGA 2CL7X 4HB4A 4TYNA 1YR7A 3TK1A 2ZVPX 4HDCA 5TDHA 3FKSA 1L2TA 2WOOA 4D4KA 2WWYA 4B76A 1HH4A 2CCJA 5EE5B 1TMKA 2GF9A 2JJ2A 521PA 1COWA 4Z51A 1JQLB 5CJPA 2R6GA 1QHGA 2AX4A 3BH6A 3PXGA 2CVFA 2FJUA 4DLTA 4FCTA 2CCGA 1ANKA 5C4MA 2Q3FA 3MG9A 4UQOA 2P6RA 2UVQA 4O0MA 4DT1B 4NE2A 4X8HA 4GFDA 3ZQ6A 1ZNYA 1OYWA 3NDPA 2OBNA 3MWKA 1XCPA 4LBVA 2AKYA 1DAMA 2ZJ8A 1DAKA 1Z0AA 3MUFA 4PSVA 1XXHA 1ZU5A 1S9DA 1T6NA 1HTWA 4IW3B 1M2OB 3PUXA 1G7SA 1SXJE 2LKCA 3AF4A 1ZVQA 2J46A 1EWQA 4B3XA 4I4LA 3KXLA 4TL6A 2G9NA 4WXPA 1W0JD 5KNBA 5J40A 1IM2A 1R6BX 4QGAA 3NKVA 1F2UA 2WSSA 4YC7A 5DI3B 2ZUBA 1O3YA 2ERYA 1US8B 5DHFA 1AZTA 2IYLD 4IOMA 5BN5A 2IF2A 1KIMA 4BUJA 1R5OA 1IXRC 2PX0A 2OFWA 4TSFA 3RVBA 2O5VA 2VO1A 2O0JA 3ZYCA 1AKEA 2XNSA 5IT5A 2W2TA 3K0AB 5AUPB 5KSYA 3FPAA 4U00A 4WZAE 1S3SA 1Q1EA 3HYRA 4AKHA 2XZLA 2WSMA 2Z6VA 4GP6A 1G8PA 3CPHA 4Q9KA 4DLXA 5A5GA 1P75A 2EFEB 1OHHD 1PLLA 2HEIA 5JLJA 1XJ0A 5DIFA 3SYKA 4ARZB 1VG8A 5DSZA 4RY2A 3NIBA 4TN1A 4I1VA 1G3IA 2BEKA 4A0FA 5IK2D 1C9KA 3QSYA 2WV9A 4ZPXA 1XF9A 2A2ZA 3AGQA 1KI6A 3N5CA 1FX0A 2CJWA 1JB1A 3U4QA 1N0WA 3H86A 2F1HA 3B13B 1KZGB 4C7OA 2ANBA 3SS8A 1OF1A 2W58A 3RRYA 3CO5A 3L0PA 1E0JA 1KJZA 4B3CA 4EQ6A 4BRUA 1OIVA 3MJHA 4KFRA 1SVMA 2O8FB 4HAWA 4C2UA 2QMEA 4B2IA 5J4YA 4HUQA 3W8RA 1T0HB 2IW3A 1TF2A 3KL4A 5KNCA 2O8CB 5JZVA 3QVUA 4ZDJA 3B2EA 1SXJC 2KBFA 4MRPA 4C9BA 4BPBA 1BYIA 2C04A 4GSYA 2IUUA 4EPRA 1JNYA 1US8A 2ORVA 3AVUA 4A9AA 2HUPA 2C77A 4V0ME 3VHLB 1XTQA 1Z2CA 3BS4A 3KQKA 4R2IA 1E2QA 3PV0A 2GBLC 3J81k 1JJVA 1ZU4A 3L8ZA 4B6FA 5KSZA 2Q6TA 1AM4D 4Q1FA 3QI2A 1MR3F 4ESVA 1NLZA 2WJGA 3DZ8A 3TW4A 1QVAA 2A3RA 1IN6A 2PH1A 3CNNA 2QPAA 3FMIA 4HZIA 2JLZA 1XBTA 1OB5A 1GKIA 3W90A 4TMXA 3OIUA 4BFYA 1MH1A 2IC5A 3BORA 3AVVA 2KBEA 2R6AA 3CB4A 3EWAA 1ZNXA 2BV3A 3KKNA 4GP7A 2QY9A 2A5DA 2BOVA 2BDTA 1X1RA 2FN4A 3MGCA 3T1OA 2QI9C 3B82A 2AR7A 1Q3HA 2A5FA 2VP5A 5EZ6B 3OFND 2ZI6A 4FCVA 4QL3A 4WW0A 1Y3AA 2OHFA 5FPYA 4Q1DA 5C2JB 1DAHA 2B21A 2EVWX 3B8HA 3TQFA 1Z0FA 3K1JA 4IJMA 5CK5A 3N2EA 4AK9A 5H8WA 1KMHA 2J41A 2VP6A 3D3QA 2E9SA 1YR8A 4DSOA 5G41A 1G6OA 2F7SA 3QF4B 4M8NE 4YMSA 1QRAA 2HCJB 2ZANA 1SVOA 4Y0VA 3FVQA 1E2EA 2JASA 3GD7A 2FZ4A 4MKIA 2WAYA 2O8CA 4BFTA 2OXRA 2GCPA 1R10A 4TYQA 1W4BA 3RDPA 4ZDIA 3ADCA 3ICQB 3A1SA 3BFKA 1EX6A 3TGPA 2J3EA 3BB1A 1WMSA 2C95A 4ASUA 2ODBA 4HB0A 4LJYA 1CJKC 1A1VA 2EYUA 3K9NA 2R44A 1E9BA 1A2KC 5FI0B 1JQJC 4FMDB 1KJYA 3Q9LA 3A4LA 4NTZA 1AQUA 5LB2A 3GJ0A 1R0YA 4PC3A 2VYFA 1Z07A 2IXFA 3FE2A 4Q4AB 2GTPA 1S96A 4JT2A 4BASA 4CVNA 1VKJA 4FMBB 4X8MA 4TLBA 2XEXA 4NONA 4DDUA 2QE7A 4IDQA 4I1OA 1LY1A 4MGIR 2GDJA 2ECKA 3JVUA 3CZPA 4BFVA 3EA0A 3SFZA 2YWHA 3Q5EA 4C0KA 2R6FA 1CBUA 2ZUDA 1M7HA 4QRHA 4AWXA 4MKGA 1I2DA 2XJ9A 3QEJA 4JLDA 1VDZA 3MSXA 1MRSA 4ZI2A 5BW8A 1HQYE 1KI8A 1P2VA 3IPYA 1AS3A 4QJ3A 3ZGXA 1G16A 3U44A 5EUMA 2A5JA 2WWFA 3OAAD 3QY0A 4BFUA 3FHCB 3KQUA 3U44B 1KSGA 3HR8A 2JLRA 4MRNA 5CYPA 3RSLA 4TLEA 1JPNA 1ZUIA 5AWFC 4RFSA 4LUCA 1Z28A 1QG4A 3KJGA 3LD9A 3ZLJA 3U3RA 3GLHE 1BYUA 3ND9A 5KHOC 3N70A 1AS0A 2YC2C 4C3ZA 2ZYVX 1WCV1 1G7TA 4HLUC 4YONB 1SVWA 2JLSA 5GJVC 4Q9IA 1X8JA 3IHLA 2IWHA 3HU1A 4MUAA 1BIFA 1EFRD 4B73A 2WTUA 1NMZA 3RAPR 4KBFA 2AD1A 3L82B 3PJRA 3W5JA 3IGFA 2H16A 5E7IA 2QM8A 2RGEA 4JYCA 2BMEA 2W6ID 2PMDA 2ZUCA 3U6KA 1ZCBA 2Q9CA 4LJ6A 3I92A 2D4HA 1KDTA 5IRCD 1VG0B 2V55B 1KMQA 1G5RA 3TMKA 4Q18A 1RVDA 2KB0A 4IEEA 4ACBA 4MKFA 1LV7A 3UWKA 2PLFA 1KSHA 5KSPA 1XD9A 1Z83A 3QBVA 2HT1A 1YR6A 1G9XA 1RYHA 4N1AA 1ZRHA 1G1MA 4AD8A 4D82A 1VCIA 4OI0A 1BOFA 1GDDA 2O8BA 1XNJA 4BWYA 3GLHB 5EP1A 2OUKA 2QENA 3ZS9A 3DKVA 2ZITA 1WXQA 3Q3JB 2QT1A 3OEHA 3HYTA 3G0HA 1GIAA 1N6PA 2P0EA 4C4PA 5JWOA 2IF0A 1E1QA 1GKUB 1WE2A 1GL9B 3UG7A 3DPUA 4AURA 2C96A 3I3SR 2Q3HA 2HJVA 1R8SA 1H8ED 2WPDD 2VSFA 4RD6A 1NVVQ 1DAEA 1SKQA 5GJCA 1MT0A 5HR5A 3B6EA 3PITA 2D2EA 1ZIOA 2WVJA 1CKEA 2FPLA 5H70A 5BXQC 5AR1A 1YZLA 4KLZA 4DT1A 2VTKA 2BM1A 4WIAA 2ZYUX 3MAAC 3AUYA 1Q57A 1BS1A 4XSHA 3LO5A 1OW3B 1OXTA 3IEUA 2ORWA 4FXPA 3D6TB 4OK3A 3EC2A 5FOTA 1Z0JA 3QJYA 4KSCA 1ZM2A 3CWZA 1T3LA 3KB2A 4QHTA 1UFQA 4NP6A 2XAUA 3KQNA 2G0TA 2PZFA 4TT3D 3WY9A 2IUSA 1ZAKA 2HT6A 2WJVA 3K0FA 2XX3A 1VHLA 1ZC4A 3KTAB 4HAVA 2RH5A 1CEEA 2O8BB 3VKWA 3CF2A 1OH7A 3H84A 5LB4A 5KPDA 3THOA 4HUQB 4LHXA 2G1JA 3TVDA 4M53A 4PPGA 4CEHB 5HKKA 1TF7A 5KTYA 3I8XA 1TF5A 3QUSA 4OHXA 2ASEA 2O52A 2PL3A 4WZ6A 4R2HA 1OKKD 1OH5A 5KSOA 5JEEA 1FX0B 1GZSA 3UXMA 3R8CA 4RFVA 4QKQA 1GNQA 3NEJA 1IN5A 3KXIA 3KQLA 2EFHB 1OFTA 1ZC3A 1W49A 5F9FA 1AGRA 2QSZA 4P31A 1G19A 2Z5FA 3C41J 2VHQA 2REBA 1E9FA 2BMFA 2KI5A 4NH0A 4FIDA 3WYFA 3S1AB 3VQTA 1R5NA 1E9DA 4XD7D 2F3RA 3BXZA 1NJGA 3B78A 4HDQB 1WB9A 2R65A 1BKDR 1NVUQ 5EE0A 1IY2A 2QAGA 2BWJA 4F4JA 1G20E 1KI9A 1P9WA 2FFQA 1EK0A 2IYXA 2NZJA 3GJ8A 2NOAA 3WMFA 5J5CA 4G1UC 4JLVA 3O8CA 