2RGDA

Crystal structure of h-rasq61l-gppnhp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGLEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Transformation Efficiency of RasQ61 Mutants Linked to Structural Features of the Switch Regions in the Presence of Raf.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rgdA00
4UJ5A 1G4AE 4PXAA 3QXCA 4Q7KA 1UAAA 4CT5A 1PZNA 4M9ZA 1PJRA 5IDVA 5A4JA 4JLJA 3REFA 5AJYA 1T3LA 1Z0KA 2DWQA 5GADl 1HQYE 1G291 5DYGA 2REOA 4OK6A 2GJAA 2X2FA 2IYWA 2QEQA 2GAOA 3S1AB 1E2HA 2P65A 4GOXA 2ZRLA 3RNLA 1BIFA 3B60A 3S1AA 4MITA 4B3XA 2JATA 3QPVA 1AGRA 3U3KA 4GSYA 3T06B 3KUCA 5DN6D 2KI5A 4M0LA 2BBTA 2JA1A 2GTPA 4B76A 4B32A 2IW3A 2QY9A 4L5BA 4PAQA 4V0OA 2QT0A 1RRGA 3U3OA 2GXAA 4QGHA 3PIRA 3CKLA 3U3JA 4US0R 1YHNA 1NRJB 2J5XA 3TK1A 3RS0A 4NDZA 4OI0A 1CJUC 4M1OA 1PLKA 1XWIA 1GP2A 4L16A 3M0EA 2C99A 2ZRMA 2Q0HA 2C9CA 4HZUB 4IOJA 4QNRA 2ODNA 1D2MA 1ZC3A 1GSIA 2VA8A 4LJAA 4KFTA 1NY6A 1E2PA 1QG4A 5HCIA 2B6HA 2C5LA 4E5UA 3I61A 3CW2A 1NN0A 2RGBA 1AK2A 1TQ4A 1UBFA 3P4YA 4M4SA 2Y8EA 2CJWB 2BKUA 3TRFA 1WBBA 3W3AA 2CJWA 3BFVA 1ZBDA 3EX7C 3TR0A 1P61B 4BLRA 1WE2A 3KQHA 4CZ2A 3T61A 1YQTA 2FWRA 4JIMA 3BFKA 1OT3A 4KO8A 4RSGA 3WBKA 3NC1C 1SKYB 1KOFA 2GKSA 2RH5A 1GAJA 1OKKD 2F9MA 3WY9A 3PVSA 3IEUA 621PA 3LV8A 3UANA 4PC3A 1UEJA 3MWKA 1Z29A 4HAWA 1OFUX 3I8SA 4JVSB 2HXYA 3AVQA 1E1RA 221PA 1EX7A 2QSZA 2ZITA 4A2WA 5EP1A 4C0JA 4R71A 4B48A 2WTUA 3FGNA 2QPTA 1VG9B 2CCJA 4X8LA 1D5CA 1EG7A 4CW7A 2FGJA 2A30A 2FOLA 4CYMA 3MUFA 4MGKR 4JLMA 2WJYA 1N2CE 1JBKA 1IXZA 1K5GA 1Q0UA 4RFSB 4DLWA 4UXHA 2BM0A 5DN6A 4LGMA 4RFSA 3B13B 1G3IA 2ZROA 4NCNA 3HR8A 3UXMA 2WJVA 1B23P 3PJRA 1TADA 2ZRIA 3GJ7A 4G0NA 3SYKA 3AEZA 3ICEA 2E87A 2NZJA 5DHAA 4N0DA 2CK3D 1M74A 3GJ6A 4HLQB 1O3YA 3BH6A 4TTRA 2JEOA 4JL8A 1HUQA 4KSBA 1NNEA 4HI0E 3QXJA 1XMVA 1P2VA 5EXTA 3GLIE 1AS0A 2H16A 1CRQA 2QTFA 2J7PD 4OK5A 3H1TA 4LHZA 2DHRA 3CRQA 2WWFA 1JI0A 2JJ2A 5J40A 4DZZA 1WCV1 2P2LA 2QI9C 4LCBA 3QI2A 1G5PA 1P5ZB 2AD1A 3MSXA 1QF9A 1RVDA 2NGRA 2GXSA 3C14C 2ZJ8A 4EJSC 5JI3E 3IQXA 2OHFA 4BE7B 4MRSA 4V0KA 3NH6A 4OBEA 1E69A 1IY1A 3AVXA 3Q85A 5IHPA 2QN6A 2O8FB 2UZ3A 1IHUA 2BEKA 4DWJA 2O8FA 3HDTA 2O8CA 5HPYB 2IX3A 4ZDJA 2VF7A 1ZU4A 4LY6A 2W0SA 4WBSA 3RS4A 1KO5A 1NVUQ 1OYWA 4S35A 5FR2A 4URUR 4ZKDA 4FWTA 4IW3B 3KTAB 3U60B 4GZLA 2NIPA 4ZCMA 3GJ4A 2WWGA 3KTAA 1OFTA 1UKYA 3IHWA 1IAQA 4JVLA 1Q3TA 5KO2A 4QOSA 3FKSA 3CNLA 1A7JA 2IYLD 4K8OA 4RKFA 1R8QA 1YR7A 1MH1A 2HXSA 3L0IB 4B75A 2CLCX 2UVQA 1G8YA 1S3GA 4LYHA 2ZRNA 2ODBA 3FPAA 1EGAA 4RZXA 1P72A 1VG0B 2CK3A 4TLBA 4QHSA 1GITA 2D2FA 4IDHA 2YV5A 3UMSA 1MOZA 2FN4A 3EC2A 3U3MA 2G3YA 4PAOA 4DSTA 3WNDA 2ZS7A 3KQLA 2I4IA 2J7PA 1N6LA 4HB4A 4DIEA 1L2TA 3NBZC 4Q21A 1GM5A 5GVSA 4MQBA 3R8FA 4RJLA 3HR7A 3I8XA 4HLDA 4YONB 4C3ZA 2GCPA 2CDNA 3ADDA 5EE9A 2QGZA 3ZJYA 4JZKA 4O3MA 1WMSA 2VHJA 2QTHA 4JS0A 3Q3JB 3NXSA 2YOFA 3OEHD 4Q01A 4LOAA 2ZEJA 5EP2A 1TUIA 2ZI4A 1ZCBA 5FTJA 3VR1A 4Q1DA 2PT5A 4OI4A 1J2JA 4I1UA 4PHGA 2QRNA 4QL3A 3IIJA 1P75A 4TL8A 1NVVR 3GPLA 4GZMA 3B6EA 1JJVA 3CUEF 1Z0IA 1Z6XA 4YMVA 2QP9X 2NPIA 3X1DA 2JLQA 3SE0A 3TIFA 4A6XA 5KSYA 3KB2A 2BOVA 2IYSA 2Q3HA 1U8AA 2HF9A 2IL1A 2ZS8A 2QGNA 3FVQA 1A4RA 2CL0X 2A5FA 3R9XA 5FOVA 5J4HA 2RGEA 1NSTA 1BMFD 4GP7A 3SI7A 2AX4A 2F55A 4KFUA 2DR3A 2OXRA 5DNYB 2NTYC 4IXMA 2EU8A 3VAAA 1OFHA 3GEHA 3RRMA 4NU0A 5JMTA 3HP1A 5FL7D 4IFBA 3HYTA 3NC0C 2B8WA 3T15A 4BUJA 1OH5A 4XTRA 2GHIA 4FMDB 3IO5A 4PR0A 2JJ8A 2OEPA 2WSMA 4B34A 1FW6A 4KFSA 4TL7A 4NMMA 3LD9A 3WYAA 821PA 2VYFA 3MRSA 4HATA 2Q3MA 1E2QA 1R0WA 4C30A 1U8ZA 1X1SA 1N5IA 2KSQA 4WVFA 2Q9AA 2ZUBA 3PUZA 3EZ2A 1XDBA 1YR8A 2ZSAA 3KL4A 1C4OA 5SZJA 4CEJA 4B3DA 2VRWA 3BC1A 4JLAA 3V4RA 2D06A 3G82C 4PAMA 3OEHA 3IDQA 3K8YA 5SZKB 3O8CA 2YZ2A 2JCSA 4PPNA 4XOIA 4AYWA 1JB1A 2IXGA 1US8B 4JJKA 2CNWD 2ZSBA 4KYUA 4B3FX 2OILA 4EQ6B 1S8FA 1US8A 2HT1A 4EQ6A 3VR4A 2DFNA 2IK8A 2JGNA 2C96A 4HZIA 3TSOA 2PJZA 4D26A 5JRJA 3SYLA 4MA4A 2WSSD 3FMIA 4FCVA 3A36A 1BOFA 4OI1A 3L0PA 4M1KA 1Z6GA 5DHFA 4KCGA 1G7TA 1KI9A 1XU4A 2KWIA 1OF1A 2MMGA 4TLEA 5D3QA 3TW8B 3BGWA 1WF3A 2O8BB 4MGZR 4MUBA 4EPYA 3FWYA 1BMFA 2O8BA 1Q20A 3M6AA 5H70A 1RPZA 2ZSDA 2BJWA 2V3CC 2ZI5A 3SDZA 4N3NA 2WAYA 3UATA 4EUNA 3T5GA 1W2GA 5AWFC 2V9PA 5CJ2A 4YDHB 1C9KA 4DSOA 4MRPA 2FDCA 2O8DB 1NF3A 5FL7A 2O8DA 5E95A 3RS2A 3LBIA 3ZLJA 3RC8A 5ELXA 3E1SA 3QVUA 4PC7A 2DBYA 2XX3A 3U6KA 2ZIAA 4S2EA 1VKJA 3BIFA 3AB3A 5FBQB 1T5IA 2HJVA 1G16A 1ZVQA 3O8RA 5FBWB 2FNAA 4KODA 3VHXA 2QL6A 4BGDA 1G41A 4MUAA 1M6NA 2F1HA 2QPAA 1P7CA 2ZUDA 4HB2A 1K5DA 4KI0A 3TSWA 4PTLA 2EFEB 4EFLA 3PUYA 1P9RA 2FZ4A 1CEEA 3EARA 1TQ6A 1U9IA 2X1VA 3BWDD 1P60A 2J1LA 2JLRA 3C5CA 3BORA 1H65A 3DZ8A 5TDHA 4C0QC 1VCIA 1VIYA 3KXKA 3VHLB 4GMXA 1G8FA 4L15A 3AP1A 4W5HA 3AF0A 3FFAA 2CNWA 3EPJA 2WMOB 1FP6A 1ONBA 4DRZA 4HUTA 3ZD7A 4O25A 2ZE7A 1AA9A 1EWQA 3LX8A 1EK0A 3B1XA 3R20A 4M53A 2ZAOA 2B7CA 1SVWA 4TMKA 2XEXA 2WSSA 2QENA 1CU1A 2C8VA 3AP3A 1OIVA 4IEEA 1HURA 3W8RA 1KTVA 2L0XA 1E94E 4Q9HA 3BERA 2ANBA 4MYHA 4YMSA 4AWXA 1KZ7B 4DSUA 2OM2A 4HSEA 3CBQA 5B57C 3GJXC 4B3BA 2H7VA 