2RGNA

Crystal structure of p63rhogef complex with galpha-q and rhoa
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
324
structure length
324
Chain Sequence
RSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Galphaq-p63RhoGEF-RhoA complex reveals a pathway for the activation of RhoA by GPCRs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein complex
molecule keywords Guanine nucleotide-binding protein G(i) subunit alpha-1,Guan
total genus 105
structure length 324
sequence length 324
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 2rgnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rgnA01
2VP4A 1SHZA 4BGDA 1N6LA 4UJ5A 4A4DA 4C30A 3AKCA 3B1WA 3J81k 2QROA 1TU3A 3CZPA 4LJYA 4PO9A 4DDVA 2BJVA 3R8CA 3I5YA 4KSBA 5F2EA 2H92A 4A8JA 1XWIA 2OCBA 2DHRA 2EWWA 4EJSC 2GZAA 4ESHA 3K0SA 3ADDA 3WMGA 2EFHB 2PEZA 4PTLA 1ZNWA 5SZHB 4BQSA 5BXQC 2R6GA 2HDNB 3LV8A 4FD2A 4MRVA 3CM0A 4TYPA 4WAUA 4DCTA 1F48A 5SZJA 3IPXA 1S1CA 2BM0A 2GBLC 4RSGA 1IOZA 2MMCA 5FOWA 1GNRA 1RC8A 5KSZA 5B30A 1N0UA 2VO1A 3WMEA 5FR1A 3NBXX 4FMDF 4WXPA 4ZKDA 1Z08A 4LGMA 1CJVC 4G0NA 3W5IA 5CK4A 2UKDA 2V7QD 2Z5FA 3U3JA 4O0MA 1OKKA 1FL9A 4O2LA 2QPAA 4U00A 1XTQA 1NL3A 2NPFA 3M1IA 1Z0FA 1EFCA 4YMVA 1UADA 1P7CA 3THWB 2VHJA 5CB6A 1PV4A 2ZI9A 3GLGB 1WBDA 1P5ZB 4XIGS 4RJLA 5KTYA 4GI7A 2QRNA 1RVDA 3KB2A 3GLIA 3NDPA 2ORWA 1AGPA 1XPUA 2BVNA 1BIFA 4M1TA 3AKEA 3B2EA 4JT2A 4NH0A 2F1JA 1NF3A 1NVUQ 2CL0X 3FDIA 1NKTA 4OQLA 3THYA 4BLQA 2IYUA 3UKDA 1G7RA 1JEDA 1K8RA 2Z43A 4TTRA 3W8NA 2FWRA 2KBEA 1UEJA 1B0UA 6Q21A 2JASA 1YRAA 2VBCA 1SGWA 3IPYA 3ZH9B 2HUPA 1I4TD 4QHYA 4PQRA 4MGKR 3IDQA 2OFOA 2O5VA 2OESA 4IEIA 3THWA 3RS3A 2ZJBA 2WV9A 2GXQA 2A5GA 4ERNA 1NJFA 1ZBDA 5P21A 3VR5A 3D3QA 2WJHA 4DLTA 1H8EA 1P9NA 1AM4D 2GKSA 2TMKA 3PUVA 4ARZB 4JIMA 4DIDA 2CNWD 3SC3A 5JCPA 1NLYA 2GJKA 4JLBA 1DADA 1EFTA 5J4LA 4YXWD 2WHXA 4KLZA 2ZRIA 1QDEA 1KY3A 4FI3C 2QQ0A 5FBRB 2CHVA 1NMZA 1ZU4A 1HE8B 1CLUA 2CE2X 3FOZA 1E2JA 2OAP1 3D31A 1YR6A 4OJQA 4QOSA 3ZQ6A 4B43A 4BFSA 2XOKA 5F9HA 1IJEA 2O0JA 4KFUA 4B2IA 1D2EA 2OG2A 1JECA 4LPSA 4C7OB 2KB0A 2G9NA 2GJ9A 3QPUA 3AP2A 2JLVA 1W44A 1IN5A 4B76A 2IWRA 2QG6A 3LVQE 5CIWA 4E22A 4V0NA 2KI5A 4Q4LA 3CNOA 3ADBA 3I5XA 1Z0JA 2JCSA 5FR2A 1QHHB 2ZYWX 3IHWA 2P5TB 3WBJA 1J2JA 4NCNA 1G6HA 3WBKA 1KHTA 5EUMA 3K8YA 3EPKA 2XZOA 4Z1MD 2O8BA 3N5CA 4A82A 2GEUA 1QVAA 1E9BA 4QGFA 3QJYA 2HXSA 1KI2A 2QAGA 1VCOA 2A78A 4PQYA 1YZQA 3GLHE 1DAFA 1KJWA 1JAHA 1U8AA 4S2EA 5FPKA 2QM7A 3SR0A 4TLAA 4YMWA 2P5SA 4JLDA 1ZD9A 4HAXA 2EFEB 2IK8A 3ZS9A 1OH8A 2CJWB 2GRJA 2W0MA 5DI3B 5B58C 4HB3A 3HPRA 3EARA 5FPSA 3X2SA 2RCNA 4OHYA 3UMRA 3SJCA 4D82A 3SJAA 3C8UA 1G1MA 4HEJA 3RWMB 4KCGA 3H0KA 4Q9IA 1D6JA 3QQ5A 4ZPXA 3K1JA 1E9AA 1NVVQ 4MYHA 1LF5A 2J46A 2J45A 2B7BA 2V54A 2RH5A 3LX8A 4TL8A 1LVGA 2B92A 2REOA 1ZVQA 4UXJA 2O8EB 3AF0A 3U7FB 4OK6A 5G3ZA 1RW4A 1CBUA 4TLBA 1ZRHA 3NEJA 4HDQB 4V0KA 1U9IC 4EUNA 2DWOA 1A1VA 4FCWA 3QKRA 4HZUB 1SVSA 1VDZA 1NLZA 2DBYA 2D4HA 5KSYA 3U6KA 3VTKA 2C9OA 2NO1A 1IN4A 2WPDA 2H18A 5D3MB 2J0UA 1AKYA 4N3NA 3RS0A 1VHTA 1W2GA 2FSFA 4CEIB 3FGNA 4BASA 3FB4A 1N6IA 5KNDA 3I8SA 1ZIOA 1S1MA 3CF6R 5JHHB 3O8RA 5DE3A 3DOEA 4P4SB 2BMFA 4KBGA 3T15A 3DM5A 2AL7A 1F2UA 1I2MA 2Q9BA 5EP3A 1US8B 2FGKA 5JI3E 2AKYA 2GTPA 4B3CA 4Y0VA 1KY2A 1V5WA 4POAA 3QKTA 4YLGA 2ZJ8A 4DWJA 4Q5IA 3I1FA 1HA3A 1OIWA 3EA5A 2QNRA 5FUVA 4A0FA 5JWRA 1WQ1R 1GDDA 4LYJA 3V4FA 2ZR9A 3U61B 5A0FA 3Q9LA 3T61A 3CRVA 1E2GA 2DPXA 3RLFA 2FNAA 5A4JA 1N5JA 2P67A 3CH5A 5FPYA 4JLJA 1NG1A 3A6PC 3CNNA 4LBZA 4AKIA 4B35A 1Y3AA 1CP2A 2ZI5A 4PSAA 1E96A 2HLDD 3VMFA 4QGAA 1J70A 1XEXB 1N6PA 4KODA 1KZ7B 2LCFA 3L0OA 2VP0A 5G41A 2GXAA 3TW8B 4B48A 4Q1FA 2J41A 3QF7A 5E7IA 4V0ME 2C9YA 3E70C 4GBMA 4PPFA 1XTJA 3EZ7A 4MGZR 2ZYVX 4CDGA 5KPDA 1D2NA 3L0IB 5AUNB 3ADCA 2H8KA 4JJZA 4YDHB 3PJRA 1F2TB 4XVRA 2ZVQX 1GG2A 1AA9A 1TPZA 1N6OA 1H8HA 2ZRHA 5HCNA 5M04A 1RJ9A 2BBSA 3C16C 3FKSD 2A2ZA 4WVFA 1F2UB 2CBZA 4AKGA 4LHVA 2R8RA 4PHGA 1XEFA 4DC9A 2B8WA 3KKNA 1SVIA 1G18A 4LJ6A 5KHOC 4PSVA 3W6PA 3B9QA 2OLKA 5FOVA 4HI0E 1OJLA 3VHXA 1OPXA 4DJTA 2JJ2D 1KDOA 2J0UB 1PUIA 5JEDA 5D3MA 3G82C 2JJ1A 4UXHA 2C03A 3R9WA 3IGFA 3U7GA 1R8SA 1R7RA 4DBLC 1W0KD 2QRZA 2EYUA 1S3SA 2XGJA 4L9SA 3CR7A 2O8DA 1I2DA 4C0AC 5DISB 1CF4A 4B71A 1NP6A 2Q6TA 3BD9A 4DLYA 4I1VA 2ODEA 3GLGE 1XPRA 4II7A 2RAPA 