1NL3A 2QT0A 4JJZA 1OJLA 1RKBA 1XZPA 2GZHA 5DI3A 5KOYA 1Z0KA 1D2NA 4FW9A 4ZCMA 3R7WB 4X8OA 1G3UA 1OKKA 2YYZA 3SC3A 2JLWA 4ITRC 2AK2A 2HYIC 3RHFA 1P2TA 3RS4A 3FFAA 1CR2A 4PC1A 3RS3A 4B74A 4DEYA 4DB2A 4PX9A 1NP6A 3RC8A 4V0OA 2OAP1 2XNDA 2YWFA 2FOLA 4EQ6B 1FTSA 2F55A 1DG3A 5CIWA 4XWOA 3VNVA 4CEJB 2FGKA 5KNDA 1DPFA 2AHOA 4JT4A 5JRJA 1TL7C 4MITA 3OESA 1A5TA 1A4RA 1KI6B 3O8DA 4B3FX 1GTVA 5L3QA 4HLQB 4LY6A 4L9SA 1N0UA 1BO6A 1GUAA 2H1LA 2IYYA 3TKLA 1OH6A 3QKTA 4QM7A 2VQSA 6Q21A 3IO5A 4M22A 4FMCB 4PPNA 3RANA 2ODWA 5JRZA 3FOZA 1XXHE 1MOZA 1P4SA 2BMJA 1XEXA 3QKRA 2EFCB 3H2YA 5TV2A 2XITA 1AGPA 2MSEB 4DLVA 3CRRA 2YC4C 1Q12A 2ZRKA 5CB8A 1T5IA 5F9HA 2HF8A 1E1RD 5FL7D 4PHTA 5ELXA 5B57C 2WMOB 5CDFE 3AVTA 2YNMA 1G3MA 3RRMA 2OLKA 1KI1A 2GKSA 5EXXA 3WYGA 3SJCA 3R9WA 1KO1A 4KV9A 3EXAA 5E95A 4JL6A 1D5CA 3GJ4A 2F43B 1ZM7A 1II8B 1LB1B 1UM8A 4M2LA 5TY0A 4Q9JA 2ZM5A 2N42A 5FR2A 3NC1C 1M7GA 8OHMA 4OL0A 3WHKA 4LJ9A 2ZU6A 2OFOA 4RD3A 3L8YA 3VMFA 3EPHA 1X6VA 2AN9A 1CJVC 1U0JA 2CE7A 2AXNA 3T34A 1F60A 3AVOA 2ZREA 1XXHB 1TNDA 4IKEA 2P2LA 2KWIA 1DE0A 1S0UA 4MRSA 2IYSA 2DBYA 1V5WA 2Z4SA 4KVGA 5KU1A 2P5TB 2NPIA 4D80A 1F48A 1BMFA 2J1LA 2MMGA 3KKOA 1LVGA 2OE2A 4UXJA 4OHYA 4D26A 2ZRJA 1R0WA 4AYXA 4NMMA 3CPEA 3RS0A 1SKYB 2IX3A 3BFXA 1NN3A 2OBLA 2OCYC 3OE7A 2ZRBA 3AF1A 2D7DA 5JCZA 1VPLA 1P2SA 2IBMA 3AP3A 1E2PA 1GKYA 5K8LA 2QN6A 4AYWA 1HQCA 1AK2A 1LTQA 5FL3A 1U8AA 3U5ZB 4C0JA 4I99A 2H18A 3JZAA 4BLQA 3EIEA 4ZO4A 1GAJA 1UDWA 1AKYA 3FMFA 2C9OA 3FYHA 2XGJA 1YZKA 3LW7A 4QNMA 4IEIA 1KK2A 2C5LA 3T61A 2HLDA 1KK3A 3AH8A 2GEDA 1DO0A 2J5XA 3EA5A 4KVAA 4NCIA 1NBMA 4OQXA 2JLQA 2YVUA 1H65A 2FGJA 3GMTA 3LFUA 1HY3A 1FQJA 4Q19A 1KI3A 2PCJA 3ZVLA 3BRWD 1JR3A 2QAJA 4BLPA 2AL7A 1E9CA 4MYTA 2W6JA 4LZZA 2GJKA 3BFVA 3VTKA 2ZI5A 1XTRA 1SXJB 2FPKA 1W2HA 3FKSD 4GRAA 2BIFA 4MH0R 5TARA 4EAQA 1P2UA 1VIAA 1LS1A 5HCIA 3LDAA 3CBQA 2C98A 4ON9A 3K9GA 5AUOB 2ERXA 4KODA 2DY1A 4XSGA 2B6HA 1IQPA 4AYTA 1ZM4A 1DEKA 4MA4A 2Z43A 4BZXA 1NVVR 3AF2A 4LYJA 4NCNA 1CIPA 1KAGA 1S3GA 1U0HC 2B7BA 3BE4A 3LRPA 4IXMA 4JYBA 4MYUA 2J7KA 3KJHA 5FR1A 4KBGA 3GEHA 3A1TA 2ZI3A 4ABYA 1CULC 2IT1A 1PZNA 4A2QA 1IY1A 4CEIA 1XEFA 1X8KA 3WRXC 3M0EA 1R0ZA 1E2LA 4P33A 1TEXA 4CEJA 1YQTA 3MD0A 1KO8A 2AKAB 4UXIA 4LPSA 2ZEJA 3ND8A 3C5HA 3JVVA 4WVFA 421PA 1OPXA 2BCGY 3OZXA 2BBWA 1C1YA 1QHHB 1UKZA 1E94E 1UEIA 2AXPA 2GETA 2WOJA 3GP8A 3VU9A 3X1ZA 2ORIA 1PLJA 2WICA 1OE0A 3SFVA 4G3XA 3PQCA 5JJIA 2IYUA 2ZE6A 4KAXA 4KSBA 3LVRE 3M4YA 1V43A 1EFTA 3E2IA 2L0XA 2QORA 2RGNC 2XOKA 4EPYA 3NWJA 3AP1A 2OV2A 4A92A 4JLOA 3U7FB 1E9SA 3UMSA 1CXZA 2QG6A 3LWNA 2VF8A 5CDFA 2GA8A 5HCNA 3T06B 2XXAA 1SGWA 1IN7A 4NYMQ 4URVR 1E6CA 4PZZA 3IIMA 3EG5A 3QKSB 3FGNA 3QXJA 5D3MB 4QG7A 2JA1A 2GCOA 4D2IA 1R5BA 4A0RA 1GRNA 1WBBA 1K8RA 4D0NA 4NL4H 5JCPA 2DYKA 1HV8A 2HYDA 5FBRB 3I72A 3SJAA 1ZP6A 4MYHA 2QQ0A 3EPJA 3VAAA 2CL6X 2QPTA 3K0CA 4GT1A 1NN5A 2PT5A 1CRPA 4FINA 4Q1EA 1KZ7B 2DWPA 3SU8A 4E09A 1M8PA 3TSWA 1KDOA 4LV5B 3AB3A 1FMJA 1Q1QA 5JJKA 3AKEA 5LD2C 1G7RA 4D81A 3U2QA 1ZYUA 2X1VA 2JJ1A 1EFUA 2CCKA 3P20A 3GLGA 5HZHA 2YOFA 4ERNA 2XTMA 3DO6A 4ZV4A 4RZ2A 4DDTA 3TBKA 4FN5A 5DGXA 1CRQA 2CHGA 4LC0A 1W0KA 5FUVA 3IDQA 4FD2A 4IDPA 2OLJA 3SNHA 2LCFA 3HP1A 2AWNA 1D9ZA 4XWKA 2QUZA 4NZYA 2X2FA 1OFUX 3NHBA 1FZQA 2LWIA 4B33A 1VECA 1DADA 1DVRA 5KPJA 1Z0DA 3OIYA 2E87A 3W6OA 4TMZA 4ZCIA 1W1WA 3U3OA 3X1WA 2ZJBA 4RZXA 2CDNA 1NBME 2G88A 3W34A 4QNRA 1ONBA 4M9ZA 5L3VA 2DPXA 5AJXA 3GLFE 2FSIA 3UG6A 3EWSA 1AS2A 1U99A 4KITB 3QF7A 1HURA 3W3AA 4V0KA 4CIDA 1DAGA 1LNZA 2VIIA 1Q44A 4II7A 1VG9B 4E03A 4D4LA 1FOEB 3U4QB 2Q3MA 2A30A 2IS6A 1H8HA 4GI7A 1YZGA 2KE5A 5K8UA 4ZDWA 3K8YA 3KB1A 821PA 2FV8A 4MDFA 1II8A 2ZJAA 2NQ2C 4TTPA 5J4KA 3QG1A 1EFRA 4CT4B 4GOJA 2VP4A 2QROA 2VSOA 4BE7B 5JHGB 3HDTA 1DELA 1E4YA 1W5SA 4M4SA 3T5GA 4B44A 5D3MA 5FI1B 1MO5A 3WXMA 4KI0A 5FFMA 3EPLA 4B2LA 1DG1G 1FL9A 4S35A 1VCOA 3UK6A 2ZVQX 2X8AA 2QBYA 1KNQA 5B30A 3PEYA 3PFIA 2C78A 2XB2A 1WDTA 4JSYA 1G6HA 2F1RA 4EJSA 4LHYA 2BHRA 1XMJA 1G18A 1OV4A 4GOKA 4JS0A 4MGKR 1VHTA 4JVNA 4IHQA 3ADBA 2JIZA 3AUXA 4UNPA 3SHFA 2CNWD 2JDIA 2WHXA 4JLPA 2D06A 3H1TA 1AIPA 4F92B 1NSFA 1ZUHA 1DO2A 4RD1A 2BKUA 2GEVA 5SZJA 3VU9B 2PLRA 1P72A 3GCGA 2PEYA 4DSNA 4YLGA 1W0JA 4DKXA 1TEVA 2OCBA 1U81A 3LVQE 2QMUA 3BBPA 1T9HA 3CIOA 3K53A 2WWIA 5BWMA 4US1R 2V1UA 1W2GA 1ZJ6A 2RGNA 1VCMA 3I32A 4RD0A 4CZ2A 3PG5A 5JSZA 2WKPA 1CTQA 1VYVA 3RS5A 3SOPA 1TADA 2QE7D 3C14C 3QENA 4HZUB 2WAXA 4O2RA 1EG7A 3MFYA 4YMUA 1Q20A 2GVZC 4M9XA 1SVSA 4Q1AA 4UNSA 4O3MA 4HATA 4XIGS 1QDEA 2Q9AA 1E2DA 1H8EA 1CP2A 2WPDA 1XJCA 3BOSA 2SHKA 1ODFA 2AD5A 5FUYA 1GNPA 1XDBA 4UXHA 2IYWA 3GPLA 1KJWA 4KXFB 4R98A 4LYFA 3I62A 1L8QA 2Z0MA 2XB4A 4IRUB 3X1YA 4B71A 3UWOA 3L0SA 1Y63A 2ZS7A 4LJ8A 4TLDA 3EZ2A 2VP9A 4D25A 4BZPA 