2P3SA 3TUJC 1TU3A 2GXQA 2ZETA 3TBKA 4PX9A 4TQUS 3BH7A 5KSOA 3BJIC 2ZYUX 2IS6A 4HDCA 3D6TB 3ZVMA 3LXRA 4K46A 2OE2A 1EFRD 1WP9A 5EQTA 1J70A 1IXRC 2CL7X 4E07A 1CBUA 4EAQA 1OH8A 3PQCA 3ZVNA 3CB4A 4D4MA 2GAAA 5F2EA 1R6BX 1Z47A 1XTIA 4BLTA 2DWPA 3C4JA 4DLYA 1OB5A 4LHWA 4N1AA 5F3WB 1TU4A 5LPNA 1UFQA 4LHVA 3ZZ0A 2ZRKA 4HAUA 5KYKA 1XD9A 2C04A 1X8LA 4NYJR 2QA5A 5CYOA 3ZD6A 1E0SA 1QRAA 1R5OA 4E09A 5KUTA 2XZLA 2WVJA 2J0VA 2I3BA 1JR3D 2JLXA 4P33A 2V6JA 2R6CA 3FKQA 2HYDA 1IQPA 1DTSA 4P31A 2QM8A 4RKEA 4G5QA 1XD2B 3IPYA 2WJHA 2ZYWX 1E0KA 1GKUB 4OK3A 1R8SA 4JVNA 3PFIA 3ICQB 4C0SA 2W2TA 2WJJA 4WAUA 3F3YA 5FUXA 3CPJB 2BBWA 4Q9LA 4RD2A 4PHTA 5E7IA 4AYTA 2O52A 1AQYA 4KLNA 3U7EB 4D6PA 2IYUA 3U4QB 1OPXA 1GILA 3GLHB 3LH5A 1E2KA 3U4QA 4Q4HB 2ONKA 2ZI9A 5CIWA 1NIPA 5FOXA 1NMXA 5DH9A 1NBMD 4LV8B 1OIXA 4BFYA 3RRNA 1QVAA 3LVRE 1DG3A 4HLCA 3AKYA 2QQ0A 1P3JA 1R0XA 2GCOB 1Z6TA 2CCKA 4V0ME 1JPJA 2EYUA 1ZM7A 2GCOA 1KI6B 5EZ5A 2FSGA 4IDNA 1TEVA 1KK1A 1KI6A 3JVUA 1FTSA 1FOEB 3EAQA 1S4QA 3KJEA 1RW4A 3P1JA 4R98A 2Q9BA 1VYTA 4TL6A 4F91B 4JLOA 1AJEA 2X19A 4B3CA 1KKMA 3W90A 4Q47A 2AFIE 4PC2A 4LBZA 1ZD9A 3W8NA 3FMPB 1KDTA 1LF0A 1G1MA 3BB3A 4Y0AA 5DI9A 5H68A 3EW9A 2IBMA 4GOKA 3C5HA 3TJZA 1XB2A 5C4MA 1U9IC 4XTCS 3SJZA 2IHBA 3TQFA 1MT0A 1QHNA 1CJKC 3P32A 3LX5A 4D82A 5LD2B 1R4AA 1KI7A 1TQ2A 2CL6X 1JR3A 4ZO4A 3V4FA 2AFHE 2HJGA 3NBXX 5KHOC 2R6FA 1WBDA 5AUQA 4JLKA 2CBZA 1ZD1A 3WP0A 2MSEB 1NG1A 5G3YA 1W48A 1Q57A 3JZMA 3HPRA 3Q5DA 3PUVA 3ECCA 3KUDA 4M2LA 3LAWA 1WRBA 4OHZA 1CIPA 5DE3A 1M7GA 3RWMB 3KFXA 2KBEA 1W1WA 2GILA 2ZRDA 2WM9B 3X1ZA 5JJKA 1E98A 3SZRA 1D9XA 2BBOA 2GEUA 1GNPA 4JVMA 4TL9A 2ONJA 1LY1A 3EPHA 1XEXB 4TYQA 3W6OA 3PXGA 3KXLA 1XEXA 2B21A 4DLRA 1MO4A 4WXPA 4BFZA 1RRPA 2PLRA 3I32A 1NBMA 3MCAA 3WRYC 4DIDA 1N3BA 3A1UA 1A2KC 4EPVA 3B9QA 4FMCF 1JNYA 4NYIR 3AVYA 2QMEA 1E99A 3GP8A 1W44A 3B8HA 4LBYA 2F6RA 4AD8A 1OH6A 4TYYA 1TUEA 1NLFA 4QNMA 2ZI7A 1AQUA 2ZR7A 2HLDA 1J8YF 3RRYA 1UJ2A 5EP4A 4QGAA 2GJ9A 2GEDA 4LYAA 1NIJA 3OE7A 3P4XA 5AJWA 2ZRJA 2ECKA 1FUKA 3ZGXA 2J0QA 1L4YA 3CH4B 3NWJA 3X1WA 4RD1A 2FJUA 1T91A 3IKJA 3UG6A 2BV3A 2OV2A 4TLCA 4G5SA 2FE4A 2ZSFA 1GOTA 1ZUIA 3BOSA 3FDIA 3A1SA 3F5FA 1P62B 3I5XA 1OXXK 2VP6A 2QNRA 3H2YA 1K6MA 4Z51A 4L4UA 2CLSA 3SR0A 1KZGB 5CJPA 3H84A 4G01B 1G17A 1DEKA 2QZ4A 2UKDA 3WMFA 2QT1A 6Q21A 4CF7A 2QMOA 3DM9B 1ZM3A 1S9DA 3E5HA 5JS7A 1KJYA 3TAHA 4JKYA 4A0RA 1DARA 3P26A 2IEYA 4RY2A 2XOKD 2FPLA 2PCLA 3OFNA 2ZJYA 3TKLA 5B30A 5SZIA 1U0JA 1YR9A 2ZU0C 3OAAD 5JWHA 2WHXA 2ZM5A 1U99A 5EUQB 4EKDA 4UNRA 4QFMA 5HZHA 2PH1A 5KPJA 1MO3A 1JAHA 1TF5A 1ANKA 1YJ5A 2D3WA 3DMDA 2IYZA 2GK6A 4M1WA 1X86B 4UXJA 4RZ2A 2PZFA 3WNBA 3EA0A 3QXSA 5AUNB 4ERNA 4POAA 5JSZA 4P4SB 3A4LA 2WMNB 3LLUA 1LW7A 4P4SA 1Q1EA 1E1RD 5J4KA 2YKGA 1GKIA 2OFXA 1HA3A 1TF7A 4M9XA 1A82A 1I2DA 3GLFB 5FTNA 3X1XA 3LQQA 3GLFA 1KO1A 3ZIAD 4UJ3A 4DLSA 2YWHA 2IS4A 4PQRA 3VQTA 5HTKA 1YRAA 3KJGA 3X2SA 2NZ8A 2ZRFA 1Z0DA 4NE2A 4ZKEA 1U0LA 3SBEA 3GLGE 5FFMA 4TQAA 5BXQC 2ATXA 3SC3A 2I1QA 4P4TA 4M9SA 4DEYA 1T0JB 4ABYA 421PA 1G3RA 1OIWA 1Q1QA 1G5RA 1G8PA 3EXAA 3HPQA 3K0CA 2BVNA 2O0JA 5LD2C 4QG7A 5KOYA 1HV8A 4LV6A 1N5KA 2DPXA 2WWYA 2PT7A 4DXAA 4C0LA 2XOKA 3CF2A 3OEEA 2IEZA 3NHBA 1LS6A 521PA 3CX7A 4MYUA 2JJ2D 3OAAA 5BN5A 4IEIA 1VHLA 1E32A 2H17A 1P2TA 3C8UA 4DLTA 4Q9IA 2F1JA 4A82A 3TVDA 1Z8FA 1BS1A 5BWMA 1OJLA 1ZUNB 5GJBA 1VG1A 4MYCA 2IUTA 1FL9A 2UZIR 1Z2AA 2AWNA 2A5JA 1I4DD 4PO1A 5FI1B 1SQ5A 2A9KA 1R2QA 4FI3C 3IILA 1AZSC 3GJ8A 4KVAA 3P20A 3LVQE 1M8PA 2QORA 3CR8A 2QU8A 5JJLA 2GJ8A 2AD5A 2H8KA 1LV7A 1GIAA 4QBGB 1AGPA 2WKQA 5J47A 2AN9A 3GFTA 3KQKA 1RJ9B 3ZIAA 2VSFA 4G3XA 2W83A 3CWZA 4YDSA 1RJ9A 2V6IA 1KO7A 1QHIA 5EXPA 5C18A 1CLUA 3IBYA 3VKWA 4QBFA 4TSFA 1W36D 3FKSD 3AGQA 4Q19A 2P6UA 3GEEA 3ZQ6A 3KB1A 3QEOA 4NTZA 2H18A 5AJZA 4D0NA 4O0MA 5ANRB 1W7AA 4Q1BA 5FL3A 5G53C 2VHCA 4PPGA 1KK3A 4U02A 1RYFA 4Q1FA 3VFDA 4A2PA 4DCTA 4OHXA 4ACBA 1N5JA 1N0VC 4WZ6A 3TR5A 2J41A 1E9CA 1FTNA 4EPRA 5B2ZA 4F7WA 1Z0FA 5TXGA 4BFVA 4D80A 4HB0A 2ZREA 1AN0A 5BYJA 3ETLA 1DAIA 4MH0R 3UWOA 4A0GA 2F1IA 1Q12A 3BFXA 3HWSA 4YMTA 2CHGA 1HYQA 1NN1A 2XB4A 3UK6A 4BLOA 1JJ7A 2ZJAA 4BQSA 5IK2D 1GDDA 3K9NA 3RLFA 2CLDX 1N0WA 2A5DA 3OIUA 1P2SA 4P4UA 2QRZA 1KDPA 1UEIA 3GJ5A 3OIYA 4JSTA 2FEOA 3MGCA 5EE3A 4P32A 4YMUA 2YJTD 2OFWA 3GLHE 3GQBA 2O8CB 4MDEA 1G3MA 4MKIA 3PUXA 2ZVQX 3WRXC 5UKDA 1EESA 2IYRA 4C0AC 1PVOA 1QZXA 2ZE6A 1W0JD 1MV5A 4U7DA 1XPRA 2FSIA 3QEJA 4JMPA 3TNFA 5AUPB 1E2DA 2GZAA 1YZNA 2DB3A 4JYCA 2HCJB 1OXTA 2ZI6A 4GFDA 1OSNA 2NOAA 2EW1A 4LJYA 5CITA 1W36B 3L2OB 1VIAA 2ZE5A 4B43A 4B73A 3KKQA 1UM8A 1BYUA 4BWYA 1J7KA 1E79D 3WHKA 4PZLA 4XSGA 4CDGA 2IUUA 4JL6A 4DLVA 2BMDA 4ACAA 1X1RA 2D7CA 4CEHB 3R9WA 4OL0A 2OBLA 3GFPA 4CEHA 2KJQA 5FBLB 4D4LA 4X8HA 3K0CC 1DAKA 1FNMA 4DLXA 2C95A 3MWYW 1GNRA 3L0OA 1YZKA 1IONA 1ZU5A 4X8MA 4AC9A 1SHZA 4ZCLA 5J4VA 4W5WA 1COWD 4L8GA 3SYNA 1E2LA 1JR3E 4B47A 4B74A 1T6NA 1NN3A 4XWOA 2VBCA 1G3QA 1R0ZA 1J8MF 2EQBA 4LDJA 2ZJOA 2V7QD 1R10A 3EPKA 1BYIA 1AIPA 2G1JA 2Z5FA 3KJHA 1II0A 5P21A 1E9FA 5JRZA 3K70D 3RC3A 1UBCA 1G9XA 