4KAXA 2Q3MA 4LBYA 1HT2E 2XSZD 5JECA 2BMDA 1VG9B 2NO7A 2NOAA 2JEOA 4I81A 3A37A 4Q9KA 3BBPA 4QNRA 4QBGB 2ZS8A 2ATVA 2HYDA 2F43A 5AJYA 1HE1C 3K0AB 4PR0A 1IBRA 2AWOA 3IIJA 2ZRGA 4BEBA 3ND9A 4PAQA 2XSZA 1ZM3A 3ZZ0A 1U90A 3BH0A 3WXMA 3TUIC 4EFNA 3O47A 2AHOA 2J7PD 2ORVA 2XB2A 5IT5A 3GJ6A 3SHWA 4V02A 1CIPA 1UBGA 3QY0A 1D9XA 3W34A 4OI4A 3GQBA 1A2KC 2REXB 3D8BA 5EXSA 4RD6A 1R5NA 4C0LA 1BMFD 3O8BA 1UFQA 2D74A 4OI1A 2IHBA 2ZE5A 1JI0A 1KDTA 5DNYB 2W2XA 4KLNA 3KKQA 4FIDA 2ZUDA 3LY5A 1OXXK 2IBMA 4B2PA 1FUKA 2QPOA 2W58A 3MSXA 4JLKA 3KFVA 2CVFA 2YWEA 5KO2A 1J8YF 2IUUA 2ZIAA 1NSTA 4D4LA 1P2TA 1JQJC 4I4LA 5J4KA 2FDCA 3EZ9A 3FHCB 4A1FA 4DKXA 1VYVA 1OHHA 2F1RA 4PHFA 3SDZA 2XXAB 1G4UR 3D7MA 2BKUA 2ZRDA 2XZPA 4JLMA 4AK9A 1XD9A 5FUWA 5H68A 4LK2A 4AYXA 1GRRA 2J7KA 1GRNA 1IHUA 1XJQA 2ZSBA 3VR6A 4DZZA 3R8FA 2GXSA 3L2OB 4TMTA 4M1OA 1G8GA 2FN4A 3FE2A 1CJKC 4QBIA 5HTKA 4E5UA 2QA5A 3GLHB 4CEJB 5AR1A 3JZMA 3PITA 1FMJA 2HT1A 4GNKA 4DDTA 1VIYA 2ECKA 1P4SA 4K81B 2PH1A 2GETA 1DBSA 1GOTA 1G8FA 5EE0A 3BERA 221PA 3ZGXA 5H1YA 4GZMA 3RC8A 1Z6GA 5CITA 4C0JA 3IBYA 1S8FA 1J7KA 4B47A 4BFWA 1I4DD 1PZNA 2W6ID 5HR5A 3BGWA 1UF9A 1DS6A 4GMDA 1W5SA 3KQKA 1XMIA 2W83A 3AVQA 1SKYE 1XJCA 4G5OA 1AKEA 4QGGA 5LD2C 2QP4A 2JLSA 4IRUB 2BC9A 2D06A 2GILA 1VPLA 1HV8A 1FZQA 4OYHA 4XJXA 5CB8A 3CNLA 3RWOA 3S1AB 4PC7A 2WWYA 2VL7A 2IS4A 5GJVC 1GP2A 4Q4HA 4IDOA 1ETUA 4ASUA 4RCYA 3MLEA 4LV8B 3R9IA 2V6IA 3QF4A 4PFSA 4LBVA 3MGCA 4F91B 3AVVA 4X8MA 2WSMA 1CKEA 2UZ3A 2C77A 3QEJA 4XH9B 2QE7A 1II8B 2X19A 3OIWA 1YZTA 3EIEA 3GFPA 4JBXA 4DIEA 4FCVA 1WA5A 4D4MA 3EIQA 4F92B 1I4LD 4EQ6B 4L9WA 1G5RA 3UG7A 1PLJA 3Q8XB 1T3LA 1G5TA 1COWA 3BK7A 1BYUA 3RRYA 1KGDA 1R0YA 5BWMA 1IAQA 3T1QA 2ANBA 4TTQA 4WOPA 1SULA 4Z8XA 1AN0A 2FEOA 2MSCB 2OCYC 2GF0A 4FMBB 4PC6A 3VFDA 4AYWA 2DB3A 2O0KA 4IEEA 5KUTA 2LKCA 2JLWA 4OHXA 4DT1A 2PZFA 3CLVA 1T5LA 4B3XA 3H84A 1HTWA 4WBSA 4BECA 1WMSA 3DKPA 5B57C 3C41J 1E2EA 1OLOA 3NBYC 3H1TA 3K9HA 4L15A 5EJEA 4EJSA 1YZUA 2N42A 3CZQA 5BW8A 3VKWA 4H9GA 2F1IA 3QIAA 4JT4A 4Q4JB 3W9YA 3LLMA 1W4BA 1AZSC 3QXXA 1ZYUA 1ZP6A 4DCVA 3ETLA 1EWRA 2YHSA 1NBME 1UDXA 3HYTA 3RSLA 2JJ8A 4C0SA 1CJMA 1X8KA 5EE1A 3CRRA 2VF8A 2GBLA 1Q22A 3MAAC 3EW9A 5CDFA 4TMVA 3QUSA 3NC1C 2CXXA 3QKSB 5HE9A 3K0AA 3TAUA 5L3RA 1S2MA 4LC0A 4EPYA 1R5OA 3H86A 4TYWA 3F0TA 1WRBA 4LHYA 1KKLA 1NMYA 1PLLA 2B6HA 2QP3A 2WKPA 4Q00A 3SFVA 3LBHA 3KDSE 4P31A 3UWOA 3N2IA 2FV8A 5GADl 2FOLA 4Q19A 4RVCA 3RRNA 2JLQA 2DR3A 4R2IA 1OV4A 3K0CC 3QG1A 2JLZA 4C0QC 2F3RA 4OHZA 5F9FA 2QUZA 2PCJA 5FOSA 4BE7B 1UBEA 3AVTA 2XJ4A 3L43A 4NCKA 2OZEA 4Y0AA 3ICQB 3C5HA 3NG1A 3ECCA 5AJWA 3SEAA 2JIZD 4D0LB 1G4AE 2E1RA 3GJ4A 5IK2D 1ZNXA 3PIRA 1SVKA 4DLXA 4PAMA 1ESNA 4ESVA 4RCZA 3U3OA 2O8FA 1R0WA 3EAQA 2XXAA 4NKRA 1UKVY 1VIAA 2IA5A 1IY2A 2CMKA 4L16A 5DHFA 1W2HA 5HKKA 4HB0A 4AG6A 2V1UA 5JEEA 1XCPA 3I73A 3MD0A 3Q5EA 1Z0AA 3DOFA 5KNCA 3OESA 2CLSA 4X8LA 4N1AA 3NBZC 1T9HA 3AF4A 3E5HA 4NU0A 3QVUA 1UDWA 3U3MA 5DIFA 1KMHA 3T1OA 1Z63A 5FBQB 5B64A 1A4RA 4KJZA 1OIVA 5LDDC 1SXJD 3K0FA 2YWGA 3LLUA 2ODNA 4W5WA 4JYBA 2F55A 2PLRA 4GPTA 2IUTA 5F3WB 3IEVA 1ZC3A 3NIBA 1D8TA 4ILEA 4NP6A 1PVOA 1XEXA 3KUDA 4G1UC 3GJ7A 1KYIA 2EW1A 2YOGA 3MG9A 3EA0A 4F38A 1FP7A 4WIAA 1KJYA 4QXAA 4CEHB 1NG9A 1OKKD 2RHMA 4LPKA 2V7QA 1UKYA 4BFXA 2CHQA 4YMSA 1S9HA 2JDID 2JLXA 1T8TA 1ZC4A 3OE7D 4XD7D 1RRPA 1X1SA 2PBRA 1ZUNB 3R7WB 3WY9A 4Q47A 1NY5A 5TARA 2C96A 1KDPA 2G6BA 3WP0A 1Z5ZA 1M2OB 4WA7A 3FTQA 2WIBA 4OQMA 4V03A 4QJ4A 3EPLA 4JZKA 2X2EA 5EP1A 2IYVA 4MKIA 3ZVNA 2YKGA 4ZDJA 2QN6A 4EPXA 3B82A 1T5IA 4C0HA 1U98A 3KUCA 5CIQA 4UQOA 5CK5A 2ZRKA 3TJZA 3LQQA 1U8ZA 3OIUA 3QSYA 2ZJAA 1E2DA 1TUIA 4QJ5A 2F3TA 1H65A 3IILA 4NDZA 2W6JD 1QHYA 3DEFA 3WYAA 3L8YA 3GMTA 3P1JA 3GJXC 5G53C 4B44A 1TTTA 1C1YA 2CLDX 5GVSA 3TSZA 1XF9A 1XTSA 2X77A 2R44A 1CJTC 1UKZA 3K09C 4MH0R 4FMCB 1FNMA 2Z6VA 1SZPA 1XEWY 3A4MA 2VHUA 3IQXA 721PA 1SHKA 1ZAKA 2IYTA 3HPQA 4H1UA 4LHZA 3ZLJA 2ONKA 4DDWA 5CJPA 2NO6A 1XPOA 1KO8A 3NC0C 1E1QA 2QT0A 2RGNC 1TF2A 3Q85A 3A1VA 1R2QA 2PT5A 2O8EA 5KDDA 4EKDA 3PV0A 3X1ZA 1ELOA 3KKMA 3B8HA 1P3JA 2J3EA 1E9FA 3MJHA 2GXUA 1PLKA 3JVVA 3SQWA 2CL6X 2J5XA 1U0JA 2WWXA 1J99A 2IF0A 1ANKA 3QENA 1IXRC 1J8MF 1WXQA 1YU9A 1NVWQ 4DCSA 1KK2A 1QG4A 4ZDKA 1N5KA 2QEQA 2DWPA 4DDUA 5JRJA 2ZREA 2GK7A 1XCGB 3UMFA 3DMNA 4A0HA 2C04A 1BOFA 2REBA 5TY0A 