2P6NA 3ZH9B 5FPTA 4Q4LA 3E5HA 3R8FA 3LY5A 4TQAA 3SBEA 1JBKA 2VLIA 1PJRA 1DOAA 2O0KA 5FOXA 1U90A 1GP2A 5G53C 1XD2A 1T3SA 2AWOA 4XVUA 1JEDA 1E79A 1P61B 1E2KA 1Q22A 2BJWA 1IXSB 2GJAA 3ZVRA 5GVRA 3HU2A 2RHDA 3ZD7A 4BFWA 1J70A 3A4MA 3FB4A 5HZKA 1G21E 2X19A 1CR1A 2E1RA 3CRMA 3THYB 4GMDA 4LDJA 3TSOA 1IONA 4LPKA 1RIFA 3AF3A 1G5PA 3LAWA 4E22A 3SHWA 4OI4A 1AQYA 2IXEA 2QP4A 3ZVNA 4DRZA 2F1IA 2WJYA 2J0VA 3IEVA 1A2BA 4DSTA 2GJ9A 3ZZUA 2VF7A 4LRWA 2ZRFA 1OFHA 3ETLA 5JFGA 4FMCF 2F1JA 3ECCA 2FF7A 1OXVA 5CLLA 4F4IA 2DWOA 2A5GA 1ZD1A 5GADl 2JLXA 3K0EA 2BEJA 4TZ6A 1KMHB 5FTNA 4DCNA 2CEAA 3TAUA 4NHOA 3UKDA 3AEZA 3WMGA 2VHJA 4M1YA 1E2GA 2J7PA 1U0LA 1TTTA 4OYHA 5KDDA 4DCUA 5IDVA 5DNYB 5AJWA 2J59A 3QOFA 3MWJA 1XRJA 4Q9HA 3ZIAD 5KO2A 3B1YA 1X86B 5JS8A 5DYGA 3U7GA 4TMTA 2YWEA 2I4IA 5L3SA 3CKLA 2BVNA 1TUIA 4JJKA 4HUTA 3PEWA 3O8RA 3RSOA 4DDVA 1M74A 4H1VA 3A58B 3IQWA 4W5HA 4U7DA 5C46F 2ZI7A 1KY2A 3B1WA 1NMYA 4WOPA 1YVDA 4DLWA 3I5XA 3U60B 4TTQA 4TMKA 4OQLA 3DKPA 3FMPB 3EIQA 4EDHA 3NH6A 4QHSA 5J47A 2ZRDA 4C0AC 2GBLA 1W44A 4Q4JB 4IOLA 1RRCA 5E7MA 3K70B 4TZ0A 3VR3A 2QAGC 1IOZA 3IIKA 2QBYB 5SZIA 1TU3A 2FEMA 1Z8FA 3QE0A 1UBCA 1IJEA 3WBJA 2FE4A 1UKEA 3P4YA 3Q8XB 3VKGA 1XTJA 2REXB 1GILA 4BGDA 2VP2A 2X2EA 4XWAA 3EW9A 2ODEA 4XH9B 4JVMA 5H68A 4NKRA 2WKRA 1KO4A 4FWTA 1X1SA 1Z5ZA 2DFTA 1E0KA 4QGGA 2AK3A 4Z1MD 1ZNZA 2V54A 3WYAA 1UBEA 3TSZA 4HAXA 1E2HA 3ZQJA 2NTYC 1E0AA 2W0SA 4JZKA 1CJUC 2FZLA 2IWRA 4KFTA 1G8FA 4ASUD 4PHGA 2GVDC 4URYR 4KHZA 1GWNA 4Q7MB 1ZUNB 1NY5A 2A5YB 4LJAA 2FG5A 1XEWY 2QRNA 3QXXA 4HB3A 3NC0C 4RKFA 2BMDA 3CONA 1BMFD 4A0HA 2ZRIA 4KLNA 5LDDC 4F4CA 5CM9C 2G0NA 4RFSB 2N46A 2QP3A 5BN3A 3B5JA 1XFAA 2HJGA 2Q0HA 1VYTA 3W6PA 5EP2A 4RJLA 3V4RA 4A2PA 4DXAA 4NYIR 4MRVA 1FNNA 3BD9A 2FX3A 4OBEA 3DZDA 1Q21A 4RCYA 2W00A 2G3YA 3BH7A 4PFSA 1GNRA 1TQ4A 3BC1A 3IILA 3ZIAA 5FH9A 3PUWA 2IEZA 2ZYTX 4TLAA 2ONJA 4D6PA 2ZRMA 3SI7A 1OHHA 3C7KA 4Q7KA 4DUGD 1MV5A 2JIZD 2C03A 2YKGA 5HKKD 1OH8A 1NBMD 2J87A 1LS6A 2HV8A 3FMOB 3RC3A 2IYRA 3QG5A 4MDEA 1S2MA 4GMXA 3OF5A 3SR0A 3THXB 3SYLA 2C99A 3AVWA 1JXOA 3LLMA 4IVPA 5JEDA 4BLRA 3NG1A 4PAOA 5CJ2A 1NF3A 3E70C 3LA6A 4I81A 1Z6GA 2ZE8A 2ZSEA 5G40A 1N6NA 2V7QA 2B8TA 2FWRA 3TE6A 5D3QA 3SJBA 4B75A 5F2EA 3M1IA 4JLKA 5TMPA 4E5UA 4TLCA 2F43A 5KDLA 4U5XA 5JECA 2OBMA 4IVRA 1M34E 3DMDA 2XOKD 1I4TD 2QPOA 3F5FA 4TWZA 2D3WA 3THWA 1GSIA 4AKIA 4QFMA 2P67A 4LHVA 4WA7A 4BEJA 4NBSA 1K5DA 3ADKA 4BFXA 4KYIB 4DLSA 2XXAB 3P32A 2JAQA 3D7MA 2ZSAA 3X2SA 1UBFA 1W7AA 1YZNA 4Q47A 3W9YA 1I4LD 2WM9B 1J2JA 2KSQA 4JL8A 2W2XA 4JKIA 1E32A 2GK6A 3EZ9A 1OXSC 3VKHA 2EQBA 2RGCA 4MQBA 3V4FA 2QGZA 1SHKA 2FSGA 4FMDF 3HJNA 4R9UC 4YXWA 1G5TA 2NPFA 2GXAA 2HF9A 3EPKA 3CRVA 4LBWA 2OZEA 2FDCA 2WIAA 1OXUA 2PEZA 4L8GA 1S4QA 1G41A 2UKDA 2ZETA 3GFPA 4KYUA 3A6PC 2J0QA 2EFDB 4PHFA 5CITA 2YV5A 1AZSC 1IN4A 1CU1A 1CJMA 1P5ZB 2VPPA 2CBZA 2JJ1D 4OI2A 1GG2A 4Q7LA 4LOAA 4DWJA 2QP9X 4EIWA 1RE0A 2GXUA 4LSGA 5DLQC 4AIIA 4QHYA 4A6XA 1W47A 4Q5IA 1ZM9A 4JLMA 3B1ZA 4B3BA 2ZYWX 2WWWA 4RZ3A 3AVXA 3KUDA 5CB6A 4A0GA 2IYTA 2R2AA 2VHUA 5C1BA 3EX7C 2JLVA 4EJSB 1XPOA 4I1SA 1SVLA 4OI1A 1DAFA 2ZXUA 5KDOA 1W36B 1XEWX 5JSZB 3ICEA 3TR0A 1NKSA 2ZJYA 5GJBA 1JR3D 2O8FA 1Z0IA 1Z63A 4M1WA 3NBFA 1CLUA 1G7CA 3TNFA 4EFLA 4DB4A 2V7QD 1X3SA 1OIWA 3EZFA 4G5OA 4HB2A 4B6EA 2VSXA 2IK8A 2NG1A 3A36A 2OCPA 1R8QA 3KKPA 1E98A 1U9IA 2WWHA 4OJKA 3RS7A 2PX3A 1E96A 2DWQA 1EWRA 1I4DD 3RABA 3RRNA 2GAOA 2CMKA 2ZJOA 3AKDA 1FFHA 3GJ6A 5TXGA 4EUNA 2IXGA 2IUTA 4ZIRB 1EESA 2GEUA 1SVKA 1D9XA 4BZQA 3I61A 4JMPA 1E0SA 3QPUA 3VR1A 1QZXA 1E9AA 1XWIA 2MMCA 1E9RA 3BJIC 1UJ2A 3OFNA 2AFHE 1J8MF 2OO7A 4CW7A 5DHAA 3OAAA 1E99A 5G3YA 1QG2A 1W0KD 1KDRA 1ZCAA 3BIFA 3LNCA 2BJVA 3GLFB 1OYYA 2J9RA 4AC9A 1UEJA 1N6IA 3E1SA 3KTAA 3R7WA 3P26A 3KX2A 4BLTA 2OEPA 1UADA 2G83A 4OKSA 4XD7A 4OHZA 4DBLC 4D4MA 1IHUA 1E69A 2IL1A 1II0A 2RAPA 5AK0A 1D8TA 4Q00A 1T4GA 5JWRA 1SHZA 2A78A 2ZRNA 4HLUA 1RZ3A 1IAQA 4W7SA 3CPJB 3X1DA 1D2EA 4DSUA 1NVXQ 1QF9A 4LBZA 1CR4A 5E3HA 1Z6AA 4TL7A 2BKEA 1DBSA 4BRWA 3PUVA 2CE2X 3RS2A 3QPWA 4CT5A 1KSJA 2QL6A 1PUIA 1F6BA 2ATXA 1NSTA 4QGFA 2IYQA 2J7PD 3RWOA 2ZRCA 3ADDA 5DN6A 1KKMA 1XMIA 3KXKA 4PZYA 3IUYA 4GZMA 4LGMA 1ETUA 4NCHA 1Z3IX 2XNDD 4BEBA 4RZUA 1E4VA 1ELOA 5JBQA 3F8TA 1YRBA 1QVRA 2CLCX 5DYIA 3VHXA 4HLDA 4XVQA 3NDBB 3CRW1 3FWYA 4TSFD 3OHMA 4QXAA 1JALA 2V6IA 5C4GB 1KTVA 5FTLA 3PEVA 1ESNA 3T15A 3EIHA 4CEHA 1TQDA 1VMAA 4JVSB 4OJQA 1ZINA 4HAZA 4FI3C 4IDHA 3UATA 1G3RA 4RD4A 2ZSFA 4TMWA 2C9CA 621PA 4QGHA 2EW1A 4Y0AA 3VR6A 4L9WA 1DARA 1ZIPA 1P3JA 2CK3A 4M1KA 1VTKA 2GAAA 4TTRA 1YE8A 4Z1MA 5B58C 3BB4A 3QF4A 1L4UA 4CGZA 1Z6XA 4RVCA 3T5DA 4RCZA 2JGNA 1NG1A 3U3KA 1X8LA 4V0NA 1M7BA 4DC9A 1NVWQ 1XCGB 4Q1BA 1Q1ZA 1XEXB 2ZS9A 4DZZA 3THYA 2R8RA 4DCVA 2NO9A 2GRJA 4NYMR 