2W58A 4TMZA 4BLSA 4C2UA 1HQCA 3BB1A 5IK2A 2G83A 1XD8A 1LTQA 1XEWY 4JLPA 2V4ZA 5CK4A 4JL5A 1VECA 2O0HA 1AKEA 2CHVA 5EUMA 3RRZA 4F93B 2GDJA 2QROA 2W2VA 5JJIA 5JBQA 1NBME 1T8TA 1T4GA 3IO3A 3T1TA 3NEYA 1W0JA 2WIAA 3PEVA 3WXMA 4TQ9A 3D8BA 2YWGA 2IYQA 2X2EA 1ZMXA 5JLJA 2J3EA 2ZRPA 3U7HB 5GVRA 3DL0A 4QBIA 2Z4RA 4ARZB 4URZR 3AP2A 1DOAA 2ODWA 4DB4A 4ARZA 1XJ0A 5FI0B 2PBRA 1E79A 4ZIRB 1NLZA 3C15C 4I4LA 3CX6A 4BEBA 4ZIRA 2FX3A 3Q8XB 3T1VA 1UDXA 3DO6A 4KYIB 2XTZA 3W5IA 1UADA 4Y0VA 1JEDA 1GG2A 2YOHA 2GF0A 4LPKA 5CLLA 2DCUA 4LC1A 4OQXA 1FQKA 2HT6A 2NG1A 1EFCA 1CJTC 2QSYA 2RGXA 1COWA 1ZW6A 3B1ZA 1NP6A 2V54A 3DOFA 1CRPA 1OV4A 4Q03A 1S3SA 4Z54A 2ZSEA 5K8LA 1OE0A 3QUSA 1JXMA 2D4HA 2Z0MA 2WJGA 4QM7A 4B44A 1R0YA 2V7QA 4URWR 1TF2A 3MWLA 4B6FA 1DAEA 1ZRHA 2C77A 2XSZA 5JWRA 3K70B 2J59A 4CEJB 2VP0A 2J46A 3CO5A 3QF7A 2NMVA 4TLDA 5AK0A 2DFKB 2OG2A 1W0KD 2OCAA 2HEIA 3EIHA 4Q02A 4TTPA 3B85A 2GA8A 1Z3IX 5KNBA 5L3QB 2EYQA 3AVPA 4A36A 4DLZA 1KK0A 1Z08A 2EWVA 4L9WA 5L3QA 1EX6A 1Y3AA 1E4VA 2ZRCA 4AKIA 1ZUHA 1AM4D 4I81A 4DCSA 2QG6A 2ZAMA 4B3GA 3SFZA 1G8HA 3NBYC 4DT1B 3ASZA 1AS3A 4EPTA 5AUOB 4DT1A 4PO9A 4PC6A 5EJEA 3THYB 1IXSB 1W4RA 2Q21A 4W5JA 2NPFA 5BW8A 3N70A 1M7BA 4LPSA 3THYA 1E6CA 3AKEA 4YLGA 2D2EA 3EZ7A 3A1TA 3RANA 2FH5B 3LNCA 3OESA 3I4LA 4OQLA 3GLFE 1W36C 1FNNA 4TWZA 3I5YA 5J4YA 1XTSA 3EG5A 4HAXA 4PC1A 4NZYA 3CF0A 3SU8A 4Q66C 2FEMA 1G4UR 3BK7A 4TZ0A 2BWJA 3C7KA 2BBSA 5A0FA 3HJNA 4TMXA 3U44B 5KDLA 3U44A 2MMCA 5KU1A 4QM6A 2FFAA 1GUAA 2FGKA 2PMKA 4RCZA 5L3SB 1TAGA 3C41J 2FF7A 4XWKA 1OHHA 4N0EA 4IOMA 1HTWA 5L3SA 1MRNA 3EZ6A 4D0LB 1DS6A 4ZV4A 3A6PC 1N6PA 1YZQA 2RKOA 1R7RA 4TYNA 2KE5A 3V00A 5J4LA 3PG5A 1XJQA 4AURA 1KI1A 3CF6R 2QBYB 2QBYA 2VSOA 4TT3A 3QSYA 2HYIC 3CRRA 3O47A 1KI4A 2PLFA 4Q00A 1S0UA 2OCPA 4KVGA 3IHLA 5FOSA 5FOTA 5E7MA 1XRJA 4UNQA 2VP5A 3GD7A 2AK2A 3KKOA 5C4GB 1W0KA 3PR1A 2OZEA 4BFUA 5TY0A 4AIIA 4IXNA 1AZTA 2E9SA 5JEDA 2V55B 2XXAB 1N6OA 4BZXA 2F7SA 3N2IA 4W9MC 3N2EA 2NO1A 2XXAA 1T3HA 2XJ4A 2C98A 2JASA 4QXAA 3TLXA 2IYXA 1I2MA 4LX0A 4EFNA 4GI7A 4QHYA 1SKYE 1XTJA 3PENA 2GVDC 2RHMA 1F2UB 2H5EA 2VPPA 3L43A 3QG1A 2A5GA 4URVR 1F2UA 1QHXA 1Z0AA 2ASEA 3A4NA 2DY1A 2DFTA 1F5NA 1XX6A 4LRWA 2XAUA 4ITRC 3ONWA 4LJ9A 5HE9A 2DWOA 2WWXA 4V03A 2P5SA 2RAPA 1U94A 5BN3A 1NKSA 4M1MA 2WIBA 3KJIA 3LW7A 1SVKA 5E4FA 4QRHA 4EPWA 2ZRAA 2R65A 5FTLA 1ZAKA 1G21E 1HE1C 4JLNA 4LJ7A 1NL3A 1KYIA 5KSPA 2XTNA 2ZJ5A 1NVXQ 4QJ4A 4HDQB 4TTQA 3UKDA 3W34A 4B71A 4IVQA 4GOJA 1DVRA 3RABA 2IUSA 4FMDF 4V02A 1PLLA 3KQUA 1KAGA 1GWNA 1ZP6A 3LW8A 1PV4A 4FD2A 4F4JA 3VNUA 4A92A 3IEVA 2V1XA 4NCKA 4WOPA 2VHUA 5FOUA 5CDFA 3LRPA 3CNNA 4RD3A 1XCGB 4OQFA 3TGPA 1N6HA 3FE2A 4DUGA 3K70C 2FPKA 1ZM2A 2Z43A 4F38A 4UKDA 2MSDB 3NHAA 3AVWA 3QE0A 4R2IA 4DLUA 3T12A 3NG1A 4FCWA 1NKTA 1W47A 2QPOA 1ESNA 1PUJA 2A2ZA 1KJWA 2R62A 4KFRA 3R7WB 2IF0A 2Z6VA 5H1YA 3R7WA 3GJ3A 3QF4A 5C2JB 1BH2A 4BZQA 4U5XA 1RRCA 1KJZA 2AK3A 2DFLA 4FXPA 1Z0JA 1P2UA 4KSCA 5H8WA 3EASA 1YKSA 4DSNA 1AKYA 5K8IA 4GDFA 1P9WA 3B82A 4Q9KA 3QVVA 5EE1A 2D74A 2BIFA 1QG2A 2PZGA 3A4MA 4LYJA 1RYHA 3TUZC 1EXMA 3KZ1E 2VTKA 5GJWC 1NI3A 1TMKA 1SZPA 2X77A 4IDPA 4TYWA 1DO0A 3FTQA 3A37A 4HAZA 5KTYA 3DEFA 2VIIA 3ZYCA 5DIFA 2H92A 2WKRA 4E22A 5B64A 3I3SR 4PZZA 5GJVC 2BKEA 4AYXA 3RS3A 1Q44A 1IBRA 2GK7A 3T34A 3EZFA 3NBFA 2HLDD 4LZZA 5FPSA 4ZI2A 3K9LA 2BM1A 2OBNA 2YNMA 1VHTA 4NYJQ 3MJHA 4TN1A 1YU9A 2NO9A 1FQJA 3KDSE 2BCJQ 1V43A 3OE7D 1IN7A 4IOLA 4EDHA 4DDWA 4HAVA 4JT4A 1IY0A 2J9RA 5IF9A 1WB9A 2ORIA 1IY2A 1ZM4A 3ZDQA 4A0FA 3E2IA 4AKGA 3AKCA 3LLMA 1OXSC 3PUWA 4KXFB 3RS7A 2WWWA 4LSGA 4BLPA 1FZQA 4J0QA 1FFHA 5JWOA 1XP8A 1U2RA 4TMVA 3VR3A 1M1YE 4RFVA 2BJVA 5TV2A 1TQDA 3I1FA 1E2NA 2ZTSA 5B58C 4ZI3A 2IXFA 2ZPTX 1JQLB 2G77B 2R6AA 1IM2A 5G3ZA 3OFND 3PEUA 2Q6TA 3DKVA 4NPHA 4B2IA 1ZM9A 4NCHA 3ZZUA 4IVRA 1M7HA 2PCJA 1TTTA 1MRSA 1SKQA 3CR7A 2XTMA 4RZUA 1G20E 1D6JA 1GRRA 4HUQB 5EXSA 3U3RA 1A1VA 2XZPA 4HUQA 4RVCA 1W49A 2WPDD 3CZPA 4UXIA 1JR6A 3MG9A 1P6XA 1YVDA 4NH0A 2GCNA 1KY2A 1KHTA 1RZ3A 3HU3A 4LJ4A 4US1R 1CF4A 3DPUA 1ODFA 2PZEA 2GWHA 2P0EA 3BH0A 1FMJA 1OFIA 4PHHA 3KX2A 3O8BA 1QHGA 1QVRA 3A1WA 1W5SA 2OXCA 3F0TA 1C1YA 1XMIA 4FW9A 4JJZA 5FPHA 121PA 3MJRA 5DYIA 2NO6A 1L8QA 2EWWA 2F3TA 1E3MA 3L8YA 4GNKA 1A2BA 4JLDA 4L9SA 2JLYA 2REXB 3KKPA 4IKEA 1V5WA 1YZGA 1VTKA 1LFDB 3IUYA 2BMFA 1EFUA 5DI3B 2RHDA 3PCRB 3N5CA 2JDID 2IF2A 3PEYA 5DI3A 1UKEA 3O8DA 5JHHB 1E0AA 4EPXA 2VH5R 1TX4B 1JAIA 1U98A 1DPFA 4Q1AA 1WDTA 1OYYA 1LS1A 3SQWA 2CEAA 2B8TA 2P6NA 4ESVA 3QG5A 1BO6A 4E03A 1N6KA 3H86A 5JFGA 5CLQA 5L8VA 1RE0A 3U7GA 1XEFA 3TVTA 4R9UC 4D81A 5LB2A 4XD7D 2YC4C 1VDZA 2FG5A 4XSHA 1DAGA 3OEED 3AUXA 3CPEA 3FFBA 5E3HA 4IDOA 4ASUD 3TH5A 1SVMA 1CXZA 2OCBA 4OJQA 1Y63A 3B1WA 5BYKA 2WKPA 2OT3B 4LJ8A 3OHMA 3B7GA 5DGXA 3Q9LA 4IDQA 4C0BA 1G64A 2OBMA 4TMTA 1HT2E 2J87A 5FBVB 2WPDA 5BQ5A 2GESA 2OAP1 3AF1A 4LBWA 5FTKA 1D2EA 3FHTA 2OESA 4Q7LA 2KB0A 3LA6A 5A5GA 1XTRA 1X6VA 4CRWB 1Q3HA 4XIGS 5FPTA 3QIAA 5CB6A 5JSZB 5DSZA 2WOOA 2GVZC 2A78A 2VLIA 1M34E 3QY0A 4PSKA 4OYHA 4DDUA 1G5TA 2J0UB 5JHGB 2QTVB 