4FW9A 4B32A 4RZ3A 2QE7D 1MABB 4RKEA 3NXSA 2OE2A 1Z22A 2P6UA 1YQTA 2QMUA 1Q3TA 2ZJOA 1R10A 3E2IA 1QF9A 2CDNA 5DI3A 3PUWA 3R9XA 1DAGA 3GP8A 3BS4A 1X8LA 3Q5DA 2IL1A 4JVLA 1LY1A 4GMXA 2YOHA 2IXFA 2G1KA 5FUXA 1OXUA 1CRQA 3QXJA 4X8OA 2XNDD 4HAZA 4JVSB 1FUUA 3C14C 5BN3A 4HYYA 4KXFB 3RRMA 2QBYA 4U02A 4W7SA 4R7ZA 4PC1A 4MGYR 2A5FA 2W6IA 4KFTA 4GP6A 4RZXA 4DCUA 1GKIA 1VTKA 3BH7A 4P4SA 2EVWX 4E07A 2BHRA 4C2TA 4AKEA 2ZRNA 1NN0A 4Q1EA 2KWIA 1CS4C 3BWDD 2OM2A 1E2KA 1LTQA 2IF2A 3BIFA 4RD1A 4OK5A 4S35A 5FBVB 3CUEF 4CYMA 3CRQA 2WICA 4P33A 5TB5A 3PEYA 5H70A 5AJZA 3BB4A 4TLEA 4D6PA 4FXPA 3DMDA 1S4QA 5JWHA 4ZI2A 2E9SA 1AZTA 1KSJA 4G01B 4LRWA 4JKIA 4TMXA 1IM2A 3MFYA 1G8HA 2DCUA 3CW2A 5KDOA 4KYIB 1X1RA 4XSGA 3RS4A 2C98A 4IOMA 1ZUHA 4TSFD 3B13B 4PZLA 3BORA 4O2RA 3CWQA 4F4JA 3TBKA 3T5GA 1ZCAA 4NYMQ 4DXAA 1M34E 4LJ9A 4B75A 2YV5A 3RAPR 1RIFA 2C99A 4LCBA 5H8WA 4YQFA 2ZSAA 2O8CA 3I8XA 5JWOA 2JGNA 3EC2A 2KE5A 4QC2A 3T1TA 5CM8B 4ARZA 3TQFA 1KK3A 4YC7A 4MKHA 4TL6A 1E1RD 1GVNB 2IHYA 2AR7A 2GEVA 2WJIA 1P60A 2ZS7A 4AKHA 1UJ2A 1SXJA 1FP6A 3ZVRA 2J0VA 1E2NA 1E9CA 3TNFA 1EGAA 2IXEA 3K70D 4V0OA 3SU8A 5JS7A 4LJ4A 1Q0UA 3GLIB 3A1SA 2DFKB 3AVPA 4OBEA 5DH9A 1OH6A 2FH5B 2GZHA 1E79D 1RFLA 2X1VA 4BFUA 3IEUA 2RGGA 3NTUA 2E87A 4P4TA 4Z8YA 4M1YA 1T3SA 4A0RA 2JLRA 4NYMR 4QFMA 4D80A 5HKKD 3IO5A 5KOYA 2ZI3A 1E2FA 4NE2A 2O8CB 2PJZA 2ATXA 3AVYA 2ZE8A 2RGCA 1QHHA 1W0JD 2BV3A 1G7SA 3ZJYA 3CH4B 3K9NA 2BCGY 3TIFA 4GSYA 4LJAA 1HQYE 1UM8A 3B9PA 1RZ3A 4W5HA 2H7VA 1G20E 3AP3A 4Q1DA 5DYGA 5KU1A 3QXHA 4LI0A 2P3SA 3KL4A 3KTAB 5LD2B 4BLTA 5FL3A 1QG2A 3KFXA 2ZYTX 5EXTA 4URWR 2FPKA 2H57A 5JSZA 3FYHA 4NONA 4PO8A 2ZAOA 3W5JA 5K8IA 5D3QA 1Z28A 2ZXUA 2ZI6A 4NYJR 5FTMA 5EE5B 3REFA 1YRBA 2OAQ1 1W5TA 2PX0A 2FEMA 2L0XA 3LAWA 4OQXA 2IS1A 2VSXA 1TEXA 3ADKA 3KTAA 4BPBA 1N6RA 1GUAA 2HV8A 4HLUA 4QBHA 3LNCA 3LQRA 4HAVA 5EXXA 4BUJA 4DLZA 1R0ZA 4TMWA 2XAUA 3FHOA 1II9A 4JL5A 2QBYB 2Q9CA 1OFHA 5LBIA 3NH9A 4TYQA 4A8JB 1N25A 2JJ1D 1RKBA 2WBLC 4XTCS 2OFWA 1IN7A 2WKRA 4QM6A 3IHLA 4GDFA 2JJ2A 3DO6A 3TR0A 1P6XA 2XX3A 1SXJB 4Q1CA 2J59A 1D5CA 3A36A 4IXNA 2FPMA 3RNLA 4P4UA 2W6JA 1UKEA 3IIKA 3I92A 1GITA 1DE0A 1T6NA 3MWKA 3NWJA 2KSQA 3I3SR 2F7SA 5C4MA 1CR0A 1OSNA 2ZAMA 5EUQB 3A1UA 2P6RA 4LJ8A 2IWHA 2LWIA 2WIAA 1ZJ6A 3UPUA 4LYAA 4NTZA 1E2QA 2QU8A 4TWZA 4TT3A 5FPHA 1NN5A 3UANA 3B1YA 2IYZA 1XU4A 1KNXA 3TW4A 1GKUB 3BE4A 4EPTA 4ON9A 2WOJA 3VR2A 3NDBB 5E95A 1GWNA 1ZMXA 2FGJA 2WKQA 4M1MA 4G5SA 3CR8A 3OAAD 4ZIRA 4KYUA 5DLQC 1ZIPA 4HLUC 4G3XA 4URYR 4GT1A 3U6BA 4LV5B 4DUGD 2W2VA 4JBYA 1S9DA 2HLDA 4HSEA 3PR1A 4ZV4A 2CNWA 1B23P 3SJZA 1CU1A 3THOA 1EFHA 1H8ED 3E1SA 4IHQA 1MV5A 3W3AA 1G19A 2ZI4A 4DLSA 4OL0A 2CEAA 1E0AA 3K0EA 2BM1A 2HEIA 1KI4A 4M53A 4TL7A 3PXGA 5J4YA 2HCJB 2ZM5A 2ZTSA 4IVQA 3QBVA 2A5JA 1A82A 4BEJA 2QTVB 4NBSA 4LYFA 1YR7A 1TQ4A 4CVNA 4E03A 3OEHA 1CR2A 4OQFA 5G3YA 1P72A 3SQXA 1CR4A 1JNYA 1P61B 3CPEA 3HWSA 1K5GA 1XDBA 5JFGA 5DO9A 1KMQA 3DKVA 4HAYA 1JJ7A 1YZNA 1OYYA 1A5TA 2B8TA 2VP6A 1E3MA 4B6EA 2ZJZA 1XD2A 2RGEA 4DLRA 1EX7A 3CX8A 2P6NA 1FQJA 5HE8A 1AJEA 2P65A 1F60A 1HQCA 2WVJA 1Z83A 4HAWA 1XMSA 4AI6A 4RD4A 1JALA 4LX0A 2DY1A 4RD0A 4TN1A 1E2IA 1SVMA 3RANA 4Q7KA 2BBWA 2YOFA 5DN6D 4NYIQ 3ZZUA 2IYLD 3GEEA 5FTKA 2ERXA 1T0HB 1X8JA 3B6EA 3CF2A 3MCAA 4GZLA 4Q9HA 5IK2A 1BH2A 3MRSA 4MRSA 4R9UC 4V0MA 5GVRA 1MABA 3NHAA 1U8YA 3PCRB 1U2RA 4UNPA 1E9SA 5TMPA 2MMGA 4R2HA 1U0HC 2OV2A 2QSZA 3OIYA 4HDCA 2QAGC 1U81A 4HLCA 4UNQA 1E2PA 1OHHD 3GEIA 4JL8A 5L3SA 2RGBA 4DSTA 2HJVA 4A36A 3HR8A 2GK6A 1X86B 3KJEA 3BJIC 2P0EA 1TQ6A 4ZO4A 4A2QA 3EWSA 5J4HA 3CBQA 3OFNA 3A1WA 4FN5A 1QVRA 4HLQB 4CGZA 3TH5A 2OILA 1Q3HA 2OSBA 3GJ8A 5BYJA 3K09A 3P32A 3TR5A 4HDOB 3GPLA 2FFBA 3AM1A 3KB1A 1MRSA 3K0FB 3HU1A 3MWLA 1A7JA 3QKUA 4D0GA 4MRNA 5JI2E 2H17A 5L3QB 3HU2A 3SE0A 4MYTA 1NBMA 5CLLA 3SS8A 3A4LA 1IN6A 2V6JA 4Q1BA 2CCGA 4MYUA 3P20A 2IYXA 3IIMA 4RFSA 2LKDA 4Z1MA 2K5UA 2WJJA 2ZJ2A 4C0KA 3ZZTA 2QMOA 1U9IA 4B33A 1N3BA 2WOOA 3Q7PA 4MDEA 5DGXA 3K53A 1FTSA 5EQTA 3OZXA 2IEZA 3KXIA 1E2MA 3H2YA 1S3GA 3R7WA 4XWAA 2QORA 4A6PA 4IDNA 3LVRE 4KO8A 3LDAA 1MRNA 4TTPA 5EZ6B 2GJ8A 2FSGA 4AY2A 4F93B 1ZD1A 4XTRA 5DHAA 4ZDWA 4U5XA 3BB3A 1Z06A 2WWFA 2VSOA 1OH7A 2GJAA 3QOFA 3AP1A 2FF7A 1DPFA 3CPHA 3AGQA 2Q3HA 1KAGA 2OCAA 5E3HA 3LXRA 4YMUA 4TL9A 4JSTA 4URZR 2OO7A 1QHGA 2QPTA 4OHWA 4BLRA 2R9VA 