2WWGA 3TLXA 2WMNB 3NBXX 5GVSA 1MO3A 4IDNA 1P73A 2QMOA 3A1WA 4TL9A 3GLIA 3BERA 2IHYA 1FNMA 2J45A 4LYAA 4PPFA 1E2NA 2H7VA 2NO6A 1OLOA 4HAYA 4IDOA 4LJ7A 2D62A 2ZRPA 4A2WA 3Q72A 4PC2A 1QHYA 4LYHA 4B34A 1QHHA 3CM0A 2ZRAA 3K9LA 4WAUA 3L43A 1XD2B 3G82C 3B1XA 5SZHB 4OHVA 2JDID 2CNWA 1YZUA 3KFXA 4M0LA 1IJFA 4LC1A 4NYJQ 4QBIA 4UKDA 4URWR 5DE3A 5FPHA 4DIDA 2N1BA 4NDZA 4G5QA 1C4OA 2B8WA 3IO3A 1S1CA 1T8UA 2ZAMA 4IOJA 4LI0A 3PIRA 2V6JA 2PZGA 5LBIA 2WJIA 4CEIB 1TU4A 3CR7A 5SZKB 2V3CC 2ZJ2A 1Z22A 5FBWB 3QXSA 1XB2A 2PZEA 3AVQA 4JL5A 3UANA 5K8IA 4JLAA 1OT3A 2LKDA 2TMKA 3QXCA 3LBNA 3LX5A 4UNNA 1W36D 3F0TA 3FHOA 2W0MA 2PJRA 1NKTA 2DFLA 5IHPA 3MWLA 1D6JA 4C0HA 4A1FA 4P4TA 2QEQA 3NBZC 1I2MA 4R7ZA 2QAGB 4KCGA 3TJZA 3GLFA 4IVQA 1SVIA 1J99A 4A36A 4C0QC 1RFLA 2OAQ1 2PMKA 3CF6R 3IHWA 1NRJB 3OEHD 3RRZA 5J4VA 2AFIE 1HYQA 3S1AA 2OCAA 2ZS8A 3AVPA 2GILA 3DM5A 3NH9A 4W5WA 3MRSA 1WRBA 4H9GA 2JCSA 4DHEA 3LH5A 3Q85A 5FOVA 4GNKA 1IY0A 1R2QA 2ODNA 3IIJA 4HI0E 1GOTA 3LXXA 1UAAA 4YDSA 4HSEA 1WF3A 3GJXC 3LQRA 3NEYA 1OIXA 4M1SA 4AG6A 5J4HA 4GBMA 2P6UA 1R4AA 1CF4A 4EKDA 2NO0A 2CL0X 4B47A 2WBLC 1JPJA 4EJSC 1DAIA 3EZ7A 3MLEA 5J4LA 2OXCA 3A37A 3C8UA 1YU9A 4Z8YA 2EU8A 2P3SA 1LF5A 4K46A 2F9LA 1IXZA 1F2TA 2ONKA 1G8HA 2VHTA 1ESMA 2IS4A 2BM0A 1JXMA 4OQFA 5DO9A 5BYKA 5M04A 2JLYA 1KKLA 3GJ3A 4MKHA 4US2R 2VP0A 2ZROA 2Q9BA 3A1UA 2B92A 3EAQA 4URXR 3ZVMA 3LQQA 3VR5A 5IF9A 1SQ5A 1KSFX 3LV8A 1N5JA 1U8ZA 3LXRA 1T5LA 5EE9A 1L4YA 1FW6A 2CK3D 4DLRA 1GL7A 3LBHA 1GL6A 1G8YA 2ANCA 1T91A 3UIEA 3BK7A 1ZMXA 1B0UA 4L16A 1G4AE 1G291 5L3SB 3C16C 3MCAA 1LFDB 2BBTA 5EUQB 4B2PA 4CYMA 3RNLA 3Q7PA 1RW4A 2YJTD 1XCMA 4M1TA 1H8HD 3DVLA 3MJRA 4QC2A 4Q4AA 4YMVA 5B64A 3NVAA 2DHRA 5DH9A 2UZ3A 3IBYA 3LBIA 1O87A 4LHWA 2XTZA 2OFXA 1KO7A 4ACAA 3PCRB 4LWZA 2V4ZA 3TH5A 1ZW6A 2GESA 1KY3A 4R71A 3T12A 1N5IA 2PT7A 2FSHA 2QU8A 4HAUA 4LK2A 3REGA 5EQTA 3R9IA 3AF0A 2GF0A 3OEED 4KO8A 1UPTA 1RPZA 1JAIA 2YWGA 4J0QA 1N3BA 1S9HA 3GLHA 5E7JA 1EFCA 1NIPA 2GK7A 1XZQA 2P5SA 2YOHA 2OSBA 4Q7JB 1RRFA 3I8SA 3DHWC 4MRRA 2B7CA 1N6HA 5C18A 3W6NA 3ZJYA 1A82A 1XPRA 4P4SB 1M6NA 1QHIA 3VR4A 2GJSA 1T0JB 3B9PA 5JI3E 5CIQA 3KUCA 1E3MA 1W5TA 2ZR9A 3MWYW 3Q7QA 1T3HA 2JLUA 2CJWB 3TIFA 2V9PA 4A4DA 1E79D 5FTKA 1YKSA 3UMRA 2R9VA 1P7CA 3CR8A 3CH4B 2WJJA 4AKGA 2C9YA 1NNEA 4KJZA 5EP3A 5DISB 2GCNA 3C5CA 2XZPA 4RD2A 4P32A 3THXA 3GEIA 3DM9B 3AP2A 2YOGA 1G8GA 4OK5A 2RGBA 3NBYC 3KDSE 2W6IA 4IFBA 1N5KA 4D4JA 2R6CA 1ZNWA 1VIYA 3EARA 4Q1CA 1N25A 5IK2A 3N2IA 2GHIA 4ILEA 4JLNA 2JATA 3ASYA 2J0UB 3GLGE 1N0VC 4YMWA 2ZRLA 1Z29A 2R6DA 2F3TA 2VL7A 3PUZA 5P21A 3TUIC 3DEFA 3QKRB 5FBQB 3KFVA 4G5SA 1ZD9A 2IA5A 3SQXA 3SDZA 4KFSA 3L0IB 4M9SA 1A7JA 4WBSA 2H57A 2WJHA 5FUWA 4TQUS 1FPMA 4BLSA 1JAHA 3TUJC 4M21A 5L3QB 3WP1B 1TX4B 2ZRGA 2DB3A 1XTIA 3DOFA 1P62B 2QNRA 1COWD 3SN6A 1E2FA 1MO4A 3CH5A 4GDFA 4EFNA 4G01B 4KU4A 3RYTC 4AKEA 3QEOA 4NPHA 3V00A 4V03A 2H17A 2YINC 3CX7A 3QPVA 4US0R 3CNLA 4PSAA 1J8YF 4URZR 3AV0B 3ONWA 1OXXK 2GJ8A 4XVRA 4PQRA 4UJ3A 3ZZ0A 3AQ4A 4W5JA 3UPUA 3A1VA 3GEEA 2ZR7A 1XPUA 2PCLA 2Z4RA 4NCKA 1G4UR 4S2EA 3RWMB 4EFMA 2ATVA 4PR0A 2CLDX 4PC7A 1XU4A 4EPWA 1NLYA 1EFHA 2VRWA 2D7CA 3GJ5A 3O47A 1DTSA 4YDHB 3T35A 5FBVB 3CNOA 2VH5R 4DDWA 1E2MA 1Z08A 4NCJA 2FU5C 3KQHA 4K81B 4AG5A 2Q21A 2O8DA 4L5BA 4FWIB 3FDIA 3TVTA 4LV6A 3P1JA 4KFUA 4PQFA 3K70C 1AA9A 3QKUA 4DCTA 5L3RA 1F3OA 4A6PA 5JWHA 1E9EA 5JMTA 4LV8B 1SZPA 3T1QA 2ZI9A 2EYQA 2XJ4A 1P60A 4LJ4A 1SULA 2FSFA 4IFEA 4YMTA 2OT3B 2Y8EA 2ZSDA 4B3GA 1G3QA 2JEOA 4E07A 5CYOA 3OEEA 4B3DA 1NG9A 4MUBA 1D2MA 2FH5B 4GL2A 2IS1A 1MABA 3B1VA 1EXMA 2ZR0A 3PUYA 3IQXA 2FEOA 3GJ7A 4PPQA 3U6BA 4A8JA 3EZ6A 1XD8A 4QBHA 2FFHA 5AUNB 1SXJD 1KNXA 1TPZA 2HDNB 4DLUA 3LW8A 4RKEA 1NN1A 1HE1C 2V1XA 2OESA 3FTQA 4M1MA 1M1YE 1LF0A 1WP9A 3R9XA 2ZTSA 2XSZA 5EJEA 4Q9LA 2OILA 2ZE7A 1JECA 3SBDA 1TUEA 2BBOA 4ZKDA 3A4NA 3BH0A 3CX8A 3L2OB 3BGWA 3CLVA 4GOXA 3IKJA 1FUKA 1TAGA 2VEDA 4TL8A 4DUGA 3ZDQA 1NMXA 2CHQA 2RGXA 5EP4A 4PQYA 1QBKC 3B85A 1NJFA 3A8TA 2FFBA 2ZE5A 3DMNA 721PA 5KUTA 1CJTC 4N0EA 4C0LA 1Q0UA 1E2IA 3G5UA 2P65A 1RJ9B 1N2CE 4L15A 3CW2A 1UKYA 3CUEF 4U02A 2W2VA 4BLOA 2YHSA 3HWSA 4YQFA 3CZQA 4JLJA 3LX8A 3LLUA 3QBTA 1GRQA 4HZUA 3TAHA 3OIVA 3TUZC 5CM8B 1YZTA 2NO7A 3K09C 4Q21A 5BN4A 4NYJR 1ZBDA 4XTRA 2GWHA 2X77A 4EPTA 1OSNA 4Q01A 2EFGA 4PANA 4F93B 2XZOA 1KI7A 2G1KA 1N6LA 1FUUA 4O25A 1HT1E 2ZSBA 4WZBE 4LHZA 2JJ8A 5FOUA 3U7HB 1GITA 4PO8A 3QQ5A 4AI6A 1XX6A 4MGZR 5G3ZA 2WKQA 5AJZA 1Z6TA 5UKDA 4ARZA 4B32A 4DEXA 1UKVY 2HXYA 1PUJA 1QHXA 4XJXA 4PSKA 3SEAA 1JJ7A 4F7WA 2UZIR 1EGAA 3DOEA 4V0MA 5F98A 4B35A 1NLFA 3PEUA 2EWWA 5KYKA 1FTNA 4Q03A 4O2LA 5JI2E 5F3WB 4LJ5A 4G5GA 2CLSA 1XJQA 3FHTA 2G6BA 2WWXA 2GXQA 2I3BA 2IS2A 1MKYA 5GJWC 4UNQA 4Q4JA 3OIWA 4OQNA 1HEIA 4PAQA 3EC1A 4Q48A 