2Z4SA 1NN5A 2J0UA 2OLKA 1G6OA 4ESHA 2W0MA 4JLBA 5JI2E 2CVFA 4MKHA 4Q4JB 2J45A 2YHSA 3AQ4A 5EE5B 3X1YA 1ZNXA 1CTQA 4LUCA 4Q4JA 2O8EA 2BMJA 1CJVC 2QMUA 3EWSA 5TARA 3FOZA 4RD0A 1P4SA 4TSFD 4PPFA 1PUIA 4CIDA 5CM8B 2YWEA 4UNPA 4C4PA 1MABB 2JDIA 3LFUA 1G3UA 4NYMQ 3A58B 1XEWX 1MABA 1YR6A 2WICA 3BRWD 3I92A 4HB3A 4Q48A 4D4JA 1OB2A 4C7OA 1JEEA 1U90A 4LHYA 5TB5A 1ZIPA 1N6IA 1Q1ZA 4UQOA 3RHFA 3ZVLA 2P6RA 2OO7A 5AJVB 4KAXA 4QJ3A 2VEDA 3ND9A 1VCNA 3MLEA 3CIOA 1JQJC 3BE4A 1D9ZA 2IT1A 1SHKA 4PSAA 4KLZA 4KV9A 4JBXA 3K9GA 4XD7A 4A1FA 4B6EA 2V1UA 2R6DA 4RCYA 2ANCA 4ASUA 4B2LA 1OLOA 3AGPA 1GVNB 4D4KA 1E2EA 3K53A 4Z1MD 2YVUA 3G5UA 1ZJ6A 1QHHB 4A4DA 3R8CA 3VU9B 3WHLA 4O2LA 2BDTA 1QHHA 1X8JA 3H4MA 3VU9A 2ERXA 5LB4A 2FMXA 1KSGA 3SQXA 4H1VA 2OUKA 2XITA 3MAAC 3DVLA 1NJFA 2OSBA 2JLUA 2F9LA 2A5YB 3K9HA 1OXUA 3AF2A 2AHOA 1CJMA 4R2HA 4HZUA 4MGIR 1VG8A 1W4AA 1WXQA 3CLVA 4PO8A 4BECA 2GJKA 2VSXA 5IT5A 4OKSA 2G1KA 4QC2A 5L3RA 2VO1A 3OIWA 1O87A 2OCYC 2DYKA 2ZRHA 2V8OA 1XMJA 1E9RA 4LK2A 3SJBA 2FSFA 3FMFA 3SHFA 2PL3A 2ZJ2A 3OIVA 5JZVA 5K8TA 1MO6A 4MKGA 1P9NA 3LDAA 1ZNYA 1K8RA 4FIDA 4QKQA 1HY3A 1UDWA 1D8TA 2R6GA 2Q3FA 3UG7A 1H8ED 1YZUA 3H0KA 4G5GA 4DDTA 2RGNA 2RGDA 1TPZA 2ZRBA 5CDFE 3WBJA 1NSFA 3B5JA 3EZ9A 4BFXA 1ESMA 2ZUCA 4UNSA 4Q7JB 4KITB 1XPUA 3HU2A 4AK9A 4JT2A 1KKLA 4OHVA 5CB8A 3FB4A 4PPQA 5JCPA 3FYHA 4V0NA 2IYVA 1QHYA 2C2HA 3BB4A 3CX8A 5HR5A 4Q1EA 4GBMA 2AKAB 1U81A 1II9A 2RCNA 5FPKA 3I73A 5TVKA 1Z22A 1AS2A 2XJ9A 3ZVRA 4OQNA 4BRWA 1EWRA 4Z1MA 5KDDA 2C03A 3EPLA 1GNQA 3NDBB 1KSHA 1QBKC 5FPYA 1R5BA 1FP7A 3TW4A 2ZVPX 1XPOA 1NMYA 4ZDKA 1SXJD 3AV0B 1MKYA 2NO7A 4M1SA 1RC8A 1WQ1R 2H1LA 1ZINA 2JJ1D 2QP3A 1HE8B 4Q4AB 1GL7A 1SGWA 2H57A 2FFBA 1VMAA 4P0TA 4Q4AA 1DBSA 3Q5EA 4DCNA 4XVRA 3BAFA 2F3RA 2FU5C 2R2AA 5AR1A 1J99A 2WV9A 3IBGA 1ZNZA 3VKGA 2C9YA 4A2QA 5EXXA 2HF8A 2BCGY 2ZXUA 4XJXA 1DAMA 3ZQJA 3TAUA 5FR1A 3ASYA 1G7RA 4PQFA 4W7SA 4B2PA 4DC9A 3HYRA 1OKKA 3T1QA 4LV5B 1DG1G 5FUYA 4AG6A 1JPNA 1H8EA 4HEJA 5E7JA 4PANA 2ZJZA 3B2EA 5KNCA 4B35A 1GRNA 4XWAA 4G5OA 1ZD8A 1CR0A 2LCFA 2WWIA 5IRCD 4NKRA 1KSJA 4AI6A 3SS8A 3CRVA 3QJYA 2ZE8A 4G5RA 1KI3A 2IWHA 2QUZA 4KU4A 1E9SA 2MSCB 4URYR 3KKMA 3BBPA 3SNHA 2ODEA 4QJ5A 3AVUA 4OHWA 1CP2A 1QHSA 1Z28A 4V0MA 1W46A 2GEVA 5DO9A 1G7CA 2BEJA 3BD9A 4MRRA 1W4CA 3QPUA 3ADCA 2QAJA 2EVWX 2XSZD 4KBFA 3DMNA 3IQWA 3ZS9A 3ZS8A 1EFTA 2ZS9A 1XXHB 2JIZD 1SXJB 3LQRA 2A3RA 5FH9A 1ZNWA 1XXHA 2R9VA 2ZJBA 1SXJA 3F8TA 5CIQA 4ZCIA 4LJ5A 4UNNA 5FBRB 3WYGA 2OAQ1 1G7SA 2JJ1A 4R7ZA 1MR3F 1S96A 2W2XA 3AVVA 3PV0A 5EE0A 3ADBA 4DDVA 3DKPA 5EP3A 3FMOB 3QKRB 1G19A 5JCZA 1Z5ZA 3QKRA 4AG5A 5C1BA 1XTKA 3QBTA 1GKYA 1T5LA 1KMHB 1E9BA 2CCGA 1LVGA 5CYPA 4Q4LA 1KMHA 3RVBA 2N46A 1LF5A 1DADA 1TL7C 5TMPA 1Z83A 1VYUA 2JAQA 3KFVA 1CKEA 4XVUA 2RGNC 3IGFA 2X8AA 3HU1A 3QBVA 4V0LA 2WBLC 4CEIB 4BFTA 3LY5A 1JECA 4O2RA 4CEIA 8OHMA 3K0SA 4I1SA 4D25A 5KPDA 1SVSA 1SVLA 2J0SA 1SVIA 1OHHD 2VP9A 5LBIA 4D0GA 3I62A 4AKEA 2KBFA 5G41A 3IPXA 3LXXA 2I1VB 3NDPA 1E2JA 3U2QA 1IN5A 1KNQA 2QM7A 3W6PA 2ZRGA 1FMLA 1X3SA 5FUVA 4NCIA 1XZQA 4TT3D 3U5ZB 2CE2X 2XZOA 3LO5A 3AF4A 1YRBA 2FPMA 3ADKA 3QQ5A 3VX4A 1F3OA 3QNUA 2JIZA 3B78A 2G9NA 3MD0A 2AXPA 1NG9A 3WMGA 1NVVQ 1VCMA 4BASA 3ZZTA 2BMEA 1HH4A 4F4CA 1NVWQ 2D7DA 2LWIA 1FUUA 2R44A 4II7A 1M2OB 2CHQA 3SEAA 4ZPXA 3NIBA 2NO0A 3OF5A 3GMTA 1DAFA 1XZPA 5DLQC 4IOKA 1XMSA 1U8YA 2RGGA 3Q7QA 4FN5A 4YMWA 3PITA 5F9FA 1RRFA 1ELOA 1UPTA 3B1VA 4BFWA 1T9HA 1E0JA 4OJKA 1NY5A 2ZYTX 4A9AA 3QXHA 2ZQ5A 2RGAA 4A15A 4CVNA 3REGA 4JLVA 4IFEA 3NKVA 1EFHA 4Q18A 5FTMA 1XCPA 4TMWA 3GJ0A 2VQSA 2GZHA 4TYPA 1BKDR 3EIQA 2YC2C 4B33A 3NVAA 2IS1A 1E2GA 4BLQA 4C2TA 5KDOA 1N6NA 2P67A 2TMKA 3KQNA 2F1RA 1F48A 3L0SA 1RIFA 3C16C 3CH5A 2N42A 2WWHA 4DVGA 1E1QD 2XGJA 3QXXA 2GETA 1G8GA 1KMQA 4IVPA 5J5CA 5CM9C 2SHKA 4OI2A 2BHRA 4QBHA 3BS4A 1T3SA 3W3ZB 3TSZA 2PJRA 4RZ3A 2VHTA 4AKHA 1TEXA 1YZLA 2LKCA 3JZAA 5HZKA 4BPBA 1YZTA 4DUGD 3THXB 2YOGA 1SXJC 3THXA 2QMHA 2ZR9A 5HE8A 3CZQA 3Q7PA 4BEJA 4WZBE 4TLAA 3PEWA 3Q72A 1E9AA 4FWIB 1Z2CA 3GLGB 4F92B 5DISB 2B92A 3GLGA 4ON9A 4DB2A 4AY2A 2ORVA 4KHZA 1KO8A 2QAGB 2EFHB 1GZSA 3UWKA 4H1UA 2ZANA 4PHFA 2QAGA 4A8JB 1KI2A 3NH9A 4DHEA 1KAOA 3EA5A 4A8JA 2P5TB 5G40A 4FMBB 4PQYA 3VTKA 1X8KA 2GF9A 4JBYA 2FZLA 3OZXA 2F43B 4MGYR 1KO4A 2F43A 3AKDA 4WZAE 5SZHB 4M21A 3G0HA 4TZ6A 3FHOA 3THWB 2IS2A 4C0HA 4GP6A 1G18A 1ZCAA 3IIMA 3THWA 3KKNA 2IYYA 4K81B 4WIAA 2C9OA 1WA5A 5JS8A 2HUPA 1KGDA 1S2MA 1T0HB 3L82B 2G6BA 2ZU6A 4LJ6A 2GXUA 3A8TA 4RD4A 4URXR 3B9PA 3SOPA 4OHYA 4MRVA 4JSYA 1XJCA 1XFAA 2GZDA 1QDEA 2N1BA 4GL2A 1T8UA 2GBLA 3GFOA 1I4LD 3ZH9B 2B7BA 1KK2A 4IRUB 4WA7A 3LBNA 3AM1A 4DEXA 5L3VA 4MDFA 3DM5A 1IN8A 1KDOA 5FUWA 1E1QA 3GEIA 4JBWA 4WXRA 2QQEA 3VR2A 3I72A 2G0NA 4Q9JA 2WOJA 3UIEA 4NL4H 4I1VA 3AF3A 4BRUA 2VHQA 1L4UA 1KSFX 4FMCB 3W5JA 3QKUA 1ZYUA 1NLYA 4DCUA 1FX0B 1IJEA 3DZDA 1FX0A 1XNJA 2QE7D 2AWOA 1VYVA 4QHTA 2E1RA 4NONA 1S1MA 3T5DA 4ZDWA 1R5NA 5FOWA 3A1VA 2EFCB 3NTUA 3W9YA 1U0HC 4YXWD 1RKBA 4BZPA 3CWQA 3QPWA 4HLUA 3MMPA 1UKZA 3QF4B 4US2R 4QGFA 4PSVA 2W6ID 3VMFA 4HYYA 4D2IA 