4YXWA 4D0NA 4BFVA 3AF1A 1CR1A 3K70C 1WF3A 3P26A 1FNNA 2C8VA 2X2FA 2OBNA 3LA6A 4Q7MB 4G5RA 5J4VA 3QKSA 5J40A 2I1VB 5ELXA 3ZS8A 2RGAA 2RKOA 3AGPA 4DEXA 1UAAA 3O8CA 4TYNA 1Z6TA 3FWYA 4IOLA 3B60A 1DTSA 1FTNA 1R0XA 3RSOA 1F5NA 1L4YA 2C95A 2PMKA 4BWYA 3EPHA 1LW7A 1II0A 2VPPA 3VAAA 1ZCBA 2AD5A 2YYZA 4KV9A 1XBTA 1E6CA 3PUXA 1E1RA 3SFZA 5FTNA 3T35A 5JBQA 1FX0A 3QI2A 3KKOA 3TE6A 2JLYA 2WZQA 1S0UA 2I4IA 1W36B 4TMKA 1L2TA 2H16A 4A2WA 1EXMA 4PHTA 2V55B 3ZQJA 3GLIE 1NN3A 1RE0A 2D7CA 2ODWA 4PPNA 4Q01A 1KMHB 5E7MA 2ZRFA 1KIMA 1SKYB 1XZPA 4KBFA 4A6XA 5DI9A 1HH4A 2GF9A 3CPJB 1M74A 1NMXA 4PZYA 2D3WA 1JJVA 1R4AA 2JA1A 5LB2A 4G5QA 1IN8A 3X1WA 5JMTA 5TVKA 4JMPA 1RRFA 2SHKA 3LRPA 4L4UA 4UNRA 1FW6A 3W8RA 4Q66C 3WNCA 1E4VA 3RRZA 3AVOA 4IXMA 4EFLA 5KNBA 1Z8FA 2IS2A 2XJ9A 4E09A 3U4QA 2WTUA 1EFUA 3UK6A 2R6FA 1XXHA 1DOAA 4ZCIA 1WE2A 3MWYW 3U60B 2XITA 4OHVA 2R6CA 1KO7A 2FU5C 3GJ5A 3PENA 4HLDA 4B74A 1CTQA 2GCOA 4HUQA 1Z0KA 4NPHA 4D26A 4B3BA 2DFLA 2YJTD 2GESA 1ZUIA 4UNSA 3AF2A 1OE0A 3LWNA 2B21A 1KJZA 2QTHA 2OFXA 1Z6AA 2Z4RA 4EAQA 2V3CC 1K5DA 4K46A 1DAEA 2QT1A 2XTNA 3B5JA 4JLNA 1DELA 3FMFA 2NMVA 1NVXQ 2AXPA 3VR3A 4BLSA 5FI1B 2HF8A 2WAXA 4RD2A 1KI8A 3GLFA 1NVVR 1GL7A 1G7TA 2OUKA 2KJQA 2W2TA 3CO5A 3C4JA 4Q7JB 5JHGB 1OFTA 4NYJQ 1NIPA 3ZVMA 2V9PA 3MUFA 3NBFA 2BIFA 1J90A 3QVVA 3UMSA 3DZDA 4HB2A 4LHXA 4MRPA 2FSHA 4QRHA 1M8PA 4CRWB 4YDSA 5F98A 2YZ2A 1YZGA 1JXMA 5J47A 1XJ0A 4C9BA 1EK0A 5LPNA 1P73A 2OT3B 4CEJA 5AUOB 3IQWA 1T3HA 4ZDIA 3IUYA 3L0PA 4UNNA 5BN4A 4OI2A 2ZJYA 2BBTA 3VR1A 4LSGA 3GJ3A 4QHTA 4DT1B 4Q7LA 2HF9A 1KZGB 1G17A 2BWJA 3IKJA 2IYRA 2ZETA 4BFTA 2PT7A 4JLPA 3C7KA 1IY0A 2WM9B 3WHKA 4R71A 4KITB 5SZIA 3OFND 4D4JA 3BC1A 2IYSA 2C9CA 2HCBA 3QF4B 2XZLA 1U0LA 3EASA 2G83A 2IUSA 4UJ3A 1W0KA 1MT0A 4O25A 4EQ6A 3TLXA 1P75A 4IDPA 3S1AA 1WB9A 2A9KA 4GRAA 4I1UA 2CL7X 2HYIC 1ZD8A 3K9LA 2PMDA 1E2LA 1W4RA 4HAUA 4J0QA 4JSYA 1L8QA 2AFIE 3SBDA 4M9XA 2ZANA 1TUEA 1CXZA 1XD8A 1SVOA 5JCZA 5CM9C 3ZYCA 4Q4HB 4RZ2A 5DN6A 3RABA 4DSUA 1XNJA 4B3DA 5HZHA 3AVXA 3T34A 1ESMA 1OXTA 3F3YA 1GL9B 1LS6A 4LBWA 3AVWA 3FKSA 4DLVA 2AD1A 1H8HD 5HZKA 4GP7A 2FG5A 2ZU0C 3OEED 4A0GA 1MO4A 1KO5A 1VG1A 1YZLA 4XSHA 3SZRA 2WSSA 4NHOA 2XB4A 2IX3A 2ZEJA 4PZZA 1YVDA 3TMKA 1RRGA 4LJ5A 2Y8EA 1DAIA 2G3YA 3WP1B 4RZUA 2F43B 3L82B 4R98A 2P2LA 2XOKD 4DB4A 3BAFA 2GCOB 1NY6A 1Z0DA 4M0LA 5JJLA 5AUPB 3AKYA 2IS6A 3RDPA 1XTRA 5HPYB 5KPJA 4IVRA 3U44B 1SXJC 2HJGA 1HT1E 5FOTA 3REGA 3SJBA 5AK0A 3GLHA 2O8DB 2G0TA 1GILA 5CYPA 1TF7A 3DDCA 5C1BA 4QM7A 2GEDA 1Z29A 2QQEA 1IXSB 4GL2A 4BFYA 3CONA 3HJNA 3AUXA 3QE0A 3VKGA 1XMVA 3VU9B 4Q9JA 3TUZC 1WP9A 2PL3A 1GNPA 4NCJA 4HATA 4L8GA 621PA 3AEZA 1Q44A 1Z6XA 3OIVA 3F8TA 2ZUCA 3OF5A 4G5GA 1NKSA 2ZRAA 5IRCD 4NYIR 3TQCA 4PX9A 2QAJA 4XWOA 1E69A 1KSFX 1NIJA 5DYIA 1SVLA 1X3SA 2NTYC 1XXHE 3AUYA 1W1WA 2BKEA 4Z51A 4TQ9A 4TLDA 2WSSD 1AS2A 1L4UA 2ZSEA 5K8UA 3SBEA 3OEEA 4TT3D 3T12A 2ZSDA 4IFEA 2FE4A 1G16A 3A1TA 3BXZA 4L5BA 1R6BX 4QKQA 5JZVA 2ODBA 2ZRLA 3FMPB 1RPZA 1XFAA 3JVUA 3KQLA 2NO0A 1YJ5A 3D6TB 1G3MA 1NJGA 3Q72A 4D4KA 2EQBA 2R65A 3RS2A 1DEKA 1M1YE 2WWIA 3ZVLA 1NLFA 3OAAA 3VR4A 3WNBA 2VIIA 1HYQA 1N6KA 1C4OA 2EFDB 4EDHA 3BRWD 4QJ3A 1W36C 1TNDA 2OBLA 4DVGA 4XVUA 4A15A 1G8YA 5FL7D 1KAOA 2QGZA 1ONBA 3RHFA 2N46A 4EPRA 3PFIA 3Q7QA 4DLWA 3ASYA 4Q4AB 4HUTA 3QPVA 4RY2A 4O3MA 3A58B 4IKEA 4TLCA 5FTLA 2D2FA 5GJBA 4A9AA 4CW7A 5L3VA 1XCMA 2GDJA 4LJ7A 1KI6B 4MQBA 1Q21A 2V8OA 1SVWA 3AKDA 4M21A 3WYGA 4GOKA 1P2UA 3UATA 1GL6A 2RB4A 5KSPA 3V9PA 1AS0A 4EIWA 4XWKA 2FFHA 1V43A 4U7DA 2GWHA 2B7CA 1T8UA 2ZRPA 1QZXA 1SQ5A 4RFSB 2RGDA 1MO6A 3IO3A 4B3GA 2N1BA 2PEYA 4M2LA 1LFDB 3I4LA 1Z2AA 1G3UA 4MDFA 3HR7A 1G8PA 3KQNA 1OXSC 1W48A 1VYUA 5CDFE 3U7EB 3K0CA 4JKYA 2AFHE 2G0NA 5E4FA 4LDJA 1RJ9B 2AK2A 3THXA 1FMLA 2HXYA 2G88A 5IF9A 1YKSA 2VRWA 3B1VA 1LS1A 4TZ6A 3V00A 4JVMA 4D81A 5K8TA 4AG5A 3THXB 1G64A 2VP5A 3KX2A 1XB2A 3NVAA 3T06B 4AC9A 3HDTA 1W47A 3LXXA 4RFVA 4V0LA 3I72A 1E79A 3W3ZB 2J9RA 2AWNA 1XZQA 4LWZA 1LB1B 2XTMA 4B73A 4BZPA 1CEEA 1IJFA 1F3OA 3V4RA 3X1YA 3ASZA 1N6HA 4P3YA 3QBTA 3QXCA 2J87A 4W9MC 821PA 4Q48A 3ZDQA 1KI3A 1W0JA 1MH1A 2WAYA 3KXKA 3TVTA 2W0SA 2BCJQ 4QNMA 1JR6A 1ZM2A 1Q1BA 1ZM4A 5E7JA 3WNDA 4IJMA 5KYKA 4XOIA 4DHEA 1EX6A 3ICEA 4YONB 4Q4AA 5AJXA 3C5CA 2GA8A 2WJYA 5J5CA 2CK3D 1GNQA 4CEHA 2WMNB 3G5UA 2NQ2C 3K70B 2BOVA 