5FBLB 5JS7A 2RB4A 1E1RA 2HCBA 3QNUA 4JIMA 5FL7A 2J0SA 1KOFA 2ZAOA 2H8KA 3GFTA 1U98A 4LBYA 2FPMA 4QJ5A 4CDGA 5AJYA 4Z54A 5DN6D 1RC8A 4AY2A 4HYYA 4G0NA 3ASZA 1U9IC 1OFIA 3B60A 1EX7A 2Z83A 4JBWA 3GLIE 4BECA 1JR6A 3AKYA 2RHMA 4HEJA 4TYPA 1W4CA 2DFKB 1W4RA 3D31A 3WMEA 4D0GA 1KO5A 1MO6A 2NMVA 3VFDA 1W4AA 2WIBA 1S8FA 1N6OA 4GPTA 1FQKA 2RGGA 2O8EB 2I1VB 1GVNB 5EXSA 4B43A 3SJZA 3VX3A 1PVOA 1PLKA 4C2TA 3UMFA 1K6MA 3BWDD 1YRAA 2F9MA 1IBRA 2D2FA 1KK0A 3WRYC 4OK6A 1Z47A 2NO1A 4K8OA 4UJ5A 3PR1A 5HTKA 4A8JC 3WNBA 5EXTA 3VNUA 2J0UA 1E2JA 1S1MA 1UDXA 1LW7A 2DR3A 1U8YA 2K5UA 2QSYA 4Q4HB 4WXRA 1W46A 4HDOB 3SYNA 3THWB 4P4UA 121PA 3OE7D 3B9QA 4I1UA 3KZ1E 4HLCA 4POAA 4RSGA 3NTUA 2GZDA 1XMSA 5EE1A 3K0SA 2DFNA 4CRWB 3U61B 1ZM3A 1KI2A 1XMVA 3K09A 3GLIB 4NYIQ 5AJVB 1MRNA 3PVSA 3W5IA 4A8JB 2RGDA 1F5NA 1FMLA 2G77B 3KJEA 1K5GA 4DLZA 4W9MC 4M1OA 4JVLA 3FKQA 5E4FA 2C2HA 4BFZA 2VA8A 4N0DA 1IN8A 3SQWA 1CR0A 4Q02A 4LCBA 1GM5A 3ZD6A 5AUQA 1KHTA 1RRPA 3EASA 3P27A 1UBGA 4PXAA 2EWVA 4QJ4A 5HE8A 3TQCA 3CX6A 5H1YA 4DCSA 4PZLA 2ZPTX 1E1QD 5B2ZA 3QKSA 1WBDA 1QHSA 1N5LA 2WSSD 2W6JD 5FOSA 4A15A 1TQ6A 3NHAA 1OB2A 3HR7A 3GFOA 2GZAA 3L0OA 1YZQA 4ZI3A 5EXPA
chains in the Genus database with same CATH superfamily
3MINA 2PBRA 2LPMA 4B4OA 4MYSA 1ML4A 1NM5C 3OZTA 3HBAA 4BQIA 4ZDKA 3KALA 1UDRA 2BDUA 4RM3A 5M5BA 3CZ9A 2YXLA 2F48A 2R68A 3BL6A 2PSFA 3E9MA 2XHEA 2QTVA 2APJA 3SQLA 4N5MA 4CM7A 1WV0A 3I5YA 3SC6A 1AN0A 5B4UA 5J23A 4PLTA 1P9RA 1PV1A 4Q66C 2VYCA 2XGOA 2HMVA 4MW6A 1X14A 2HXSA 2FUG1 3I1FA 4ICIA 3F6RA 1TQ2A 3GRVA 3KVYA 2XXJA 2B6NA 3H0KA 4Y8VA 4QOSA 3I4LA 3TSCA 1SUAA 3QMPA 5LZ4A 5CNJA 3GF4A 3UXYA 3UBMA 4MVJI 5FTJA 4B79A 2H48A 4WADA 4MROA 4Q12A 3AGPA 1PJLA 2NZ8A 3GVCA 2EBUA 2HI0A 3LPDA 2O0LA 3ZDBA 1TD1A 2QR3A 1KC3A 2R3SA 2XSZD 1C1XA 3BWMA 3DFZA 2C8KA 3DPIA 1T10A 1ONOA 2PGDA 5FTWA 4AMGA 3IIIA 2IDZA 1WKCA 2WF7A 3JSAA 3OCZA 3IRVA 4TQ9A 4BKQA 2WZBA 2V97A 5FOWA 2HADA 1S3FA 4UEWA 4A8HA 1T0BA 2AHRA 2G9UA 1WKBA 2O2SA 1H3FA 2A1UA 2VCHA 2XCQA 4E7PA 1K4YA 4MV1A 1MGOA 4O2AA 1UK8A 3PDJA 2QQEA 3T9BA 2WINI 4X1IA 4QG3A 3C3PA 2OVFA 4UCWA 4DTCA 3B12A 2C31A 3G8AA 3T7EA 3O8BA 4JB3A 9ABPA 2OG2A 3K6RA 5FEMA 5JJLA 5EZ5A 1J2TA 1DBIA 1GCUA 1FRZA 1KWKA 1J1UA 1Y7LA 3K0AA 1XTSA 1Z39A 2FMXA 2QAIA 3DL0A 5K20A 3N53A 1GFIA 3KHUA 3F3YA 4RANA 3EVZA 1TUBB 2ZJZA 3FTDA 3HPQA 3UK0A 3L4SO 3SSAA 1CS0A 2ET6A 3ZE8A 2O8DB 3CZCA 4XB2A 1I0IA 3IUNA 5DU2A 4INZA 1VJ5A 1DV1A 3PUKA 3CVVA 4Z7JA 2QXTA 3D8NA 3LSYA 1IEXA 1WQ1R 4RNDB 4TPKA 3QVVA 4ZYZA 1D1TA 4DG9A 3WQBA 1DPGA 4Y6SA 3ANSA 4JXZA 2XMPA 4L4UA 4QDKA 4RSHA 5F4BA 2KJQA 4L85A 3TR5A 2JGIA 5BO5A 1JEEA 1ZH2A 2G0AA 2G76A 4XB6B 3W06A 1JMYA 3DULA 4EMBA 1UP6A 1X1QA 3UMCA 4CM8B 1I3OA 1AT1A 1B23P 4TWIA 1LI7A 3GA7A 3KKEA 2PGNA 3QVXA 4GPBA 3SG0A 4QO7A 2ZWOA 1HE8B 2DLNA 2FNAA 4WKNA 1P9NA 1YJ5A 4TYWA 4HEA1 4ZT4A 4DEVA 5LPNA 5BYJA 3V4OA 3CF0A 1JIIA 3HFRA 4KUHA 2XF2A 1HFKA 1JLHA 1XTKA 2WTNA 2ZP1A 4UCXA 1L5LA 2NU8B 5HILA 3W8FA 1GDHA 4J1TC 2HD4A 3E35A 4ZTZB 3O3CA 5E2AA 4NDNE 4ZI7B 3LPAA 3IP5A 2QRPA 1PTKA 4R5MA 4FIZA 2YMPA 2A7QA 3DZGA 4JASB 4PAMA 4QUHA 2GOYA 3H1AA 3HDJA 2C2YA 4IHJA 3FNHA 1WA5A 2VPTA 3DE3X 2Z4TA 4UHKA 2VK8A 3P4XA 5A0FA 5I4CA 1KZ6A 5ITVA 1A96A 2Q4EA 1JG4A 4AJJA 3EEFA 3AKCA 3U3MA 5ER9A 3U7EB 4TYYA 3RTAA 2I2BA 1YR9A 2JI9A 4D0LB 3JZMA 5MGBA 3DBRB 2HLDD 5KNLA 3EAFA 1TYEB 1FX1A 3HUEA 3LWBA 4CQMB 1YCFA 4CIBA 4LX0A 3BEOA 3FFBA 3U16A 3VR2A 2PWZA 1TDJA 1J0DA 1JI0A 4MWEA 2DY0A 4IHAA 1XP8A 3RG2A 1L3IA 1UBMS 1FB5A 3BE8A 1EAMA 2YRXA 3HCBA 4B48A 2V5AA 5E9QA 1NC1A 3L0YA 1S02A 2CXXA 2MSWA 3BJMA 2BBSA 3EXEB 4JJGA 4O8CA 5EJMA 3CNBA 4ZVLA 1HORA 2EZ4A 2C61A 4V2IA 3RVRA 1PVVA 2PMBA 1ZXBA 1JQDA 3F8WA 4C30A 2ZJ5A 3WE7A 1RHMA 3CMMA 1GARA 4HMOA 3FLMA 3DFFA 2YFHA 1K8YB 1ADJA 4WECA 4BMCA 1QIJA 1YI1A 2CJFA 4MYCA 2H92A 3MSCA 2VLBA 3GJTA 4G5XA 4P4SA 1OWNA 1WPGA 5C31A 4AICA 4CL3A 3TOZA 1BVRA 2WZQA 2AFIA 2I91A 1KK1A 1T43A 4WV3A 1I6MA 1T9ZA 1BE1A 2AI1A 1SWVA 2HIAA 1Q15A 1T4MA 2I6GA 4RX1A 1L7AA 2PO7A 3O84A 3E22A 1JT2A 2CL7X 4TYNA 1YR7A 2BSAA 4JC0A 4YRAA 1E5LA 4FN4A 4ND2A 3GFBA 3NBKA 1I2AA 3TK1A 2LRHA 2ZVPX 1FLNA 5TDHA 5KX5B 3NTRA 1L2TA 4FR0A 3PKIA 3BGIA 1HH4A 1QDUA 4HQ6A 2CCJA 4KYVA 2HA3A 4B76A 5ICEA 1Z2PX 4QPCA 4BB6A 1GKKA 2GF9A 2JJ2A 521PA 4HGOA 5K0LA 4G25A 3UT0A 2G06A 3BH6A 3WSVA 1UMBB 1J25A 1UPCA 1WPQA 1MQAA 2IP1A 2JANA 2W6CX 3DQPA 5CT6A 4PLGA 3S99A 2UUAB 3ZCSA 3BRQA 3EQ9A 2CCGA 4LOJA 1WCYA 3AF6A 3UTDA 3L7MA 3MG9A 2BKLA 4DT1B 3PUJA 2FZEA 4YAWA 4Q93A 1EGMB 4UEQA 4GFDA 1ZNYA 3DJFA 3NDPA 4LOHA 3ERCA 4Z3KA 2H5LA 2Q45A 3MWKA 4DBLE 3KRTA 1AC5A 4LBVA 1HTBA 2ZG6A 4PSVA 4U1RA 3D6NB 1RMYA 4BMYA 1T6NA 3I6IA 4H6PA 3FNRA 4H16A 1K5HA 5DXJA 4PGAA 1SXJE 3WO0A 2QNBA 1QMPA 1SBYA 4PYRA 3IXLA 1EWQA 4ZMBA 5IZ4A 5B1EA 1CRWG 1W0JD 