5F9HA 1H8HD 1CR2A 2PX3A 3D31A 4YQFA 2XB2A 1HT1E 3B1YA 3RDPA 4G1UC 5F98A 4XH9B 3GLIB 5CK5A 4M1YA 4Z8YA 3QOFA 3GLIA 5M04A 1N25A 1N5LA 1IOZA 5KSZA 3SHWA 3LBHA 4LI0A 4CT4B 3AVTA 4LWZA 1S1CA 2LKDA 1P73A 1XD2A 5BN4A 4BFSA 1G6HA 2IHYA 3VX3A 3WP1B 4A6PA 1ETUA 1SULA 2WAXA 3MWJA 3K0AB 3L8ZA 2ERYA 3WMEA 1N6RA 4LYFA 3ND8A 3SN6A 3K0AA 4H9GA 3QKTA 1S9HA 3K0FB 3K09A 5AJXA 1I4TD 2HV8A 1F2TB 3K0FA 2JLWA 3VNVA 2EFDB 2W6JD 1F2TA 4P3YA 3RYTC 2K5UA 3GLHA 3M1IA 2HCBA 3QENA 3TUIC 2AL7A 2VP2A 4LHXA 5HKKD 1DE0A 4Q4HA 3SBDA 4Q5IA 2GNOA 1KI8A 2PMDA 3K1JA 1E4YA 2G88A 3CRMA 5JECA 3UMRA 1MO5A 1W5TA 3CRW1 2CXXA 2IYTA 2EFGA 3T1OA 2XNDD 4RD6A 4X8OA 4FINA 4YC7A 4GRAA 2QE7A 1Z07A 3DOEA 1JXOA 1EFRA 1L7VC 2AR7A 1E2IA 4OQMA 3M4YA 1LB1B 3D3QA 1KIMA 2REBA 5KNDA 1DAHA 1J90A 4U00A 2FFQA 1JALA 2JLSA 2WJIA 4F4IA 4IJMA 1RFLA 1XXHE 2OLJA 3GCGA 1SXJE 1Z6AA 3CPHA 4YXWA 4M8NE 1E2FA 1HEIA 2QAGC 3D7MA 3SFVA 2A7QA 4ZDIA 2C78A 1OW3B 1GFIA 2ZR0A 2W6IA 1IN6A 4MRNA 4A8JC 1H8HA 2VF8A 3RSLA 3AUYA 4GPTA 1XBTA 3R9IA 1GL6A 4M22A 3QKSB 2O5VA 5JEEA 2J7KA 4MKFA 4Z8XA 1OH7A 3QKSA 2RGCA 2RB4A 2RMKA 2IA5A 3AVOA 1DO2A 3SJAA 1Z06A 4NCJA 1F60A 3FHCB 4NHOA 4I1OA 1N0UA 1Q1BA 1XTQA 2AKYA 4CGZA 4MYTA 2AXNA 3TE6A 3LWNA 4Q1CA 2Q9CA 4KJZA 4Q7MB 3EWAA 3BXZA 4M9QA 2GBLC 2FSHA 1UKVY 2FA9A 2O0KA 2WZQA 4HAYA 3RAPR 4DBLC 5D3MB 4PZYA 4C7OB 5D3MA 1LNZA 1UF9A 3UMFA 1Q22A 3U61B 4C9BA 2W6JA 4EIWA 3W6NA 4GMDA 2ATVA 3U6BA 2PEYA 1UBEA 5HKKA 1E9EA 1CULC 2BC9A 3EIEA 1B0UA 4XVQA 2FFHA 2IXEA 2IWRA 2GJSA 1DELA 3EC1A 1UBGA 1TNDA 1KNXA 3WNCA 5C46F 3E70C 1CR1A 1XCMA 2IC5A 2XNDA 1W2HA 4ILEA 1FPMA 1PLJA 2PEZA 3DHWC 1SVOA 2R8RA 3TQCA 4EFMA 3THOA 4M1TA 4WW0A 1CS4C 1E96A 1F6BA 2CMKA 3UPUA 2OFOA 1D2NA 2G0TA 1A5TA 1GTVA 4DKXA 4NP6A 2CE7A 1VCOA 4DJTA 2ZI3A 1GL9B 4HLUC 3T35A 3K0EA 3P27A 3VR5A 2Z83A 1KY3A 3CONA 3WYFA 2JLVA 2VP4A 3CNOA 2PX0A 4KBGA 2QP4A 3TMKA 3RS5A 1ZIOA 2D62A 2NQ2C 3SJCA 5K8UA 1KDRA 2FV8A 4JYBA 2ZYVX 1E2MA 3VKHA 1IJFA 1ZC4A 4I99A 4NYIQ 3RWOA 1VPLA 2VL7A 4A0HA 3DDCA 4GT1A 1NMZA 1II8B 1XF9A 3NEJA 1II8A 1CR4A 4NYMR 1Z6YA 3CM0A 2JLZA 3KXIA 4JKIA 4HDOB 5GJCA 3J81k 3AH8A 3IIKA 4IHQA 1NJGA 3MFYA 1GRQA 3VR6A 2XNSA 1W4BA 4FCTA 4LC0A 3V9PA 2YWFA 2W00A 2YINC 3K09C 1Q21A 5EZ6B 2YYZA 4NBSA 4DCVA 4EJSB 2CVHA 5HCNA 5LDDC 4PFSA 3U7FB 3RSOA 2O8EB 4QGGA 4LBVA 4EJSA 2HDNB 1IN4A 2GRJA 1Z63A 1YE8A 2ORWA 4C0KA 721PA 3JVVA 1OXVA 1E9DA
chains in the Genus database with same CATH superfamily
1P4JA 5JU6A 3CGWA 2R00C 2NU8A 4Q7KA 3RJZA 3AV3A 4UTXA 3UTCA 1DMSA 4NC9A 1LDEA 3LT1A 5A4JA 4JLJA 1WSWA 4X20B 3UOWA 3R0QA 4I4TA 3PEEA 4XYEA 2OHGA 1K75A 4N9QA 1HQYE 2BT4A 1Q5PA 2IPAB 3OZSA 1U7DA 4JQYA 1SCQA 2TSYB 2HCTA 4J1SA 3D9QX 3S1AB 4U1RA 2P65A 2O50A 3RNLA 2VH1A 1ZWLA 4MITA 5D7NA 5G0SA 1RFGE 2CLOB 3U3KA 1EDEA 3DBHA 4U3JA 4P7FA 5FWYB 1VLVA 4M0LA 1EE1A 4NULA 4K03A 2RE8A 3GYBA 3TCNA 2HR1A 1UBJS 4WOKA 2X1MA 3N8HA 3TF5A 5I01A 4QGHA 1AKVA 5IAKA 4I5GA 3U3JA 4GICA 4R0MA 4RTOA 3FNIA 1YHNA 3I39X 2PSDA 2V59A 3OLCX 2BSQA 1XNQB 1NM5C 2XY4A 4M1OA 1ISHA 1X7DA 3H87A 1PZMA 2V7UA 2QMQA 3M0EA 4RK1A 3H1EA 2NTNA 4HZUB 1SQGA 2XVZA 4JJAA 4W6ZA 1ZC3A 3TLGA 5AHRA 5C7OO 4KXNA 3HI4A 2VA8A 1SPBS 5FWDA 1E2PA 1QG4A 5IX8A 5HCIA 4D9BA 2C5LA 1Z4QA 2PGDA 4AXBA 5KOJA 1TQ4A 1UBFA 3DDNA 2Y8EA 2BW0A 2CJWB 2NLOA 3FNFA 1M8KA 2O3QA 1KRWA 1M54A 5JBNA 3BFVA 3EIUA 3EX7C 2FEAA 1QV7A 3CO0S 5FA8A 2F3PA 4BLRA 3KQHA 4Q6BA 1CP3A 2JGLA 2DFPA 2QUBA 3AEQA 3CUWA 3Q6MA 3T61A 4CZ2A 2Q5HA 4P34A 1OT3A 3TRIA 2KQUA 1I7NA 3NC1C 2AOUB 4MI6A 2NM0A 1KOFA 3IUSA 3NTQA 1OKKD 4L3VA 4BFCA 2PZJA 5EGNA 3L18A 621PA 1MW8X 3BMOA 3UANA 5BWNA 3ZWAA 3WGJA 3ZI0A 5LMNB 3AVQA 3C3YA 221PA 2V4UA 3DCIA 2PU5A 2ZITA 3HKCA 3QFHA 4XVCA 3TI9A 5HIKA 4W99A 4HFJA 5EFOA 2QPTA 1UZMA 3DS8A 1VG9B 3LHSA 2JCXA 1V8ZA 2QRLA 2FOLA 4CWAA 1PEDA 1YS6A 4BX9A 5T8KC 3RTDA 4ND2A 1MENA 3F8WA 4FCCA 4EG6A 4FNGA 1K5GA 2ROQA 1NVTA 1YB5A 3PX7A 1QF7A 3OCJA 3JQCA 1FE8A 5FX2A 2VR1A 1WZNA 3B13B 1QLWA 4HPJB 2H11A 3GLSA 4RFSA 1G3IA 1SHTX 3CLKA 3AIKA 4ARAA 3UXMA 3VH4A 2WJVA 4X1IB 2H9IA 2V7PA 5DNUA 1TADA 4G0NA 1MJFA 4K1XA 3SYKA 4MVJF 4QLBA 2NZJA 1ZXLA 4N03A 3Q88A 3EJ6A 1EDDA 3KLNA 2CK3D 2P7IA 4N0DA 1O9BA 2L82A 1E5VA 5J43A 2V4MA 2W11A 3N0TA 5DLEA 3CF4A 2JFNA 2AF4C 4F85A 1SUFA 3JR7A 3MTQA 4MGHA 2QQGA 3ZEAA 1N2OA 3GIWA 4PLHA 1WQ4A 2WTBA 5AI0A 2W6PA 1V9LA 2J5QA 3BGSA 4P7BA 1CRQA 1NRXA 1PHPA 2ZULA 5GZ3A 2VBFA 5K6RA 1U0EA 2VZLA 4PINA 4UBLA 4V2IA 3H1TA 4GZ6A 4LHZA 3CRQA 1ID1A 1LPPA 3JASB 5J40A 3EE6A 1ZK1A 1B42A 1NYLA 1RLIA 5COBA 1WCV1 2QI9C 4A6DA 1Y1SA 3QI2A 3LUDA 3JSAA 3W5VA 5KS2A 3ILVA 1I0IA 2O2SA 3E53A 3GPDG 3JYLA 2CZGA 1TM4E 5C31A 2NGRA 3FG9A 1JMVA 1AKWA 2VBIA 3C14C 4HZGA 1UDCA 4PVDA 1O6CA 2OHFA 3I0MA 3JQGB 1NW8A 4H60A 1ADJA 5IP5A 3RODA 5A1TA 1T10A 2RBKA 1IY1A 2Z1MA 4GQAA 1U0BB 2HLHA 1MH9A 2WHRA 4PRKA 4Y2TA 5IHPA 1DXHA 1E6MA 4WBXC 4HNHA 4BGIA 2QUIA 1Z39A 5H9WA 4DWJA 4BB9A 3CUTA 1N36B 4KQHA 2IHNA 3QV2A 3IMCA 1BROA 3CLUC 1UJ6A 3I01M 5EQDA 1GDTA 4OKNA 3CJQA 4WBSA 1GAQA 4YUZA 2DPHA 2Q4RA 3F7NA 4ZVRA 1B1AA 5AM0A 5B58T 4BL5A 4ZCMA 4I8IA 3KS9A 3FI0A 1I0ZA 1OFTA 