3NKVA 2ZYUX 4OK3A 1C9KA 5EZ5A 4FWTA 3W6OA 1CRPA 4M1WA 4KHZA 4NMMA 4RD3A 3N70A 2ORIA 2IT1A 2EWVA 1US8A 3B78A 2VH5R 3HU3A 2D2EA 2ZROA 4M9ZA 2RGNA 1GTVA 2ZRCA 1X6VA 4HZIA 3TK1A 1ODFA 2CLCX 1TL7C 2QTFA 2ERYA 4MUBA 2NG1A 2Q9AA 3SI7A 1KSHA 2GNOA 3RC3A 4CEIA 4OI0A 1Z07A 2AKAB 4IVPA 3Q3JB 4JYCA 2ZUBA 4Z54A 5EP2A 4Q21A 4WZBE 4MYCA 1M7GA 1EG7A 2IW3A 2W00A 2YINC 4MKFA 5KSOA 1VKJA 4LHWA 4QGHA 1NSFA 1OH5A 1Q20A 4F4CA 3VHLB 1W4AA 4GOXA 3AH8A 1XRJA 3TSOA 1G7CA 1VYTA 4WXRA 4TSFA 4Q1AA 121PA 2IYQA 1T0JB 2IYWA 2CVHA 4M8NE 4C7OA 2GZDA 4LYHA 4HB4A 2EFGA 2ZQ5A 5C2JB 2YC2C 5JRZA 3TAHA 1ZW6A 3PEUA 4DRZA 3TUJC 4BRUA 3AVUA 1T91A 3U44A 3SN6A 3BFKA 2F9LA 2O52A 1YE8A 5DSZA 3W6NA 1KI6A 2PJRA 3CX7A 2NZ8A 3VU9A 421PA 1G9XA 4ZIRB 2VHCA 2YC4C 4EPVA 1LF0A 3LH5A 3EX7C 5LB4A 3SYNA 1NNEA 2GVZC 1JR3D 4EFMA 2CJWA 5CJ2A 3GCGA 3P27A 1BYIA 2UVQA 2VEDA 4A8JC 2PLFA 2I3BA 1VHLA 2UZIR 3TSWA 3DPUA 2VF7A 4I1OA 1E9RA 4KU4A 3FVQA 4B3FX 2XNDA 3QG5A 4A92A 1DVRA 2GAOA 2OCPA 1PJRA 2FX3A 3UG6A 4C3ZA 1P9RA 5HCIA 1QBKC 5UKDA 3M4YA 1KO1A 1KNQA 1EESA 1JBKA 1G21E 1KK1A 2PX3A 2J0QA 2QAGB 2ZJ5A 1SKQA 1UBFA 2I1QA 8OHMA 1BMFA 4BRWA 1XEWX 3ZD7A 4JLAA 3EIHA 1D9ZA 3TGPA 2H5EA 4AD8A 1RYFA 2R6AA 2VSFA 4KVGA 1D2MA 4KSCA 5TV2A 1F6BA 1WCV1 1Q1ZA 4Q9LA 2FZLA 3FFBA 2QM8A 1E1QD 2R6DA 2VQSA 4JJKA 3GLGA 1MKYA 2C2HA 2CE7A 2FJUA 3RYTC 4PXAA 4I1SA 4M4SA 1P9WA 2IXGA 5ANRB 1OYWA 2O8BB 2X8AA 4EJSB 3CX6A 2C78A 2F1HA 1NBMD 2YWFA 4GFDA 1XTKA 1FPMA 1OFUX 3FKQA 1OB2A 2NIPA 4A2PA 3EZFA 2AN9A 2Q21A 1JPNA 1W46A 4URXR 1CJUC 4NZYA 1CULC 2Q3FA 5JSZB 4OKSA 3SYKA 1ZM9A 2QP9X 2KBFA 2FPLA 1P62B 1VCMA 2EU8A 2GJSA 2AXNA 3LBNA 4ACBA 5L8VA 3T1VA 2JATA 3WYFA 5EE3A 1O3YA 4PQFA 1VMAA 3ZIAD 2EFCB 4PPGA 1QHIA 4JLOA 3U3KA 5JJKA 4DB2A 2BDTA 1YR9A 1Z2CA 4B34A 1Q12A 2Z83A 4Q02A 4IOJA 1II8A 4PSKA 3A4NA 4MA4A 4PO1A 5FI0B 3BB1A 3THYB 1E99A 4M1SA 5JLJA 4MITA 3M0EA 4QG7A 1DO2A 2H1LA 2QY9A 1N5IA 2OXRA 1VECA 3F5FA 3LO5A 1TMKA 3EZ6A 1TAGA 3RS5A 3SHFA 4IFBA 2QGNA 1FQKA 3C15C 2YVUA 1HUQA 4UXIA 4ZKEA 1AK2A 2WWHA 3GLFE 1JEEA 4AYTA 5TDHA 1MR3F 2WJGA 2YNMA 3VX3A 2VTKA 2A7QA 2FA9A 2NZJA 4RKFA 3GLFB 1JAIA 3OE7A 2RHDA 4XD7A 4P0TA 3OEHD 2JDIA 4BLPA 4BZQA 1PUJA 2WWGA 5IDVA 2NGRA 1G41A 2JLUA 1Z47A 2ZU6A 1M6NA 2C5LA 1KTVA 3AF3A 1EFRD 4UKDA 1T4GA 2A3RA 2VLIA 3EPJA 1AQYA 1UBCA 4TZ0A 1DG3A 1XXHB 4DLUA 2XNSA 1E94E 4ZI3A 3AB3A 3IBGA 4AURA 2CK3A 4WZ6A 4ZCMA 4LY6A 2QENA 3I32A 1KDRA 1ZU5A 1GM5A 1QRAA 3PEWA 1U99A 3FFAA 1QHXA 2ZRBA 2VYFA 4PPQA 4HUQB 2V1XA 5FOXA 1M7BA 3EZ2A 1OF1A 4ACAA 1NRJB 3VNVA 4DUGA 1M7HA 2A5DA 2FMXA 4JL6A 3AV0B 3U4QB 1JR3E 3U7HB 4CT4B 2JIZA 4MUAA 1TADA 4PHHA 3EC1A 1W4CA 3TKLA 2XTZA 3B1XA 4PAOA 1OT3A 2NO9A 4DCNA 5FBLB 2J1LA 5FPTA 1OIXA 3MJRA 2ZS9A 4H1VA 4K8OA 5AWFC 2YWHA 4FCTA 4LOAA 4FMCF 1R5BA 1RRCA 1Z6YA 1Z3IX 4QHSA 1W36D 4LUCA 4US1R 3L8ZA 2D62A 4PC3A 3A8TA 1G3IA 3UWKA 1FOEB 4BLOA 4C2UA 1TF5A 3B1ZA 2FFQA 3HP1A 4N0DA 2WPDD 1U94A 4NL4H 2FSIA 5A5GA 3JZAA 1FX0B 3LW7A 1DAHA 1DARA 3HYRA 1TU4A 2JAQA 3PUZA 4KFRA 2WWWA 1P2VA 3MMPA 3O8DA 2QMHA 4JVNA 4M9QA 1S96A 2OEPA 4JS0A 1JPJA 2WMOB 2VP2A 3KJIA 1W49A 4B2LA 1VG8A 1VCIA 3CRW1 3FPAA 4PC2A 4BZXA 3PEVA 2NPIA 4EPWA 3T5DA 1KI9A 2DYKA 4TMZA 3ONWA 4QBFA 1TEVA 3WRYC 4WW0A 3GEHA 4F7WA 3ZIAA 3MWJA 2ZR0A 3BOSA 3WHLA 4B6FA 1E98A 1E2HA 1MO5A 1JXOA 5JJIA 3NH6A 4FINA 2BMJA 3EG5A 2GVDC 3FMIA 4LV6A 1GKYA 3GJ0A 3QNUA 3CKLA 4GOJA 4CZ2A 3KQUA 2ANCA 2RGXA 2MSDB 3AQ4A 4DSNA 4C0BA 3WRXC 2V4ZA 4IDHA 4MKGA 3FHTA 4C4PA 1E0SA 1Z0IA 2D7DA 1E9EA 3QEOA 2G1JA 5EXPA 4OQNA 5FL7A 3WMFA 5GJWC 1E0JA 1QHSA 1N0WA 2ZR7A 2ZRMA 1WBBA 4TYYA 5FFMA 4CIDA 3U5ZB 1GIAA 1IONA 1DO0A 1Y63A 2DWQA 3CWZA 5AJVB 3DM9B 1BO6A 3U3RA 1LV7A 1UPTA 3PG5A 1AIPA 4DSOA 3GFOA 1G5PA 4D25A 3LW8A 2O0HA 5L3QA 3CF0A 1FFHA 1GZSA 4M1KA 4TQAA 4AWXA 5IHPA 5BN5A 3PVSA 4US0R 1XTIA 2ZITA 4ITRC 1ZNYA 4W5JA 4X8HA 3SYLA 1KOFA 5FUYA 1N5LA 1A2BA 2IC5A 3DZ8A 3EWAA 4PANA 2R2AA 3CB4A 1AGRA 1DAMA 2QMEA 2QL6A 4LC1A 3KXLA 1L7VC 1JQLB 1NN1A 2ZSFA 2GCNA 3LBIA 1R8QA 5G40A 1TQDA 521PA 1Q1EA 1ZM7A 4CT5A 3KQHA 1AS3A 1COWD 3N2EA 1G6OA 4IW3B 1ZNZA 2VA8A 5FH9A 1W7AA 5BQ5A 2BBOA 3KZ1E 1GAJA 1F2TA 1VG0B 4I99A 1G3RA 3P4YA 1K6MA 1JR3A 5FTJA 2FFAA 1BKDR 2BMEA 2VHTA 3H4MA 3W90A 4KVAA 4KFSA 2PCLA 3BFXA 4Q18A 1EWQA 5FBWB 5KDLA 3VQTA 4ASUD 3GD7A 5C4GB 1QHNA 1XX6A 4IOKA 1OW3B 5EP4A 1XMJA 2FZ4A 3SOPA 5C18A 4JLVA 