2JAXA 5J40A 5T6MA 2XMZA 4BKMA 1AX9A 1R6BX 1XJ5A 1UOQA 1K8ZB 1UXJA 2IX9A 1B42A 1CHNA 1E60A 1UJCA 1G98A 2I7CA 2WFMA 3GP5A 3NKVA 4BIIA 4ZGGA 2ERYA 1AZTA 2IYLD 1N9ZA 3DAOA 4WK2B 3VTAA 1KIMA 4FHZA 2XDQB 4M7PA 4Y2VA 2H3HA 4F97A 3EGXB 4A03A 4BUJA 4LMAA 4OGKA 1R5OA 3AFIA 3OOYA 3RVBA 1CY8A 2JFYA 4OQEA 5JH7B 1L4LA 1SCBA 4OV6B 2O5VA 5KJEA 1A5SB 1OI3A 3CY6A 1XLWA 2VJPA 1AKEA 3ZYCA 1ULZA 2AE2A 4MQ5A 3QEBZ 2ZBEA 5JZBA 4DSZA 3DAGA 1M66A 3V8EA 2FP3A 1ZUD1 3FPAA 2DUWA 4R2JA 4EGAA 2EKLA 1QU2A 5ESXA 4ZOQI 4NXNB 1NR7A 4PRZA 4FBGA 2XZLA 1PJ2A 1Z18A 4GP6A 3HY6A 4FFDA 2C5HA 3JSXA 2YQ5A 4DCCA 3IE0A 1PL8A 4Y9UA 5JLJA 4RHCA 5DIFA 1ECBA 4CHGA 1JWBB 4RHTA 5DSZA 2H2HA 3LQ4A 3EZLA 1RP7A 1TZ2A 3V6LA 4ZN6A 3QSYA 4ZPXA 3VV2A 4ALKA 3CLSD 1M8GA 2GPJA 3JATA 3K0BA 3GEBA 1UBKS 4J16C 1PU2A 1RP1A 2CJWA 4LMBA 4NHEA 3U7RA 4F84A 3H86A 3W4KA 2EEPA 1UOPA 3RRYA 2GZ3A 3BD8A 5AW0A 1E0JA 1MAHA 4MQEA 2FDRA 3P2IA 1OIVA 2AYYA 1XVTA 1ZS9A 4B4DA 1KEZA 1Q7RA 2ZK7A 4B2IA 3STXA 4FFPA 4QSMA 5D1NA 3W8RA 1ISHA 3IUSA 3H2HA 3G6KA 1KBZA 3OZRA 2WFAA 2VJBA 1RQ7A 3B2EA 4QDXA 5DK6A 2O8NA 5FNVB 3CHYA 1SU7A 5BNTA 4BPBA 3LOPA 5DTIA 1SBQA 4X1YA 3MS7A 4GSYA 4EPRA 1XL0A 5BRJA 1M5RA 1IXYA 4A9AA 1FYWA 2C77A 5H83A 5SY6A 1VSQA 7MDHA 3GYBA 2JFQA 3VR5H 1V8OA 2ZYRA 3BS4A 4YK7A 4JLUA 1W29A 1Y37A 3PV0A 2GBLC 4ZAFA 1JJVA 4DBZA 3J81k 5KYVA 1ZU4A 4C4AA 1KVRA 1QFJA 3KLPX 3QLJA 3AW8A 1B43A 3ER6A 1Q77A 3BVPA 4JDUA 5FWAA 4Z4FA 4OLBA 1R6DA 2C3OA 3KELA 4G4SP 4KIJA 1QVAA 2IEDA 1IN6A 3N8KA 4WUVA 2QPAA 5COAA 3N8GA 2YYYA 2PMWB 4MKZA 1XBTA 2A1TR 2PZAA 4LQCA 2FE1A 1CRZA 4WLUA 2E6KA 3P9PA 4BFYA 3PL1A 4RVFA 1YVPA 4OG2A 5ALIA 3IBTA 4CR8A 1YWGO 5I01A 4GP7A 2B98A 4YP7A 2O59A 2BDTA 1X1RA 1P2GA 4BO4A 4DNFA 3B82A 2BAGA 1Q3HA 2A5FA 2WP8J 5LC1A 3OFND 1BX1A 4FCVA 3WGTA 3QTBA 1MZPA 2OHFA 3FN4A 2H4FA 3MBOA 3OPMA 3NJRA 5CBPB 1ZSNA 3ZDXB 5FFNA 2CY0A 2WHYA 3D7NA 3TQFA 3DOUA 4YUXA 1Z0FA 5CK5A 4AK9A 4X62B 3F4KA 1E4OA 2WE8A 4LQLA 3D0KA 3LVFO 4P93A 1YR8A 4DSOA 1G6OA 1Q74A 2CXTA 2F7SA 3ETEA 2X4DA 1EFKA 2ZANA 1SUDA 4YMSA 2B69A 4MW2A 4YPFA 2R60A 4Y0VA 3FVQA 3IAHA 3K9BA 2JASA 3WFJA 2FZ4A 2D6FA 4F4UA 2PKRA 5EL0A 2VPZA 1CUAA 3TTYA 3NM5A 1E1MA 4HEHA 1JLRA 4UAUA 4WKCA 5T3YA 1XDDA 4TRNA 5ALZA 4UCFA 1JB9A 3A1SA 3HKCB 1EX6A 2HSJA 3L6OO 4NESA 4TZKA 3PNBA 4BVFA 1OXKB 4G1MB 2YY6A 5EMHA 4CM9A 3D2LA 3LF2A 1A1VA 6REQB 3EAGA 3F97A 3G89A 1QBGA 1RHRA 3GBPA 4QYTA 5KWVA 4Y2TA 1D7AA 2ZQYA 3O03A 1SRQA 2JAOA 3A4LA 2OBXA 4JY7A 1C7JA 1CWUA 2IPXA 3BGOS 4NTZA 5LB2A 3ZHXA 2SBTA 4UUNA 1S96A 1J09A 3RSFA 4CVNA 1VKJA 2ISQA 4FMBB 4X8MA 1IZ8A 5F78A 3D81A 1WAMA 4R4JA 4R8MA 1EK1A 4E31A 3TI7A 5L4LA 1EUCA 3TOSA 3GGSA 4I1OA 2GDJA 4CR7A 3JVUA 1F2DA 3CZPA 4EB8A 3SVLA 3EA0A 1JU9A 1RYNA 4C0KA 2R6FA 1EVKA 1O94C 1YS1X 4QFCA 4KQ6A 4YS6A 3OZCA 1A2OA 1T8YA 2G5PA 4AWXA 3BKWA 2JGJA 4M7WA 3SXJA 1R16A 2VJCA 2PHZA 4X54A 2VSNA 3LIIA 3DTNA 5AVTA 2J9FA 1FLDA 2CFIA 3E82A 1BS2A 1KARA 1TTPB 4UPDA 4QJ3A 3ETNA 3RF6A 1KEEA 1TYBE 2E7ZA 3Q0EA 5BV0A 5H59A 3ITNA 4ZAXA 5IMBA 3FR8A 3I9LA 3U44B 1TMGE 2QYSA 3EMKA 1PT6A 5ARCA 2PE5A 5E6UB 4TLEA 4H6VA 4LXIA 1RBQA 4BMOB 3LD9A 3S68A 3ZLJA 1P6UA 1BYUA 1GPUA 3VOTA 2WT4A 2ZYVX 3KAJA 3L0BA 2ZJ1A 5HUQA 4GS5A 2XMGA 2IWHA 2GHTA 2VQDA 3L8HA 3UQZA 3SLKA 4YAIA 5L95A 4ETNA 5MFZA 2RE8A 1ZOLA 1V8ZA 3R5HA 3L82B 5IKPA 3A9CA 3IGFA 4XLLA 5ALXA 4R05A 5E7IA 5INTA 5EJ8A 4BKRA 3E53A 3R3VA 1UC8A 1FBNA 3EQ8A 4LJ6A 1P2FA 1X3LA 3I92A 3O73A 4ETWA 1TPYA 3S27A 1N3YA 1XQ6A 3RTEA 4DL9A 1QP4A 1KDTA 1PJQA 2GEBA 5IRCD 4Y2GA 2ERCA 4MLDA 4LKOA 2LDBA 3CLUD 4KXYA 4QQFA 1PWZA 2B99A 4K9SA 3R7DA 4BAUA 4LG1A 3FSRA 2Q1WA 2YFQA 3IUBA 3FDJA 2AN1A 4F04A 4BLUA 2PLFA 2GZRA 1FXWF 2G72A 1JKFA 1BVYF 1YR6A 4H1TA 5LQNA 1ZRHA 1G1MA 4LTMA 5EQJB 4ZC1A 5I6DA 4WD3A 1TW3A 1VCIA 3O4FA 1QVWA 3D8SA 4CCWA 1Y8RA 1GDDA 3FSEA 2O8BA 4D9JA 2WI8A 5CYFA 1W19A 3HFGA 5CFZA 1MOQA 2NNLD 4S12A 3FCYA 4I08A 4PU0A 3TEFA 1WXFA 4BNHA 5A4MS 2C8LA 3Q3JB 3OEHA 2RIRA 1GIAA 1N6PA 2A35A 3I5AA 1C9YA 1UJ5A 3MCWA 5JWOA 4UTXA 3FPEA 3M1LA 1PG5A 1JSZA 2BFDA 3RUEA 1ADBA 5MN6A 3A28A 1IBLB 1M2HA 3OG9A 2J9GA 3H2ZA 1GKUB 1Q0PA 1GL9B 1C80A 1WZEA 3MT8A 4OJTA 1YCDA 4GZ5A 4WLVA 5ALKA 3UG7A 2Y1EA 4IR7A 3NNDA 2P27A 1XOIA 3DLCA 3JAWA 3LX6A 2BFFA 2H4HA 2C1XA 3NHYA 4LWQA 3IAS1 4QASA 2XKKA 5EGNA 1M2KA 1ODJA 1NVVQ 3B6MA 4RDHA 1MT0A 3QVMA 3DL4A 3RC2A 4BX2A 2VAXA 4BJ6A 4MCIA 5TGDA 3T7IA 1ZIOA 4FFOA 4NH4A 2FPLA 2OZLB 5AI8A 5AR1A 5BXQC 4KLZA 3W2FA 4DT1A 2NUTB 4YJHA 5KVCA 2GSDA 4XARA 4JBNA 3W5VA 1RKUA 1N2ZA 3ZR4B 1WCWA 1AB6A 1EWYA 5ADWA 1UMBA 1AK9A 3WTBA 4OK3A 3RU7A 3M6LA 3W4IA 4B83A 1F4LA 2AUNA 4KSCA 1R00A 1WXDA 3KQWA 3ND5A 5L7TA 1AMOA 1T3LA 3KB2A 4QU8A 2TYSB 4ZU6X 2RH9B 3B3AA 3G3EA 1JEOA 1IHOA 2UAGA 3N39C 4U8HA 5C4IA 3HNPA 2XQVA 1DTEA 1OROA 2G0TA 2YNMC 4LISA 4NQZA 1NONA 4XWTA 