5KOIA 3SX4A 3IHWA 1IAQA 4K1LA 4M99A 4FIZA 2YASA 3RAGA 1MEOA 4PTYA 3LCUA 3FKSA 2IYLD 4K8OA 4TZKA 5E6RA 1R8QA 4X84A 2B4AA 2XLCA 3SQOA 3K6KA 1J0EA 1MH1A 1ESDA 2PM8A 1FB5A 1QS0A 2C4TA 2CLCX 3F5DA 4LYHA 4HYTA 4GIBA 1J6UA 2WJ6A 2PUGA 5AW3A 2ODBA 3FPAA 3ZTWA 4RZXA 3RB8A 4PNEA 3KE9A 3GU3A 2VWQA 4BO7A 1RZRA 4KPGA 3HHPA 4D92A 3PWTA 3DVRX 4IDHA 5A9SA 4JX9A 1VKRA 2FN4A 1R4NA 3AYZB 4YJHB 2G3YA 4X24A 1KYVA 2QZSA 2C4HA 1PV2A 3T9FA 3WNDA 2ZS7A 1PSWA 5HUHA 3D0RA 4Y1RB 1D7OA 4EBFA 4EITA 4DIEA 3COYA 3UT5A 4OLFA 5FUMA 3SC4A 2R8ZA 2O2DA 1GM5A 5GVSA 2UYHA 3BYZA 1QVZA 3SQDA 4MRAA 2C5SA 1VKHA 3EVFA 3JQBC 2E89A 3I8XA 4J90A 3RARA 4DIMA 2D54A 4P82A 2YRWA 4LOLA 4AICA 3ADDA 3R0IA 5LYYA 5IVHA 4FOLA 1PW5A 2QGZA 5IG2A 3H6HA 4ZV7A 4CR7A 2YV1A 2AFHA 3I6BA 1Z75A 4Z99A 2WFZA 4O3MA 4MTCA 4N5IX 1DRJA 4TOIA 3ZZMA 5H4HA 3W4IA 2VHJA 4ID3A 4JS0A 1DWOA 2Q2OA 4Q01A 3CB2A 5EGSA 1A2QA 3K20A 4XUDA 3KKEA 2HHLA 3PA6A 5EP2A 1VE9A 4ZVOA 1MORA 3GR6A 3PC8A 4G23A 3ZDRA 2A9VA 4KE9A 1ZN9A 3EGOA 5E6SB 2R2GA 2PT5A 4MICA 2X0FA 4MLZA 4LJLA 4BP9A 3VR4D 1G20B 3DKIA 5BW5A 1WNFA 2W37A 3HS3A 4FFPA 4QUAA 4QDKA 1DIBA 1QNLA 4OYYA 4PF1A 3ABRB 1M2WA 3B6EA 1JJVA 5B1SA 1VLMA 1Z6XA 4M37A 3X2EA 4EMSA 4YMVA 2VJQA 3X1DA 1BA2A 1VLQA 3SE0A 3TIFA 3ZJ5A 3HUDA 1RMYA 5KSYA 4F3TA 2GZMA 3MWDA 3Q0EA 5TPWB 4WXHA 1DKMA 3AESB 1A4RA 1RLJA 3KVOA 5FNVB 1AF4A 3GOQA 4GECA 1XG5A 2AEJA 1T2AA 4BKPA 2RGEA 1QIHA 1O5TA 3MQFA 5LU8A 2FF5A 3JQ9C 3G68A 1U6KA 2DR3A 1MB0A 1RXIA 4IXMA 2VYCA 1F4LA 4KDEA 4NG5A 3GEHA 2A9OA 3INNA 3K94A 1ZA1A 4NU0A 2P6PA 3K96A 3KIPA 2QX8A 1QPBA 4IFBA 4JUFA 4LXIA 2PUBA 4JZYA 3ZLVA 3NC0C 2B8WA 4KUHA 4BY9E 2FRXA 4MVJE 4FMDB 2ACKA 4B34A 4EHBA 4AQ7A 5GINE 2ZB7A 5T5QA 3WSTA 3U49A 2M9MA 3QW2A 4B8WA 1LRLA 1H2BA 2VYFA 3MRSA 4S3MA 1AKNA 4RQUA 2OGWA 4FBGA 2VRCA 1L7EA 2QLNA 2KSQA 3H42B 2Q9AA 3AERA 4WVFA 1C0EA 2YIJA 3VYRB 1XDBA 4KR7A 4E5PA 2GJ4A 1YR8A 3KL4A 4FSXA 4CEJA 4RMHA 2O59A 4PRLA 3IJ5A 5JFTA 1ZJJA 2I4OA 3BC1A 3CXRA 2QAIA 4QICA 3VGJA 2Z6UA 3OBBA 1VSTA 3G82C 5KJ6A 4PAMA 4YJ2F 2QRJA 5TRTA 3OEHA 2L17A 1SBZA 3K8YA 4B6JA 4OM7A 2EARA 2YZ2A 2JCSA 2PVCA 4PPNA 4DLAA 5ARBA 1XLTA 1ZK4A 1ZOSA 4WZZA 3EEIA 1JB1A 2NYVA 5TF4A 2IXGA 4F2HA 1XZAA 1US8B 4LTDA 4QULA 2CNWD 2ZSBA 1BD4A 3JS5A 1LD3A 3W5UA 4B3FX 1S8FA 3DHYA 3NYWA 5JAPA 1M1XB 3BM5A 3Q41A 3KAPA 1MG0A 4BQQA 2DFNA 2V97A 3WFIA 4YMHA 1ESEA 4HZIA 2DUMA 1J07A 1RKXA 1ZBQA 3GF4A 2VCHA 4J1QA 3SYLA 4MIEA 1VE5A 4MA4A 4D9IA 1RTTA 4OJMX 4OXIA 1XQYA 1NW6A 5AXCA 2FZVA 3B51X 2C0CA 2AG0A 5FHQA 1VJDA 3WOHA 5LIRA 1VMDA 1PX0A 3UHFA 4M1KA 1UJ4A 2VK1A 4Y6SA 2QL7A 2MMGA 4AZ0B 4TV8F 2GARA 4XRRA 5CBPB 3BGWA 3SYTA 1CUHA 4MUBA 1JW9B 2IYOA 3FWYA 4RM2A 2R8EA 4EPYA 1NAHA 1JGTA 1PK8A 1Z16A 3O1HB 3WIEA 5H70A 1RPZA 2ZSDA 4GGOA 1KE1A 1IULA 4ND4A 3UATA 4GXTA 3W2TA 1MBZA 4EUNA 1JNXX 3DDHA 3BZWA 4ZHSA 1X7XB 1FFDA 1JDPA 3QWBA 2O8DA 1ECCA 1ZN8A 4IO0A 3RS2A 4NDAA 4DMHA 1R00A 1C3XA 1NOIA 1E1CB 2EFYA 3E1SA 3KQTA 3Q5GA 1NR7A 3B6ZA 2DBYA 4PC7A 4EHJA 1X7YA 2WYVA 6LDHA 3UHAA 1GRCA 2QR2A 3BIFA 1QGED 3VPAA 1G16A 1ZVQA 2HRBA 4YRBA 2FNAA 4KODA 4XLLA 2X4LA 5THQA 5LP1A 3PE6A 1M6NA 1LCIA 1WUYA 2HWXA 2QL5A 5D51S 5FV7A 4ETMA 2H4ZA 1SQ6A 4DBZA 2X9NA 4H7HA 3A28A 5E6UB 1Y3BE 1NJSA 1ZESA 3TGLA 4ZYUA 2PMWB 1V8DA 1P9RA 3EARA 2XHEA 3A6KA 3BWDD 4N8EA 2OL4A 1EHCA 3CYFA 1THMA 3OY7A 5TDHA 2QRVB 1YI1A 2I8AA 1CETA 3QLUA 4LXTA 5IMSA 5I8WA 4IIYA 1A9XA 3ZE8A 1E92A 4PZAA 4DA0A 1BN6A 1G8FA 2HQRA 4HXFB 4L15A 1JSRA 5F1KA 2Q5CA 2XEDA 1XELA 1V11A 2OQVA 2YJ4A 1QC5A 4DRZA 4FKBA 3ZD7A 2ZE7A 1Q1AA 3LX8A 1L5GB 3INTA 3PR3A 1SN7A 5EQJB 4BJ1A 3R20A 4M53A 2FSPA 4J4BA 4F71A 1VL0A 1JQBA 1E2UA 5SICE 5A03A 2XEXA 3MCWA 1RAEA 3DXYA 3FRIA 3AP3A 4IEEA 1HURA 1QSGA 3JYHA 4U2KA 2LV8A 1C8BA 3UCEA 3WNQA 3ZXXA 1NNLA 3G9TA 1E94E 4RACA 4AWXA 4YMSA 1HFJA 4D3XA 4ZTUB 1TGVA 4G1EB 4L57A 4UBJA 3VSAA 4DSUA 4N0PA 3AUTA 3C97A 5D1NA 1U0RA 3C8MA 3L9XA 3I2IA 4NMXB 1A96A 1OBOA 1NUSA 4B3BA 2P3SA 4IIJF 2BHTA 1B6SA 3LZCA 4H27A 2GXQA 2N0SA 1Y8CA 2OMKA 3AFMA 3IIEA 5CFMA 2O5RA 2Q49A 4KZKA 4EB6A 1BE8A 2ZYUX 3EPHA 4J7AA 3WISA 3DZIA 4EJ0A 1C1DA 2G0AA 1ECGA 3ZVMA 3KR1A 3WO0A 3LY8A 2UYGA 2OG1A 3C8ZA 4HRXA 3SX2A 1RTKA 2EJCA 4HDKB 2VKQA 1IXRC 2Y76A 1H6AA 4WNIA 3GLTA 2AOVA 1EVEA 2FW0A 3GUHA 1NX9A 4D4MA 2IDKA 1N1MA 3OTHA 2VF4X 4OO3A 1Q7GA 1R6BX 1TYAE 1XZFA 4RA9A 4I9NA 3ZU3A 5JDIC 5C53B 1M5TA 5HNKA 1Q77A 5EIBD 1SUSA 3DAPA 2B7LA 3FDJA 1WPXA 4RETA 4D2IA 2C04A 5L7WA 1C5KA 3ETHA 2PGIA 2CLLB 1RQRA 1PT9A 2I1LA 3B3JA 1ORWA 3S7TA 7MHTA 2ID8A 5KUTA 2XZLA 4P98A 3TXXA 1PU2A 2J0VA 2I3BA 3LZDA 4CXMA 5B55A 1QIMA 1UQUA 4P33A 4YT4A 1T15A 1JP7A 2BR5A 2UV8A 1IQPA 1DTSA 3VOSA 3HXQA 1FJGB 1UZLA 1VQ1A 3OEYA 4RKEA 5E2IA 3ZZ1A 2BFEA 1RQLA 4L08A 4CCWA 2E5FA 1U63A 4Z53A 4K6GA 3W5DA 3TLEA 3U4DA 2X4GA 3ABOB 4XYLA 5M34A 2ONCA 1FDVA 3UXHA 3ZWNA 1CRLA 3R3JA 3CPJB 4TUYA 5CCBA 1NKVA 2D2IA 3G9QA 5E7IA 3WK4A 3DE3X 5B3JA 4D6PA 4MS4A 3G8CA 3PDWA 5HUQA 1GILA 1C81A 1HT0A 1RWQA 3G7SA 3H4IA 1D6NA 3U4QA 2ONKA 1R18A 3KQOA 5CIWA 5B7PA 1K92A 4UM8B 3ZXSA 4QAJA 4E2WA 1CQIB 3H05A 1OIXA 2FG7C 3MT0A 2A84A 2P2SA 3SQNA 2QQ0A 