1E9DA 3EXAA 1HURA 3K9GA 3QPWA 1SXJE 1EFRA 4ZCLA 2OXCA 1NI3A 1IY1A 3B85A 1OXVA 5CYOA 2G77B 4P32A 3DVLA 4MGIR 1OFIA 3VX4A 4D2IA 1Q57A 1XP8A 2A30A 3DHWC 1E0KA 2IYYA 2R62A 3RS7A 2GAAA 1N2CE 3KJGA 1YZKA 2A5YB 3BFVA 4TQUS 3BH6A 1KI1A 3DL0A 5SZKB 1P2SA 3TRFA 2QZ4A 1DG1G 2PZGA 1BS1A 3R20A 1GRQA 2ZRJA 3KJHA 4AIIA 3QXSA 5BYKA 2ZI7A 4ABYA 4IDQA 5EE9A 2GHIA 5TXGA 2Z4SA 1ZINA 4US2R 2QI9C 1VCNA 1XD2B 2ZVPX 4N0EA 5AUQA 2ZPTX 2BEJA 3LD9A 1KK0A 3ND8A 1KKMA 2CCKA 1AQUA 1IXZA 2AK3A 4NCIA 1LNZA 3NHBA 2O8FB 1KSGA 1N0VC 2EYQA 4KI0A 2AX4A 1N6NA 4OJKA 2F9MA 3L0SA 3M6AA 2ASEA 3UIEA 3LFUA 1TQ2A 2BEKA 1MOZA 1O87A 3NEYA 2ZE6A 3B7GA 2Q0HA 3QKRB 4HZUA 5B2ZA 4URVR 2WJVA 5CLQA 4LZZA 1OB5A 1KI7A 2XEXA 1HEIA 2GCPA 2DFTA 4YMTA 2VHQA 5JS8A 2OBMA 3KKPA 3VNUA 1KO4A 2J7PA 5L3SB 5K8LA 2DFNA 1JB1A 2PZEA 1Q1QA 4M9SA 1HY3A 2J0SA 4JBWA 4FWIB 3GFTA 3ZD6A 2VP9A 4DEYA 1YR8A 1UEIA 2CCJA 3PQCA 4URUR 3X1DA 4F4IA 3OHMA 4WZAE 5GJCA 2RMKA 1WDTA 2BJWA 1YHNA 2OLJA 1GFIA 3G0HA 1MO3A 2F6RA 2OHFA 4MRRA 3U2QA 3P4XA 3PUYA 4FMDB 1IQPA 4BFZA 2ONJA 4M22A 3CIOA 3SNHA 3X1XA 5FOUA 1GSIA 3RVBA 5C46F 4CF7A 3LX5A 1G291 2CHGA 3TVDA 2IEYA 2MSEB 4Q4JA 2HT6A 3FMOB 4XVQA 4QL3A 3I62A 3VKHA 3CRMA 2QSYA 1G3QA 3UXMA 3I61A 1E4YA 2ZE7A 1DAKA 1TX4B 4NCHA 1RYHA 1E32A 2Z0MA 4Q03A
chains in the Genus database with same CATH superfamily
2VP4A 1Z73A 1PR5A 4A4DA 4BMOB 1YJQA 1CHNA 3AKCA 3UMJA 1PG5A 2FK7A 3B1WA 3UK1A 1TU3A 3VTZA 3W6UA 1T9GS 4QDUA 4F5DA 5LKRA 3VUEA 4ZO8A 2IX3A 4E70A 2BJVA 3R8CA 3I5YA 2BTQA 2VTEA 4KSBA 2H92A 1D1PA 4BLUA 2EWWA 3K1AA 5EQFA 1OAOC 4EJSC 4Y6LA 5A9SB 3OLVA 5EUCA 1GUZA 2EFHB 5SZHB 3ZOZA 4GQIA 2R6GA 2HDNB 4FD2A 1H23A 1E3EA 1ZS9A 4P7BA 4UMDA 3EFOB 4QD3A 1I7LA 3I6QA 2GAIA 4ZAVA 4CMIA 2GWRA 5JZMA 3VSAA 1S1CA 3GZNA 3U9LA 5CLFA 3ESAA 1JPVA 4I5GA 2WIKA 4GLFA 2D8AA 5I9TA 1AXEA 4IMRA 1IOZA 3TCNA 5GPBA 2GLUA 3C8HA 2RHGB 1KARA 3A4TA 1N0UA 3RGWS 2GN9A 2C2XA 4G1VA 2XPCA 2I6XA 4GKVA 1BHO1 3P97A 3CYFA 3ZR4B 2VO1A 4UFPA 4QWWA 1ECPA 2BKVA 1AH2A 3DTVA 3IVAA 4YASA 3TZLA 2PAAA 4BFCA 4ZJZA 5DJ5A 1X9IA 2IPOA 2V7QD 2Z5FA 1BCRB 1FFDA 4MGHA 1L5LA 2ZJ6A 1FL9A 2X7XA 2QPAA 1V96A 4LRQA 3T0IA 1NL3A 3V3TA 4D44A 2Q7XA 1QCCA 1EFCA 1Z0FA 2PWYA 8ABPA 4GAEA 1P7CA 1NWCA 3SLRA 3WISA 3KM0A 3UYLA 1WBDA 4WE3A 4RJLA 2XECA 4WI1A 5AI5A 4LISA 5AVRA 3RU9A 1FYXA 4IZ6A 3GLIA 5JCJD 4L0MA 1HZZC 2EFJA 3NDPA 2BN4A 3DQQA 4RTRA 4QARA 4MR9B 4NH0A 4E1BA 2DUNA 1J39A 1UOQA 2BGRA 4OQLA 3U1TA 4BMVA 2C2WA 4D9EA 3THYA 1Y4AE 4POOA 5ICEA 1M2NA 3UKDA 4IHJB 4G25A 4DNQA 1NFFA 2C4MA 4GZ6A 2JVKA 4CV1A 4UZFA 1B0UA 4FONA 3H2ZA 4BVKA 6Q21A 2V0NA 2HHCA 4KQ9A 1SGWA 4REQA 2IZ5A 1DJPA 4KUHA 4QHYA 4ZQFA 2X5KO 5J2UA 3CKMA 1Y6JA 4QEKA 1K27A 2GXQA 4LOJA 1TM1E 1QIIA 2A5GA 1DDIA 2B5WA 4JCOA 3ODPA 4PLHA 5P21A 4ERNA 4NEGA 1R16A 2WJHA 4DLTA 1ZJYA 1H8EA 3CTPA 3EUEA 4BX8A 3AF6A 4LY3A 1V1RA 4JIMA 4B3TB 4GXRA 4DIDA 2BFCB 4JDUA 1J0BA 1L5RA 4JLBA 1EFTA 4FEAA 5J4LA 4YXWD 5K01A 3E15A 1T8RA 4KLZA 3KOZA 2ZRIA 1LI4A 1R4ZA 1SO8A 2FUCA 2QQ0A 3AR8A 3GLTA 4XYEA 5FBRB 1NMZA 3NS7A 1ND5A 2BDEA 5KKCA 3ETJA 2CE2X 3IAXA 2FWBA 4YRZA 2IPAB 2OAP1 5EYPB 2VJMB 1EYZA 3L1UA 4RY0A 3ZQ6A 4B43A 4MWGA 4E5PA 1MN6A 2O0JA 4CMKA 5K0JA 1D2EA 4R16A 1JECA 3ENKA 2P9TA 1B6RA 2FRDA 2QXUA 2KB0A 4MUMA 4OHOA 1HLDA 4C4ZA 3I6ZA 1TMYA 1ZKMA 3QPUA 4JGGA 1ZITA 4JYAB 5HIIA 2WFAA 3OHPA 1WOYA 2D3TA 2IY9A 2PBZA 2WU8A 1AKTA 3NW9A 4V0NA 3PA8A 1N1DA 1SELA 3ADBA 3I5XA 4EI7A 2WJPA 1LQ2A 4C4YA 2NXCA 1NAIA 3JARA 2ZG6A 2B4QA 3DYBA 4QXMA 1L5HB 4H0FA 3T99A 5A6SA 5K0SA 3WBKA 4M83A 1NQUA 1JEJA 3A27A 4RV5A 3I6YA 1FRNA 1NHWA 4Y2XA 3N5CA 2V5AA 1TGVA 4QGFA 4BKUA 5BOSA 3QJYA 2HXSA 5DLDA 2QAGA 4WKOA 4CM4A 2FX5A 4TMFA 4RTSA 1S01A 2A78A 2J67A 2M1XA 4PQYA 1MEEA 8LDHA 1YFJA 1B41A 4F5WA 1QZUA 3BUSA 1MB2A 1MORA 2HN9A 2I2AA 1EM8B 5AVXA 4FEGA 3CZ5A 2IHZA 3MILA 4TLAA 2Q3EA 4YMWA 2H5IA 1GZ6A 2G9VA 1IEXA 2P5SA 5D6OA 4O4LA 1AU9A 1NW7A 2Y68A 3DFMA 3FLEA 4BV9A 1U3DA 2EFEB 2J3HA 4UE3S 4HLNA 5JD4A 2R0QC 2D5CA 4FB5A 3ND5A 5DI3B 1YHZA 2ACVA 4CKWB 1J0AA 1SU4A 2E85A 3F6YA 3GX1A 2RCNA 1J97A 3SJCA 1CNFA 3MJVA 3C8UA 1G1MA 3WLLA 3PLRA 1ISPA 3RWMB 2GEBA 2HU5A 3PDHA 4MWBA 5EN4A 4BC0A 3D7LA 2RI1A 4NPCA 4ZPXA 6GPBA 1E9AA 4MYHA 5IT4A 5K6TA 1LF5A 2B7BA 1T35A 3PWTA 1GV0A 4CQMD 2AV6A 2O8EB 3ZEIA 1CJCA 1IUPA 5EZSA 1Z82A 4NENB 2C3OA 4OK6A 4PWZA 2FW8A 5G3ZA 1IRIA 1N7JA 4IUYA 