1ZRNA 5LXTF 1L5GB 1K98A 2HT6A 5DDIP 4UTVA 4ZI7A 4B80A 1W52X 1VE5A 2XX3A 5EKTA 1I2BA 3FH0A 5G4LA 1VHLA 2J09A 4WLOA 1BVUA 4F5WA 3KYIB 2JZOA 1DKLA 2O8BB 4RQTA 2HDWA 1PR1A 1XLVA 3CF2A 3FPLA 3H84A 5LB4A 3LT4A 3UJAA 5KPDA 2ENWA 1ZMOA 1NMQA 4IGAA 4LHXA 2G1JA 3A14A 4W63A 4N5DA 3TVDA 5EHZA 1JDJA 4MVJD 3WLAA 4KXWA 3LUDA 5HKKA 4EBBA 4PBSA 4RHEA 1YUNA 2HLHA 5E6RB 1K66A 4BN0A 5JOQA 4WZ6A 2ASEA 2PL3A 2CW5A 4PGHA 3RE1A 3SC4A 1OH5A 4NCAA 3FSJX 4E3ZA 5BV2P 3ST7A 2I4TA 4G0WA 5FCDA 4TVKA 4YR7A 3FCAA 1GNQA 1J0BA 1M0SA 2FP4A 1IN5A 1GT91 2FYTA 3JD3A 3KZNA 3NEJA 2VXBA 5LDGA 3EY9A 3E3OA 1OFTA 1ZC3A 3KQLA 4HDMA 1HYBA 3GAAA 2EWMA 1GT6A 3ANMA 4JKOA 5I9LA 1EM6A 4RH1A 2W2PA 1WTAA 4QULA 1XLTC 4TM7A 2X1MA 2CMGA 4FQ7A 3CLRD 4KE8A 4O4IF 2KI5A 2ZBFA 4WOBA 2ZDGA 4FIDA 4XJVA 3I6ZA 1R4MB 2YXPX 3QELA 1R5NA 4TUYB 3RFTA 3S1AB 4HX9A 4AXXA 2JFWA 4XYEA 4ARUA 5FA5A 4E5PA 1OLUB 3H9QA 4HDNA 1VGQA 4IYRA 1QF7A 3X3HA 5CA1B 5DTMA 5LKAA 1KZYC 4ZZ0A 2QAGA 5KQPA 3DTVD 3UFBA 1G20E 1KI9A 1JLSA 4U3JA 4MV4A 2OB1A 4BCBA 1EK0A 2ZB4A 2L42A 1VLLA 4RK6A 2PLAA 1YZFA 4RPLA 4BBAA 2CNOA 2X6QA 1E3JA 3FX2A 4YGXB 3SSNA 1G21B 3CJRA 4ZQFA 4B8WA 2B7LA 2YR0A 5FA6A 1IOVA 3S2IA 4E5MA 5T8KC 5DI3A 4EARA 2GZHA 2B9EA 4H60A 1Z0KA 1R88A 1GR1A 1X7DA 3E5MA 3KHKA 4U0KA 3PQ4A 5JCJD 2OP1A 1K4MA 1SK8A 4N3AA 2JLWA 1I7NA 1DWQA 3OMXA 3RHFA 1TT5B 1P2TA 2VDQB 5AVRA 1CR2A 1SC4A 1OLUA 3N2KA 1DOZA 4WJZA 3FUCA 4E70A 1AXGA 2OAP1 1H2WA 3RARA 3MGBA 1XQ1A 1FEZA 2FOLA 3TKAA 2AOUA 3NBMA 4CEJB 3DOIA 1DPFA 5AW5A 1TL7C 3MIIA 2GASA 4QATA 5HGJA 1A5TA 1T3GA 4GWGA 1SQ0A 3O8DA 1BS9A 3D54D 3UOGA 5L3QA 3F73A 4LY6A 3F5QA 4OQDA 5KTRA 1BO6A 1Y5IA 2IYYA 2TMGA 1NATA 3QKTA 3ZWCA 3K9QO 4INJA 4YMHA 4PPNA 4R6XA 2JHAA 5JRZA 3M5WA 2B5VA 5CH3A 5BYAA 4DAEA 1X7XA 2QN8A 4I9HA 2ZUTA 4O08A 2VWQA 3H2YA 4XASA 5TV2A 1WUIS 3HJGA 3FTCA 1YB6A 2NZUG 2QF7A 1CS0B 3K15A 3MB5A 4IIXA 4ZVQA 5HOQA 3AUJB 1Q12A 2CUNA 3M6IA 1NQAO 3ZV5A 1DIBA 1UWLA 3PQ2A 1RKQA 2XHZA 2GGSA 1Q7CA 1ISIA 1JLMA 1HDXA 4HP8A 5ERXA 4XR4A 2GKSA 5EXXA 3SJCA 2JA2A 4S3MA 5J2UF 4FYIA 3DR3A 4RQBA 1D5CA 2F43B 1XP5A 1ZM7A 1II8B 1LB1B 2RCYA 3QEMB 1VIMA 1EZZA 2ZUVA 5TY0A 4WXEA 6ABPA 4Q9JA 5DGTA 2N42A 5EC8A 1ODLA 1QPGA 1M7GA 3PHGA 5SYAA 2D0OB 4DILA 1E7MA 4TXHA 3QWBA 2Q3JA 1QB7A 4LJ9A 2OFOA 2XD4A 3NP9A 1MX3A 4JK3A 3GIDA 2QRHA 4FZ3A 2GYUA 4G1BA 1DXQA 1VHDA 1NNI1 2JVIA 3L8FA 4FC6A 3T34A 4GI1A 3VSDA 5JASA 2ZKLA 4U5QA 1XXHB 1TNDA 4BGIA 2P2LA 2P9HA 5IVHA 5JCOA 5DGIA 4FDVA 1V7QA 3A05A 1VKNA 2QJRA 2J5BA 1YHYA 3IAS6 5BOVA 4BV3A 4Z4IA 1OX4A 4M89A 1FDTA 2PAFA 3GUCA 3QBEA 5AJUA 3SLRA 4C5BA 2NPIA 5BURA 1SQGA 1VLHA 3NRBA 4HLNA 4ZPJA 2Q3CA 3Q3EA 4D6YA 5KSWB 4DDHA 1V95A 3OMWA 3ZCVA 2QTGA 4JX8A 3FNBA 1I6LA 1M34B 2OE2A 4UXJA 1QJCA 4OHYA 5D85A 1YD7A 1J24A 1Z82A 4NMMA 3S4YA 1D4AA 3FDFA 4UUMA 3RS0A 3B3QA 1GVHA 1V2HE 4GVLA 2HRBA 3AF1A 2PRZA 3ES9A 3PGKA 4YJ2B 4CT0A 2BMVA 1P2SA 2DH5A 1CDEA 1U31A 5K8LA 1XZNA 5K99A 5BWNA 1HQCA 4AAYA 2VPIA 5HF8A 4ZEMA 5FL3A 4ND6A 4PNPA 3IVRA 5C8DA 4BLQA 3BKXA 1JKJB 1UDWA 1HFWA 3D2BA 4MINA 3S28A 1AKYA 2FMHA 2C9OA 1M2WA 2FPOA 2O1EA 3TTXA 2XGJA 3JWEA 3LW7A 1JJFA 1EWKA 1Z4OA 1HZZC 2QTMA 3CUTA 3KBOA 4IEIA 4RJJA 4AJLA 1HDRA 4EY3A 3EF3A 1L4BA 2GEDA 1DO0A 3EA5A 4KVAA 1YQUA 3KEQA 4OQXA 3V97A 1P5RA 4YNBA 4BVGA 1ZUNA 2YVUA 3R1IA 5F76A 4WVLA 1UWKA 2FGJA 2ECFA 5D5PA 1XQYA 5JDIA 2QUIA 3NANA 2VG8A 3H9UA 3T0IA 2W4QA 3KB8A 2Y4NA 3P0IA 2EKQA 2D59A 3NCTA 4MRMA 2XVMA 1CPYA 5ES3A 4YJDA 3N2GA 3OT5A 4C22A 5BWCA 1G6KA 5L7WA 2V7UA 4LZZA 3WB1A 3BFVA 1QZZA 2DBZA 4LDRA 4UZFA 1RRMA 2FPKA 4WCFC 3WYCA 3FKSD 4MH0R 4X91A 5HCIA 3LDAA 3CBQA 3Q3IA 2C98A 1EUDB 4WEOA 1VJ1A 2ERXA 4S1PA 5F2NA 3V5NA 2B6HA 3K5WA 3GMSA 4NK5A 4CKEB 4WI1A 1A27A 2XMBA 4CNQA 3MJ4A 1WTCA 1C4KA 1DWPA 2A4KA 1MNQA 2Z43A 3BL8A 3TDNA 2UYOA 2MIIA 4FHEA 2VDWA 1U0HC 1VE6A 4OAPA 4B7XA 2YVKA 2AUTA 2B7BA 1P80A 2MSLA 3B3JA 3QE3A 5DX8A 4Z2AA 1IK4A 3KJHA 2PZJA 5EXDA 1TKAA 4PXSA 4IGKA 3WL6A 3ZWMA 1ISJA 1C8BA 2ZI3A 3SIRA 4MS1A 3AC0A 1PZNA 2YBDA 5AVUA 2Y1OA 3VGJA 1QSGA 3UAVA 3HXPA 4IDAA 1WKVA 4CEIA 4CM9D 3HO1A 1L4KA 5CT5A 4P9NA 5JUWA 1R0ZA 2PR7A 3HGMA 4EZEA 1L9KA 1E2LA 2H5JA 3IMGA 1TXGA 4R2WA 1VZ2A 2Q5EA 3L6CA 4WN9A 1SUFA 1PGJA 2ZEJA 5ERGB 2AFRA 4RGQA 3T3MB 2XVZA 2R7AA 1ZGZA 1K6XA 1L0BA 2O05A 4QELA 2JD0A 1YO6A 4F3KA 2BBWA 2M2IA 3GP8A 1ID8A 1WP4A 3E9CA 1T3TA 4YECA 1XTPA 2HBRA 3BXEA 1UWCA 3VU9A 5C8YF 5L40A 4L8WB 1LH0A 2JGDA 3KJZA 3U9LA 3PCXA 3MQFA 3D5QA 3R0QA 1FDVA 2IYUA 4DV3B 5G0SA 4L5YA 1TD9A 2ZE6A 4Y98A 3OKAA 1FXSA 4RL6A 4TKUB 5T64A 3ZJVA 5E3IA 1V43A 1T5BA 2Z8XA 4X1OA 2Q2NA 2EZ8A 5KJCA 1O0BA 1ULTA 1ZEMA 3E9YA 1MNAA 1H0RA 1ZWKA 1UDBA 3OIFA 4JBGA 2HNKA 2NACA 4M54A 4H7EA 4BEWA 2WD9A 1E9SA 2CDBA 3ZDDA 1CXZA 2O1SA 2XWJI 2RHWA 3G7UA 5CDFA 2GA8A 3LPMA 5HCNA 1R74A 1SGWA 4XGRA 1D0SA 4NYMQ 