2PXCA 2R5NA 1P3JA 5JT1A 2VUIB 4JEIA 1Z6TA 4RK5A 3TLMA 3E8SA 3GRUA 4DXDA 5E3JA 1VE3A 1KI6B 1O96B 2WFMA 4FQ8A 4IDNA 2IY9A 2C0PA 3IDSA 1YRLA 3CLSD 1FTSA 1FOEB 3EAQA 1I5EA 1S4QA 3KJEA 1SEPA 4R98A 1FLAA 5HFNA 3HGMA 4PNPA 4JLOA 1J23A 5T4FA 1T4BA 4PGAA 4B3CA 1C4WA 1U5BB 4CLXA 4EGFA 3DTTA 3IS3A 3OT1A 3OTIA 2AFIE 5BSTA 3HJCA 4PC2A 5L4SA 3HJBA 5KNBH 2PIAA 3FMPB 4A73A 3GBSA 4L51A 1M2FA 1C3OB 1SUAA 3E9RA 4Y0AA 5DI9A 3GB9A 3EW9A 4UQLA 5CBKA 3FHJA 3C5HA 3DR3A 4LQLA 4MQ6A 4TV9B 1U9IC 3KWLA 1HOXA 4NH4A 4XTCS 3SJZA 2CHFA 4EBBA 5CB4F 1MT0A 1QHNA 1T26A 4D82A 1FLVA 2BEUA 3PIIA 1R4AA 3AFGA 1YXMA 2XTJA 2CL6X 1P1CA 1JR3A 3AC0A 4M76B 3STTA 4YLYA 3BICA 4PEVA 3ELWA 1ZSYA 2P4QA 4J6FA 4JSRA 5AUQA 2MSEB 2IHKA 5JD3A 2I4MA 3PNQA 1Q57A 2COUA 3Q5DA 3PUVA 3ECCA 3MBKA 5IS2A 2PIDA 3LAWA 1PN3A 3LYLA 4M2LA 1S2DA 1IHDA 1ODCA 3P94A 3V97A 3QVJA 3GGDA 4NMHA 5DMXA 1HTBA 1W1WA 4JB2A 2FPGB 4ZVPA 4B7AA 3QY9A 1V8OA 1Y7LA 3SZRA 1D9XA 3CEAA 3PFNA 4TL9A 3UN1A 1A7AA 1LY1A 5H81A 1ZEMA 2NV2B 1Z8NA 3PXGA 4KVZA 2B21A 5BSRA 3TRKA 4N4AA 4DLRA 4HY3A 3LLVA 4IIXA 3I32A 3HUTA 1NBMA 2AG6A 5CX4A 5FDFA 4AM8A 4MWEA 2ZCVA 1VGRA 2VNIA 3G13A 4W1SA 2BGJA 3E9QA 3OFVA 3B9QA 3T6KA 3C6QA 2OSVA 3AVYA 1RXSA 3IAS6 2QMEA 4DQVA 2Q3JA 1BDJA 1W44A 1T8SA 3NONA 4F6LA 2F6RA 3SEQA 5KQSA 1KU0A 1QZ3A 1TUEA 4TYYA 1X0VA 4HJRA 1W94A 1AQUA 4MAMA 2TMYA 3RJMA 4TKUB 3HJRA 4X90A 4EA7A 1UJ2A 1XZDA 2RH4A 1SA0B 1C41A 1PR6A 3E3MA 4LYAA 1NIJA 3OE7A 3AZQA 4GKVA 2ZRJA 5ALRA 4D02A 2CNKA 1A77A 3ETGA 2RGWA 3EXIB 1L4YA 1LI7A 3NWJA 1L7BA 3PGJA 3QKWA 3RRJA 3IKJA 4WI1A 3X1WA 2CC2A 4G56A 2BV3A 1NBOA 5BSVA 2BGKA 3PYXA 2BUCA 2X8LA 4ND8B 4PYLA 4ZOQI 2VP6A 1QLHA 2HEGA 2GLUA 1V8PA 3HVKA 3QTTA 4CL2A 4S1WA 3AWIA 3IMEA 2QLLA 1DJQA 3SR0A 1Y37A 4QJBA 4WESB 4QU0A 1OAOA 4RV9A 4CF7A 2QZ4A 1O0CA 2QT1A 1XZMA 5JQGA 1DNPA 4UM5A 3AT1A 1NR1A 3C0KA 4Q7EA 5F51A 1TVCA 1DMRA 2G4VA 4V24A 1AG9A 3UHOA 1GTRA 4ZYYA 3AFOA 3MMZA 2P7HA 3OFNA 3QTLA 4Q3BA 2B1GA 2ZJYA 3HSSA 4RE5A 5DRYA 3NUGA 3TKLA 4BUCA 1QX4A 1E18A 5F7OA 4F46A 5JWHA 1JIJA 2ZM5A 1T3ZA 1T5DX 1X38A 3A7DA 3E7XA 3HU5A 2PH1A 4MLCA 2G36A 3SVTA 4C07A 3AXSA 4AF6A 4U2FA 4QUIA 3W77A 5J3JA 4FFBA 1YUNA 1ML3A 4DV5B 1MD9A 4EGCB 4UULA 1ORRA 3UY4A 3VVLA 2H52A 3EA0A 3BCSA 1FC0A 3QXSA 4CMKA 2GD2A 4ERNA 3AY7A 1N8KA 2RHLA 5GP1A 1XI2A 5BXYA 2YKGA 4PYMA 3GVHA 1E1RD 3LT4A 2PGNA 3LRTA 3M70A 1HA3A 1TF7A 1A82A 1I2DA 3GLFB 2I7CA 1JDVA 5HP4A 5BYAA 1EP9A 1KO1A 3MXOA 4S1PA 3ZIAD 1E3WA 3UFXA 5IEJA 2PKCA 3DXZA 4XGNA 2EKLA 2Y2VA 2IS4A 1PIWA 4PX5A 2FSSA 3IP6A 1D1SA 2EC5A 3IPLA 3KB6A 3NHKA 2NZ8A 2ZRFA 4AUMA 3O94A 3TX6A 3BWCA 2C1EA 5TQ0B 1U0LA 3V3KA 4LF5B 5TNXA 3N8GA 4E08A 5T3UA 5EIBC 1EWTA 2QTLA 4R1OA 1VMIA 2OBYA 2YMMA 4M9SA 2W42A 5BSGA 2XDWA 1OIWA 1WPQA 2FJ0A 3PDUA 2DFDA 4MUHA 3UYKA 1EA7A 1G8PA 3EXAA 2AQ8A 3HPQA 3V4SA 1UR5A 4EW1A 3DBOB 4LS3A 3KM0A 3TZLA 1VKNA 1XCOA 3GBPA 1FDOA 1OWMA 3PDIA 1T1EA 4PICA 3USZA 1N5KA 2BMAA 1PWXA 10MHA 3TLYA 1GY8A 2GPSA 1WZEA 2FRVA 1E5TA 2OO5A 5KYXB 3FSGD 2XXBA 3KO8A 4RKQA 3NHBA 1LS6A 2B4YA 1EDOA 1LZKA 1RNLA 3CX7A 5AI6A 4CTKA 3OAAA 4POOA 3SIWA 1VHLA 1RQ2A 3WB0A 4U63A 2FOXA 5ALHA 4PWYA 4IXTA 4L4ZA 2ENWA 1U4OA 3TVDA 5AMXA 1Z8FA 4PCVA 4YAEA 3SHQA 4E2XA 1OJLA 1ZUNB 2BHLA 1QCDA 4WWHA 2AI1A 4B6SA 3ZV4A 2R86A 2NAFA 5BUCA 4QU9A 2P62A 1B73A 2A9KA 1DAOA 3U56A 3GJ8A 4DG9A 1OC4A 3P20A 4X1YA 3QX7A 4HNTA 2C7RA 4FJ1A 4EOGA 3X44A 4CU5A 5J58A 1GAEO 1CZNA 3R7SA 2X7HA 2GAIA 3WFZA 4O3FA 3R5XA 5F1PA 4N5NA 3CLSC 4OUDB 4EZEA 4DV0B 4HDSA 4O08A 4QATA 4DDMA 1K3UB 1UBLS 1E63A 1V5FA 2FWJA 2WF7A 3NHSA 4G85A 3R3VA 3GFTA 4UHKA 5JBIA 3C1UA 3SZ3A 4W63A 4AJPA 3MAJA 2UZ1A 4E11A 4G3XA 3EY9A 3R0XA 2W83A 5J2UB 1B76A 4YDSA 2ZWPA 4OV6B 1FFXA 1G21B 2OV6A 4ALNA 4FTWA 1DQSA 4YAGA 2I6GA 4GYKA 1ZN7A 1YR3A 2H54A 3BMNB 3H0EA 3KPYA 3GFVA 1KZ4A 4X6XA 5ALTA 5HK8A 4GP9A 3G17A 3GFGA 3ICPA 1UMCA 4ARVA 1XJWA 3FPKA 2QD2A 3GEEA 1W85B 3HP4A 3KB1A 4UTVA 5IAGA 4CG2A 3T4PA 4KDCA 1X9GA 1Z8HA 2P35A 3IP5A 3OMLA 4D0NA 3DEYX 5J2TA 2HADA 4O0MA 1X42A 4BNWA 4Q1BA 5FL3A 1L7RA 2Z8YA 4Q1FA 4DCTA 2W8BB 3AUJB 1M2JA 1U9JA 4RAQA 1U8FO 3NHZA 3BTVA 4ZHQA 3TR5A 3RSGA 1K5PA 4QECA 1HDCA 1K6IA 2GKOA 1GPKA 5KKNB 4F5DA 4P7KA 5AW1A 1DXOA 4TKZA 4GPZA 3IOYA 2IU4A 3HRKA 1QDLB 1N5RA 2ZBEA 4HB0A 1H1DA 3WL6A 3L8GA 2IP1A 1NJ1A 4YO7A 3LX6A 3D4PA 3B9RA 4NQRA 1ATZA 5ALJA 2BI8A 2PGAA 5BQOA 2ZSUA 5MGBA 3O3NB 3SNKA 1L3IA 3UWOA 4Q24A 2F1IA 2PVPA 3TLAA 2VVTA 2CHGA 1WMBA 4ZYXA 1WB5A 4MPDA 2ZJAA 5A9RA 4QXQA 4JIGA 3AZPA 1KDZA 2VHWA 3FPLA 4BVGA 1M10A 1WZUA 4K9MA 3K9NA 1RWVA 4M86A 4YRJA 3QYPA 1WB6A 4JSTA 3PFFA 2G80A 4YROA 1H05A 3GQBA 4KO3S 5EWLB 4TTJA 4MDEA 2O8CB 5LA6A 3M3HA 1RI4A 3Q3GE 4LXQA 4Z0PA 3WRXC 4I4TF 1EESA 3Q0IA 4CFSA 2R4TA 1X92A 1JKJB 1BCRA 3ENWA 1MV5A 3DF7A 4ND6A 2HSZA 4JMPA 4BNZA 4A03A 2XUJA 4OHPA 2PLNA 5AD1A 2HA3A 1TZ2A 2GZAA 3O2JA 2AA3A 2BRUC 1P8AA 1SG9A 2HCJB 3ML1A 5B7QA 1VPDA 2LP4Y 4YQZA 1H1LA 3C7AA 4P3NA 2W9XA 2PSFA 4TGLA 4B43A 5TS2A 3KKQA 3S0JA 3SMVA 3MCZA 1CLEA 1J7KA 2B3TA 4P2BA 2QRHA 4CKBB 1EJ2A 3ANLA 3H11B 4PZLA 1BCSB 5C4IA 2BZ1A 2IUUA 2E2WA 3GYGA 3TL2A 2RH8A 3NXKA 