3KZCA 3F6SA 1M8JA 1R88A 3FR7A 3JQGB 3PIDA 1Z5OA 5ETJA 2V4MA 3UAOA 3B7PA 5DASA 4EUNA 1A1VA 3K8ZA 2VR1A 1SVSA 1NLZA 2AUNA 4NMWA 4Z9YA 4PHCA 2NM0A 2OO5C 1LVUA 1L6RA 2C9OA 2WPDA 3CB2A 2OO3A 1VSBA 2QG9A 2AB0A 1AMNA 1QANA 4GDMA 1TCAA 3RSHA 4BNXA 1AKYA 1QIFA 1EXVA 2YDXA 3ZHTA 5JNWA 3E03A 3K4QA 4C07A 3UA4A 3O2QB 1EK1A 4G0MA 1U8EA 5DM70 5LJLA 3FGNA 4R8LA 4BASA 2A9QA 1N6IA 4PCLA 1GGJA 5AT1A 4UVIA 1H05A 4Y2JA 5DE3A 3OTHA 2EKDA 3AR7A 2OPHA 4UOZA 5DX8A 1F2UA 3D6UA 4I6EA 5EP3A 4A2CA 2H7XA 1US8B 3KP1A 3VYRB 3OJLA 4N54A 1BGWA 4TWAA 2AKYA 3VYSB 1FS5A 1XCJA 3GV0A 4HTFA 4KWEA 1I7DA 2V3WA 4IIEA 4M8LA 5KYTA 3QKTA 4GQAA 1PF7E 1Y42X 4GOMD 2RGWA 5AHWA 3EXFA 4DWJA 4BPRA 1O7JA 3K5WA 4WFJA 2DOKA 2YN0A 5HWSA 3QUCA 4GI2A 1GDDA 3V4FA 3R9XB 2W6OA 3DE3X 3TJMA 1ZHHA 3IHKA 5KTRA 2ZR9A 3CJRA 2BMAA 1LPPA 5D1HA 3U61B 2ES4A 1C7EA 3Q9LA 1VBMA 2GN8A 2BTOA 1E2GA 3EVEA 4OH1A 4YQEA 3BK2A 5LVAA 1IQRA 2OBXA 1PKEA 1U9YA 1GCIA 5SY4A 3CH5A 5FORA 2CBXA 5TPWB 1KORA 3B6MA 3HRKA 4MB0A 3CNNA 1BDMA 1SB8A 2FPPB 3K30A 1O6GA 2ZI5A 4TV9B 2BHSA 5CRIA 4B35A 3W5DA 1SQ0A 3LECA 4ZRMA 3IMKA 1PRYA 1J70A 3PUHA 2Q5EA 5FNZA 1N6PA 1LTKA 4WESA 1NNI1 5AI9A 1EJ2A 3IESA 2LCFA 4R8RA 2GXAA 4FFBA 3L93A 3TW8B 2REQA 1XMXA 2J41A 3TOXA 1HDIA 2J3DA 3QF7A 3E70C 1XTJA 2C00A 4FT4A 3BSSA 1M34B 3EZ7A 1LW6E 5ERGB 5F23A 3SGLA 2O5RA 3CLUC 3L0IB 3ADCA 2H8KA 1WXXA 1JLSA 3PJRA 1JFLA 5CA0A 5AMXA 3KOYA 2W4QA 2GYWA 1JXQA 3X3HA 4ZYZA 1TPZA 4RPLA 2FP4B 1LBTA 3F5SA 4HYQA 2XCRB 4B9EA 4WVFA 4BMZA 2Z5LA 3IDFA 2JGDB 4LHVA 4PHGA 5CFQA 1XEFA 4DC9A 4TS3A 3QWAA 4RULA 3WWEA 2JFBA 4I2VA 3HDJA 1ZMBA 2DKFA 3FZEA 1ESZA 1BHSA 2SKEA 1CRZA 1KC3A 3ESBA 3G85A 1V3UA 1C30A 1D6NA 1N1MA 3MZ0A 4PSVA 3W6PA 1JLRA 1T8WA 1T5SA 1TA9A 3LVBA 4RE6A 2IYEA 3HDVA 5E9JA 2LCQA 4DA6A 2J0UB 3UBTA 2JGJA 5D3MA 1EZZA 3Q8WA 4BNVA 2JJ1A 4UXHA 2TECE 3ZKAA 4RTLA 3VHQA 3WMXA 2DWCA 1UKCA 5B7QA 2P9YA 5I3CA 3IP6A 5K8VA 4O4JA 1R8SA 3KQPA 1BW9B 1DT3A 1ZK0A 5FWYB 2W2KA 1TVKB 4Y9SA 3PCXA 5TEWA 4B3IA 1W0KD 1W6RA 4YRBA 2CHEA 4U4AA 4ZZ0A 3D9QX 2GARA 1MENA 5KJCA 1PS8A 2EKLA 1JSCA 2M1ZA 1TCCA 3CR7A 4I9UA 4C0AC 4B71A 3TLBA 3BD9A 3CUTA 2XNKA 3ZGVA 2RH9B 1M2KA 2FWAA 2DH5A 2EL9A 3OC0A 4JI5B 5DV9A 2COUA 4GS5A 2XSZD 5JECA 4AY4A 1M2OA 1XTUA 4MV8A 1JNXX 1ZR2A 2NOAA 2OECA 3QPBA 4UMVA 5CH3A 3AJ8A 1JE1A 3FSEA 5FRDA 3KLBA 3UKJA 1G8SA 1EWYA 3JQFA 5AJYA 1HE1C 3PGJA 4MW4A 3D4OA 3HZZA 4MAAA 5BV7A 16PKA 4PLGA 1BH6A 4QU5A 2YHIB 1ZM3A 1HQKA 1FC0A 4WSOA 4LE2A 4MQEB 5J63A 3BH0A 3WXMA 3ND6A 4ZV7A 1W19A 1WXEA 2AHOA 2V6FA 4UUOA 3BXFA 2J7PD 2XB2A 3WDSA 2X2PA 5DIZA 2XOXA 3C6XA 4V02A 4EKGA 4XLLA 1CD5A 3C1TA 3ROXA 2UXDB 3PPVA 3ASUA 5J2UF 1D9XA 1U3TA 4GUDA 3W34A 3WSWA 1P0QA 5DBHX 5CDUA 5JALA 1J24A 3HI6A 1D07A 2D1FA 1GQOA 3NDJA 5EKSA 4Y1FA 1A2KC 6CHYA 4DGQA 2AFVA 1KEPA 5JAOA 1MOPA 3NANA 3OLQA 4NAVA 1EGVB 1BEZA 1R5NA 1YDFA 2LRHA 3O9VA 4LJRA 1WSAA 1YTUA 4LFCB 1FFXA 1JWBB 3ZE0B 2JFVA 1RAIA 1JI0A 1TYBE 2C4HA 3AEUA 3M1LA 5CCEA 1OC4A 5IM5A 2PH5A 3PICA 2V6MA 1KETA 3LY5A 4MQUA 1LDNA 4KNYA 2EIXA 1JVBA 1QH0A 2Q99A 4P54A 4TUYF 2PGNA 2W58A 1Z15A 1M2VB 1U65A 5LA6A 1M2WA 3NV7A 1HKHA 4AROA 1V6SA 2CVFA 4HNSA 5BVGA 5FI5A 2AC4A 1WU7A 1NSTA 2HSWA 2B2XA 4UNIA 4D4LA 2BFAA 1P2TA 1DC5A 1JQJC 1N5OX 1MIOA 4MMXB 3DNFA 2GT1A 3TDMA 5E1BA 3EZ9A 4EMSA 3FHCB 2FDCA 4M37A 2EJCA 3JQ6A 1VL5A 1E4OA 1OHHA 4ER3A 5L7YA 3TMYA 2QUIA 3UO8B 5BNZA 3EWNA 5EIOA 4OREX 3KHSA 3RV4A 4AK9A 3D4NA 4LK2A 2MYTA 4AYXA 3ADOA 1GRNA 1IHUA 1XJQA 4DZZA 3RYCB 3MBOA 2GXSA 1PWHA 1O1YA 1ZJ4A 1WMDA 3JQDA 3L2OB 1NZJA 4NK4A 4WZBB 1MC4A 2FN4A 5IDYA 1CY8A 5F64A 4CMAA 3FE2A 3R6DA 4I5DA 4JXKA 2BY4A 1PAUA 1YMUA 2FMFA 2ZWOA 5ALTA 1T25A 4QBIA 5IC6A 1XVTA 2QA5A 4L8VA 2EEZA 3JQCA 4BOYA 1FYDA 4NAHA 3JZMA 1XYYA 3BA1A 4U7TB 3WLKX 2ADFA 5B37A 4YUAA 4RJ2A 4GNKA 1O95D 3GWGA 1VIYA 4NOJA 1P4SA 4UHKA 5EIAA 1ADBA 1ECBA 1EP9A 1SWVA 2DKNA 2Z8ZA 2PQMA 5EQJB 5IJAA 2XLBA 5EPEA 1GOTA 3JU3A 1T6ZA 1LSJA 4Y9DA 1B00A 1RTTA 3D64A 1CUEA 5H1YA 5AW3A 5KQGA 1BD4A 1HDOA 1Z6GA 2XMZA 1S8FA 1D5WA 3V1YA 4KXUA 4M0UA 1I4DD 1LC0A 4B47A 1PZNA 2W6ID 2Y0EA 4UUPA 1DJOA 1MG0A 1V7ZA 3BGWA 4RKYA 2PL5A 3FFTA 1XMIA 5JFTA 2PRIA 4G5OA 4QGGA 3RJ5A 3O2NA 1N75A 3GNQA 1UINA 2VDUE 4B8YA 3FF1A 1VPLA 3ED1A 1AF4A 1FZQA 2JFUA 3HHPA 4OYHA 3MT7A 5CB8A 1PW7A 1HO3A 3DPIA 1TKCA 3MB5A 4ARBA 3B48A 4QTUB 3E9EA 4C4SA 5GJVC 1L7DA 1GP2A 4X3OA 5FJIA 