4PGGA 5GAJA 1E6CA 3S1LA 4PPYA 4DIFA 3K6SB 1Q2XA 2Q0SA 2VJDA 2WIGA 4M1QA 1YZYA 4D8WA 3ESZA 4KE9A 1CUWA 5IJZA 4XIFA 4WNIA 3OLWA 1Q0HA 4RSRA 3BGDA 1R5BA 1GRNA 4TZTA 3HA2A 2Q8QA 3IR6A 3RB8A 2H07A 4D0NA 1ODKA 1YA8A 4NL4H 4YA6A 4YQEA 5C7IO 5LCXA 5FBRB 1SXPA 1YRWA 3HCAA 3SJAA 2QQ0A 4KR7A 1GPLA 3PXBA 1SC3A 2CL6X 2Y3IA 1USUA 2A9PA 2XUKA 3DA8A 2B0JA 3JQ7A 3O74A 4S1WA 4PY2A 3SSMA 4Z7OB 4AX8A 1ORRA 2PT5A 5A3RA 3DGFC 3MOSA 1LPPA 4F1JA 5AVJA 2JGFA 1Z6ZA 1UOEA 3TSWA 3VZPA 2Q6IA 4I8IA 4LV5B 5CB4F 5F1OA 4RQUA 4ED9A 2ZCVA 2FRVA 1R1DA 5LD2C 4D81A 4R1OA 4IEFB 4BP3A 1E1YA 2XY4A 5CX1A 3UAZA 2I4RA 2XKBA 4RTSA 1WZCA 1ZGCA 4ND3A 5ITWA 2YOFA 4QUAA 1PZXA 3T3DA 4ZV4A 3TBKA 1TFUA 1KGSA 1DXYA 3NTOA 3NC4A 4AO8A 4ER7A 4LC0A 3FYCA 3WV4A 4B0PA 3G7SA 3IDQA 3PR2B 3R6LA 3NO4A 1PEYA 3TXXA 1DHRA 1ZIDA 1BW9A 4IDPA 4MI1A 4KOEC 3AFHA 4D3SA 5A5VA 3WP0A 1ZKMA 1ECLA 1ZISA 5C35A 3EG9B 2X2FA 2WVAA 3VHXB 4B40A 2IEBA 1AHPA 3DVAB 3UNXA 4U9UA 2RFLA 1DCMA 1XAHA 2JFPA 1VECA 2Y1WA 3DEJA 1DADA 1FLAA 3D4NA 2E87A 1ISRA 1A1SA 4J0IA 4TV9A 3W6OA 5KNDD 3K0KA 1ZGGA 1W1WA 1V25A 3HHEA 4X9XA 3X1WA 4G23A 5IT9A 4RIIA 3NCHA 3BILA 3O8OA 1HLFA 5BWOA 4YI3A 3R9XB 1MH9A 2DPXA 3DC2A 3FVTA 4JEIA 4S05A 4NMHA 1REQA 1U99A 2WSIA 4KITB 1HURA 1QFYA 4UOQA 4CIDA 5KINB 2JHGA 1WD7A 3QVGB 1LNZA 1I5EA 4E03A 1VG9B 5IC4A 4D4LA 5KYYB 4C7XA 3HO8A 1UKBA 3ED1A 4OSEA 1IOLA 1YUMA 1F0PA 1U1GA 4NOMA 2IS6A 4AJIA 6ADHA 1OFVA 4QOHA 3CU5A 1NJ2A 5REQA 1VB3A 4WACA 2O3QA 1JS1X 1M2JA 5JFOA 4AIRA 1DDGA 1UJNA 3RT7A 4BB5A 4CKCA 5IJ0A 1IEVA 2CLEB 3GDOA 4YALA 3BMCB 4JI8B 5IC5A 2VSOA 5CW2A 3HDTA 1E4YA 3T7AA 2BFMA 1K97A 2PUTA 4B44A 4YRZA 5FI1B 4KI0A 4UATA 5KCZA 4ABTA 5DMHA 4KNWA 2ILTA 3AFOA 2R4TA 1VCOA 1XVIA 3A2MA 3BIJA 4C0XA 4LYYA 1WJGA 1UBRS 1PNOA 3AL3A 1HT3A 4P1ZA 5F3DA 3KPVA 3RAGA 3H3JA 1MP0A 2F62A 4JSYA 4L8YA 2BHRA 4TWAA 4DUYB 2E3JA 4HRXA 3JQBC 3FWKA 4J75A 1RI1A 2OCIA 4JI6B 1VL5A 5IJ0B 2JIZA 4EL0A 5I9NA 2JDIA 2QB5A 3USCS 2D06A 1NSFA 2FVXA 2H11A 3RFXA 1DO2A 3Q2IA 4QXQA 4C4YA 2GEVA 1JMVA 3GK3A 3K32A 5EIOA 2I8AA 4CDRA 5IF3A 1IZ0A 4WCVA 2RHCA 4R8SA 3U7QA 2B94A 5B6PA 3NIWA 4FOLA 4YLGA 1W0JA 3P0EA 1TEVA 2G08A 4Z9FA 3NATA 1Z73A 5IJ9B 5IULC 1A71A 2ISCA 5K3SA 5EPOA 1ZHHA 5BWMA 4US1R 1OX5A 1JEYB 5AKYA 2RGNA 1E0DA 4RD0A 4QDUA 4Y2JA 2LTAA 3RS5A 3RVNA 5JJCA 4A0SA 1PG2A 2IFTA 4TRRA 4YMUA 3U1VA 4L8VA 4M9XA 3MGKA 3WAGA 4JU9A 4K9LA 3GZJA 3ZH2A 1H8EA 5BR8B 1XA0A 2ONYA 2Y9PB 3C7AA 4MW5A 3ESXA 4L08A 1GNPA 1XDBA 5IAGA 2IYWA 1FFBA 1KJWA 2FW0A 4J6EA 4LYFA 2RHOA 2V9CA 3LU1A 3BQMB 4JJ6A 4OQQA 2XB4A 2CSXA 4BXOB 2WDPA 3UGTA 2VZ9A 5KJ1A 4LJ8A 4NZOA 2X41A 4G37A 3FUTA 3JD1A 5K3EA 1F6DA 3P9YA 4J1TA 1BRMA 3ZIUA 1G0NA 3GT3A 1OPRA 4MULA 1TZBA 1C2TA 3V8RA 4K8RB 4FHFA 4TQAA 1JBKA 1KMNA 5EN4A 4KAJA 1RBZA 2HGSA 2V5VA 5EWJB 3AZQA 1XD2A 2AWOA 4R1SA 4YREA 2UZ0A 2O2DA 3DLHA 2WHPB 1E79A 3AHCA 2GJ4A 4DJAA 3ZXXA 4RADA 4HFMA 2GJAA 4O2BF 4Z4EA 4Y6RA 3HU2A 2RHDA 2ZTLA 3TN7A 3QUTA 5FRDA 3A4MA 2LP4Y 3LJKA 1G21E 1QIMA 4BUCA 1H0HA 3RK0A 2E1RA 4FEEA 4L8LA 3CRMA 1YMUA 3VR6H 1E6WA 1XTBA 5JROA 2QGFA 2OHOA 3CSSA 3MCUA 3ICOA 4LDJA 3A10A 4R51A 4RTLA 3VU0A 2IIVA 3VUFA 1G5PA 1JQ5A 1L5FA 2IXEA 2MJLA 2QP4A 4KE7A 4QPDA 3NORA 5DCUA 2JI8A 4BO7A 4BRZA 4DRZA 4Y2UA 1I5OA 2WJYA 5JADA 1LRKA 2VTEA 2ACWA 1A2BA 4AO6A 2PBZA 4C21A 2GJ9A 2IV3A 2R84A 4EKGA 2VF7A 2RI0A 4JNKA 4K87A 3PDHA 1OFHA 3ETLA 3DCJA 2F1JA 1C3OA 2HTEA 4XX0A 5CX4A 3VKUA 5EHQA 4ECAA 5CLLA 2AEFA 1VCHA 1M1NB 1K08A 1XQWA 3EW7A 2W90A 3GLQA 1IG0A 4L1KA 4D74A 2A5GA 2MINB 4JCCA 2EG5A 2BEJA 4RWZA 2Q5OA 2QXYA 5FTNA 4Q3DA 3SM9A 3TAUA 2OV4A 1PRYA 4RE5A 1V0JA 2QHXA 1U7UA 4V0RA 4C1NA 3URKA 3I52A 5TGTA 2D4AA 2FEPA 4CF6A 4M1YA 3KYJB 3IJPA 4RW0A 1TTTA 4OYHA 5DPMA 1RQLA 4FILA 4TV8A 1ZN7A 1HDYA 4ZV9A 3QOFA 2XUZA 4EDHA 4H4CA 4OQYA 5EJAA 3FBTA 1MOPA 1X86B 5K3FA 1L5SA 4FYYA 5JS8A 5DYGA 4RLFA 4L27A 2PGAA 3BMOA 4JQCA 2I4IA 4IICA 4LI3X 3U3DA 2DOKA 4REQB 3UK1A 3KQQA 3PWTA 3KLNA 4JJKA 4DGQA 3UB2A 3Q98A 3LXUX 4MQLA 1RACA 2VHXA 1JA9A 4EMTA 1BE0A 3B1WA 5KKAA 2FWMX 4P0PB 2R1UA 2EAUA 3GFVA 4DLWA 5J3JA 3I5XA 3HCNA 1KH3A 2XAAA 2ZPUA 4HQKA 1G60A 5AW2A 1O0CA 5U9CA 5J47A 3HBFA 1C3VA 5EFZA 3CIFA 3MT7A 1C14A 3S44A 1RWXA 3VC1A 4HGZA 1RRCA 2H65A 2M32A 1HR0B 2BF7A 2WF6A 3GHYA 1N9KA 3CSUA 3OSZA 1IOZA 4Q34A 2QBYB 3OO1A 1G1AA 1EE2A 4GF5A 2FEMA 3JW8A 4I1PA 3WBJA 3FETA 2F8MA 3P4YA 1VBKA 3MERA 1Z36A 3A04A 1XTJA 2REXB 1GILA 4BGDA 1BMDA 1XKTA 1E3IA 3DC7A 1MVLA 1EU1A 3HVHA 3ENWA 1KO4A 2H59A 4MCAA 3H9CA 1E0KA 4AUKA 3UV6A 4QUDA 4OAQA 4JFAA 3ZE0B 3WYAA 4KR3A 3GXOA 4I19A 1DTWA 1YQEA 1RMTA 2HIGA 2W0SA 4PLVA 1F1JA 3C87A 4K9NA 4MRMB 4IIHA 1WW3A 3LUAA 3P9IA 5TX7A 4C05A 5KHAA 1CZNA 2R00C 4TYMA 3K8OE 1GWNA 2WE7A 2RAUA 3AEQA 3VV3A 1ZUNB 1ISSA 2A5YB 2B4TO 3FZYA 3N05A 4I4TF 4LJAA 4X3OA 2M1XA 3W7VA 3ZXUB