4M0UA 1X1RA 3JQRA 4KUEA 2GCIA 2GPTA 3JAWA 4X54A 3GFPA 4FEEA 3HWX1 5JXGA 3KQMA 1CUFA 4EWLA 1NMQA 4ZMSA 1MHTA 1VJ5A 2C95A 3W9SA 2Q1UA 1YZKA 3B2QA 4ND5A 1C0KA 2QD4A 4YRPA 4MVJH 4W5WA 5F12A 2DUUA 3KLBA 2ID7A 1B3RA 3A3OA 3SYNA 4AMUA 1KC3A 3L5KA 2B94A 4W5OA 1GPNA 2XYRA 3ZNNA 1T6NA 1EH5A 4FFDA 2V5VA 2FKNA 1RBQA 1M2VB 2Z04A 3VKFA 5CAEB 1VDMA 1L7XA 2ZJOA 3RUHA 3EDRA 4INAA 1R10A 4J16C 4N76A 4Q3DA 2EKBA 3DXFA 1C0PA 2Z5FA 1M1YB 1N75A 3KJHA 5K3SA 5C32A 1II0A 5P21A 2DTXA 1UBCA 3RVJA 4QFDA 4JGGA 1JA0A 3VR6H 4TMZA 4PYIA 3BB1A 1HPLA 5IK2A 2OYRA 5HG0A 2WM8A 3L6UA 2EKZA 2CYAA 3FOCA 4JLPA 4OXYA 1QG6A 2D5BA 2V4ZA 4L0CA 4KJXA 2O0HA 1ZAYA 2VDJA 2X0KA 4G81A 2IU3A 2JRLA 2NVUB 3EFEA 4YNBA 2GDJA 1D1QA 4X7RA 2V3WA 1FFYA 3PEFA 4DLNA 1WHTA 5T4HA 3IO3A 3T1TA 4RW0A 4Y18A 1F0YA 5BT9A 5AICA 2WIAA 1XE3A 4G2NA 2ETXA 4TQ9A 3D8BA 1F06A 5JNSA 1ZL2A 3TTVA 1ZOLA 3L04A 4QBIA 2Z4RA 1KZYC 4NK5A 2XMBA 3RIMA 4N82A 3ZHOA 2PBRA 3PHIA 1E79A 1E7RA 3TQTA 3PZBA 4OXQA 4KLRA 4UTOA 3EC7A 1HNZB 3C15C 5MF6A 1AO0A 3ESXA 2YJGA 3ZWWA 4N8SA 4HV4A 2FX3A 3T1VA 4ZIRA 3DO6A 2OK7A 3W5IA 1U7HA 4Y0VA 1TUBA 4F6RA 4FDUA 1GADO 2QK4A 3RLIA 1H42A 1PNRA 2WJ4A 4EF6A 1U3TA 2GN6A 3KNZA 3QWHA 4LPKA 4LC1A 1H2AS 5HMMA 4CQLB 2RKBA 4CM1A 1XA3A 4L8WB 2NG1A 3DMRA 2QSYA 3K73O 5K2OA 5DZSA 1K5HA 1ZW6A 3DOFA 4MXDA 3OLQA 1R27A 1S3SA 2ZSEA 3E9MA 3MGBA 4JXKA 2Q4TA 2Z0MA 2KMLA 1SCIA 3CIFA 5AHWA 1D2CA 4B44A 3E5MA 4BX3A 4QM7A 3OJCA 4RVOA 4URWR 3URKA 3BFPA 2QTBA 1TF2A 3MWLA 3TRHA 3DAFA 1ZRHA 3WOVA 1WABA 1Z0SA 2AOTA 2J59A 2FG6C 4IX9A 3IOCA 1JWAB 3X1KA 3WB9A 5B1IA 2PKYX 4TLDA 1NA5A 3LMKA 1PR0A 2DFKB 3AWDA 4L27A 3WWOA 1W0KD 2A1TS 4Q02A 4M8LA 3B85A 1Z3IX 1BS2A 3LP8A 4OAOA 4DM7A 2ZDHA 3DCYA 4E1BA 4EI7A 5L3QB 3N2YA 3TMAA 1Q11A 1RLMA 3DE0X 3G5AA 1YZHA 1OWPA 1YIOA 4PGGA 2ZRCA 3EQ9A 4ZAWA 1QUEA 1ZUHA 3QSGA 4G0ZA 2VATA 3HQ4O 2GD0A 1P6UA 5ALKA 4DT1B 4L8LA 2J8ZA 3CLHA 5ALLA 1NVFA 4CKXA 3H97A 4KVFA 1U7WA 4AJLA 4ZU3A 4COOA 4EPTA 3FDXA 4JOBA 4DV7B 3ESCA 1IXSB 1MOQA 1N5OX 3FF4A 2NPFA 4F2WA 5AW7A 1TCAA 1QRRA 1M7BA 2JBAB 1DP4A 3H3XA 5CHYA 3D1VA 1C8VB 3A1TA 3R6TA 4RPHA 1CDZA 3A32A 3BHMA 2VZ8A 4O4LA 4OQLA 4P4NA 5DM1A 4ZOLB 3UJAA 4AZ3A 3I5YA 4GX0A 4LRQA 1XTSA 1MHPA 3C1OA 3VZPA 5K5EA 4NZYA 4DUYB 2QN2A 5AI9A 1WUIS 2P9ZA 2FPIB 5A0FA 1BJKA 3ISJA 1T5HX 2ZIXA 3DAYA 1ICIA 2BFCA 4R8LA 5TPZA 1O58A 4NAHA 4RCZA 1V3TA 4RVUA 2MU1A 4YCJA 5IAEA 3C41J 2FF7A 2GEFA 4N0EA 1ZOIA 3J7TA 5LQSA 2ZM6B 3HDHA 1F9EA 2J9YB 3MTEA 2YWDA 1WW2A 1Y81A 2RKOA 3E9EA 1R7RA 1Z8DA 3USCS 3V5NA 3V00A 1B8NA 3PG5A 1KI1A 2R25B 4FE4A 3ZHUA 2QBYA 3GLKA 2HYIC 1A95A 1HBJA 1TOAA 4BYMA 1KI4A 3QX8A 1VPEA 1S0UA 2OCPA 4KVGA 4Q00A 1RABA 1YS4A 2H5IA 3HCPA 4GI5A 1KEEB 3ELYA 1BQEA 3HVJA 1XRJA 3CT4A 2VP5A 2X14A 4K6MA 3HY4A 4XIIA 2AK2A 1MX5A 2VJCA 1ZICA 3E7PA 5I7VA 5I48A 4PFJA 3OKPA 4BMNA 5D1HA 5DTQA 1AZTA 4G89A 2E9SA 3H1FA 2I8CA 5CUQA 4BZXA 3A9CA 3PXEA 4ARSA 1VGVA 1U1DA 1B8OA 2XJ4A 3AW9A 2JJMA 1OTYA 3KCNA 3G7UA 2DQZA 5CT6A 2X5KO 1UXKA 1X9IA 3S81A 4X64B 3D8RA 1Z62A 1QH1A 5KJEA 4LX0A 1JG1A 3R5JA 5JS2A 4INZA 2XCLA 2IPNA 3QG1A 2VP3A 3H04A 2C8JA 2A5GA 1FCJA 1DLIA 4ER6A 1F2UA 1ECPA 5KNCH 1JQKA 2DFTA 3ET4A 1VE1A 2XAUA 2XIJA 3MPUA 4ITRC 2CZQA 4LRWA 2JGAA 2LZ0A 3SC2B 5BN3B 2DY0A 1RWNA 1ZGCA 2XECA 2P79A 1U94A 5H59A 1F0NA 2WIBA 3KJIA 3NGXA 4BKOA 4JENA 2HC9A 4QRHA 3T5AA 4EPWA 1D6SA 4NEHB 1KVTA 2GRUA 3ZLBA 3TLZA 3D7KA 5F35A 3O91A 2HH9A 1DC4A 4JLNA 1PYDA 1R6AA 1KYIA 3G2HA 3NYRA 2XTNA 3DQPA 2ZJ5A 1KBZA 1NVXQ 2BHSA 2QRKA 4QJ4A 1U1CA 2H3HA 2PK3A 2HJSA 4BIMA 4B85A 2BLLA 1L5QA 1DOHA 1REQB 2P4SA 1SUBA 3F6SA 4MQUA 5B3AA 3UKDA 4F9GA 1E8MA 1TKAA 1DVRA 3WK7A 3A11A 3RSQA 4MQEB 1W4LA 4X5OA 5HF5A 1FMTA 4V02A 3VUEA 2GN4A 3KQUA 4F4JA 3VNUA 1N4AA 3RFUA 2QD5A 5L6MB 3L02A 1V7QA 4LHEA 2GCEA 1N1DA 5CDFA 5PGMA 5HDQA 4NVRA 4RDIA 1DJLA 2FUG6 3KPVA 4OQFA 2AFVA 2PRZA 4XJVA 5BPHA 5HRUA 3FE2A 4J2TA 4PG4A 1SHJA 3LC7O 1ZM2A 4F38A 1UP4A 4Y0NA 4G8CA 4UKDA 4KRGA 1E8DA 1P0IA 1T0PA 2AHRA 2P6MA 3DYVA 2UAGA 1HK7A 3ICOA 1BS9A 3PQDA 2WIGA 4FCWA 4M36A 4H59A 3OCYA 1NKTA 1W47A 3HN7A 4NAUA 1FFAA 1WOYA 1KH3A 2DM6A 4IHKA 4YRQA 5EJMA 3V7YA 4C6HA 4D8XA 4DOMA 4JC5A 2A2ZA 1QIJA 2A0FA 3I58A 4B46A 4CLRA 3HNOA 3RUPA 1JZSA 2Z6VA 4X9XA 3U7JA 2WD8A 1HFEL 1Y4DE 3GJ3A 4HAOA 4HWKA 1EB9A 5TJHA 4U5XA 3A6LA 3SIPA 2RDMA 1KJZA 4UUOA 2DFLA 2V96A 4EUFA 1RPNA 5H3LA 3TN7A 5EMLA 3NBKA 3U7QB 1U9YA 3IXMA 3EASA 4OHOA 1Z4PX 4FOTA 5K8IA 1B2LA 3DTVD 1P9WA 1TKCA 4Q9KA 1SD5A 4XLTA 4LOKA 2NUTA 2QS9A 3UCXA 1NDHA 2H65A 3A6GA 1NU6A 2AMJA 1KP3A 2OWDA 4LYJA 2CBGA 1SU6A 4GZ5A 1DTWB 2VTKA 5CT4A 4Q4CA 1GN9A 3L84A 1Q0ZA 1Z4JA 4JLUA 4R01A 2X77A 5DX0A 4IDPA 4TLMB 2OXTA 2W22A 2VDWA 4TYWA 2L19A 5FJIA 3A37A 3LC2O 1BXGA 2VIIA 3QQPA 1AV7A 2ZGVA 2H92A 3EBLA 4X71A 4ZICA 5IH7A 2C5BA 4UCFA 5B64A 4CUJA 5BV7A 4LI3X 3I3SR 2VTDA 4PZZA 1KAHA 2CFCA 3RS3A 1AOXA 3T34A 3WDLA 2GUGA 2C3YA 4A1OA 4BS9A 1MX3A 3K9LA 4DCPA 1MCZA 4MQFB 2C5HA 3B1FA 5C5EA 4E6EA 3F98A 3L4SO 4UD2A 5JSFA 1BDIA 3JALB 2VQ3A 1SCAA 3EVGA 1RHKA 3WL5A 3U5TA 1WB9A 2CUNA 5IF9A 1GEEA 2X8WA 3ZDXB 2JFWA 4YCBA 1ZM4A 3HBFA 5K01A 1B74A