4ASUA 4WHMA 1TCBA 2AEJA 1VP3A 4QWMA 5HDQA 4LV8B 3QF4A 3HI4A 1VLZA 3FDXA 3NPMA 4KJXA 3QYPA 1M6WA 1YS6A 2WZCA 1KP2A 3G9QA 3UBMA 3UH0A 3DWFA 1PTJA 4XH9B 1BE6A 2WG1A 3HBNA 3OIWA 3GFPA 1U6IA 4JBXA 2VRCD 4NAUA 4R1UA 4OCZA 2B37A 5B3JA 4DIEA 4DR5B 5H81A 4F92B 1GEEA 3VO8A 2ID8A 5JSFA 1U6JA 2NADA 4PV7A 2Q5QA 2PKEA 1G5TA 3QVJA 3D3WA 4YR7A 5CBPA 1R0YA 1CQWA 4LDQA 1C9MA 2WLSA 3H9BA 4WOPA 2QL5A 1PHRA 1RZVA 2FMTA 3CN9A 4K87A 3SX4A 2R6HA 1AN0A 3GVXA 1ZRSA 2OCYC 1KVQA 4H4EA 2G4LA 3FZNA 2I4OA 3GT7A 4R68A 1SBNE 3VFDA 4ED9A 3E3OA 3KHKA 4I3HA 2LKCA 4YT8A 2JLWA 4DT1A 2VXYA 3CLVA 2ETXA 2RONA 1FS4A 2D1RA 3CUWA 1GN8A 4I0WB 4KZPA 4BO1A 4WK2B 4W63A 3BF8A 3DKPA 1J06A 1CVRA 4BB9A 2P30A 3A4VA 4FHZA 2EL7A 3HKBB 4IILA 2FN3A 4WKBA 4ZT3A 4AJOA 2OCDA 3BHIA 5LKAA 3I53A 1A8UA 1NZFA 1RAFA 4DY4A 4DJEC 1QIDA 3LLMA 4MW5A 1C3LA 1Z2PX 2CXHA 3QXXA 1X80B 1ZYUA 4GH5A 1H2WA 1ZP6A 4OTZA 3R23A 4ZU1X 2JGLA 3SEZA 4M0KA 4DCVA 1RU3A 2YHSA 3HYTA 3RSLA 4CG0A 4E2WA 4EG0A 3VAYA 1CJMA 2AR0A 5EE1A 3CRRA 1BN7A 3MAAC 1LI5A 1P5RA 4YP0A 3WL4A 4EKYA 5CDFA 4TMVA 3QUSA 4HNVA 1PJBA 1UWVA 3NC1C 3SHTA 3QKWA 3RUFA 3TAUA 5L3RA 3H8WA 1KEZA 2CLOB 4PX3A 3H7AA 1QC5B 1W2WB 1QJ4A 1Y3HA 1PLLA 2I55A 3PKIA 1PV1A 4LSMA 3IVMA 4ZTUB 1R6DA 1W25A 4LWPA 3W4IA 1QGED 2X5OA 3N2IA 1Y6RA 1CUJA 1OAKA 1VL8A 3LL7A 2PXXA 1PD1A 2DR3A 1HQDA 3D5TA 4HT3B 2JLZA 3G9TA 4WUVA 1N8KA 3PQ5A 5FIUA 5F9FA 2PCJA 3GCXA 4RZIA 5TGDA 1DOZA 4JMLA 1O2DA 2GM3A 2XJ4A 3ACDA 3TDKA 4NCKA 3PD7A 2FW7A 4Y0AA 2X15A 3S44A 3UTDA 4E12A 1LCIA 3ICQB 1DQZA 3NG1A 1A0OA 5HILA 2JIZD 2FDRA 2RI0A 1ZNXA 2GFQA 3UB2A 1F1BA 2Y0CA 4XB1A 2PKYX 4EABA 3ILXA 4O2AA 3HJGA 2JAWA 4PAMA 2INGX 4RGQA 5KJ6A 2BGWA 3ANXA 1JSRA 1NNUA 3HJRA 1HC7A 3EAQA 5BSMA 4NKRA 1UKVY 4YRDA 4DQUA 4EEZA 2C4KA 1HSZA 5DHFA 3AR3A 4EYQA 1RI3A 1U7UA 2JA2A 2QQFA 3OCVA 2PV0A 4Q0MA 4OHMA 3WIUA 2NSHA 4J0DA 4AG6A 1I7NA 1XXLA 3CLTD 3PFWO 2XB6A 4BLVA 5CFNA 2LNDA 3Q5EA 3V97A 1Z0AA 3DOFA 3QU5A 4IF4A 3VO1A 4N1AA 3ITDA 3E6AA 3NBZC 2R8ZA 4QVKA 2ACWA 3QVUA 3WYCA 2PGDA 3M89A 1VJGA 3DEZA 3T1OA 1Z63A 3DW1X 2HNBA 1Q0SA 4RENA 1SXJD 3K0FA 3ME5A 1GR0A 3LLUA 3QPAA 3PNSA 1E62A 3LUHA 4OJTA 4QO8A 1SOWA 3THSA 4ZVSA 5BMVA 4W5WA 5ITVA 3PNVA 3R3JA 4P7KA 1B42A 3NHWA 4I55A 2YMLA 4ZO9A 3QMWA 1VE3A 2PLRA 2IUTA 1E6MA 5JC1A 4EZBA 5ALHA 4H2DA 1BX3A 2PNFA 3EXHA 3NIBA 3MRXA 4RGYA 4ILEA 3W2FA 4C2BA 3PL5A 4DIOA 1P2FA 1PVOA 4L08A 1Z38A 2D4AA 3GJ7A 1I2AA 3HKCA 2R1VA 3MG9A 1JHVA 4ZI7B 4F84A 4IWYA 4RMGA 3JQPA 1KQOA 3BJRA 4FDMA 4QAQA 3W2HA 3RODA 4D4HA 3OO1A 2CJXA 3O3OB 5J1TB 5DOZA 4WIAA 4C7JA 2XDQA 4UTRA 5LOVB 2X22A 1NG9A 3PE4A 4DJFC 1TYZA 4LPKA 5AXCA 2VJPA 5DRTA 4B4WA 4EFDA 4XPIB 1S9HA 1W73A 2VJCA 3TQIA 2JLXA 4MWZA 3TCXB 1T8TA 4XD7D 4AY5A 1MG5A 2EV9A 1MPXA 1PGOA 1ZUNB 2DG2A 2GHRA 1P1FA 3R7FA 5F7ZA 5FYDA 4ZVTA 4AUMA 3V4ZA 3QBDA 1NY5A 2VYVA 4Q47A 5AFSA 4DV7B 3FTQA 2YZMA 3HNOA 3E7PA 2WIBA 4OQMA 4V03A 4QJ4A 1Y1SA 2Q6VA 5EP1A 2IYVA 3OU2A 5B36A 3M5PA 3HM9A 3B82A 4N3CA 3LO8A 4WNCA 5CIQA 2PL1A 2WE7A 1Y4ZA 1FFYA 3LT5A 4Q6WA 1K9VF 4OG2A 4RK0A 3HKEA 4RWZA 1LDMA 2H4WA 2NAFA 4FNAA 3K35A 2NLOA 2YJ5A 1TO6A 2W6JD 2XYQA 1W85A 4L5YA 3DEFA 4NDZA 5BN5B 5KVQA 2H06A 4R81A 5LZ8A 5B4UA 4B3SB 4D96A 3HBMA 3P1JA 3QX9A 4K9RA 4X6XA 5C8XA 1HTBA 1NQXA 2B9VA 1G66A 2CLDX 2RFLA 4QUGA 3ZDYB 3FOEC 1XTSA 2X77A 4OFZA 1CJTC 1M1YB 1UKZA 3E81A 4FMCB 1FNMA 4HNAA 2K87A 1F8UA 1VLQA 2XMRA 3TE7A 1SZPA 3L1HA 3Q87B 4KI7A 1TUBA 4LJLA 3VSCA 1GLNA 3DAHA 1SQFA 2D1SA 3GRVA 1BEEA 3C7CB 3EUFA 3E4CA 5LZ9A 1Z5WA 2NO6A 1T9CA 3I2KA 4QEDA 2YXPX 3KOXA 1KO8A 3OX2A 3NC0C 4MUGA 1E1QA 3KEGA 2RGNC 1LZKA 1PR2A 3Q85A 1HORA 2C5BA 3DDUA 1ZOSA 2ZSHA 1GZ7A 1LPNA 5C0OE 4EKDA 3UPTA 5C53B 2FG6C 3NTVA 5G4KA 3KKMA 2V45A 5J4HA 1P3JA 1E9FA 4PBSA 2GXUA 1PLKA 4HWRA 2FXIA 2J5XA 1TFRA 3P9NA 2VNAA 1WEHA 4RELA 5C3MA 2ZUEA 3N0XA 2IQ5A 3KLMX 3GCDA 4BAUA 3GT0A 1IXRC 1J8MF 1WXQA 1PNTA 1NYQA 2QZ9A 2AUMA 3M8KA 2B78A 3EGVA 1GADO 1WJGA 1N5KA 2QEQA 4Y2TA 2GM5A 4RQAA 1ILEA 1PJ2A 2CMDA 4LCJA 3I1YA 4P58A 2Z98A 4RC9A 4F56A 1L4MA 1UMCA 4ESEA 3TLYA 3K4PA 1R8XA 4KR6A 4V3BA 1C0KA 3S2IA 4FYHA 3WFIA 5DHQA 2HLPA 1RRMA 2VPQA 4U6QA 4M98A 4GM1A 4RKEA 3NXSA 1E3QA 2NSLA 1DDOA 3KSMA 2QMUA 2A6PA 1E1CB 4WZZA 4OP1A 1CEYA 5LIRA 1ENOA 2CDNA 4DHWA 3MAJA 1DAGA 1BU8A 2VWHA 1P7PA 4GM0A 3K9WA 2OZKA 1U63A 4EM6A 3A9UA 4U5QA 2YOHA 2RCYA 1Z2NX 2HBZA 4C5AA 4C20A 4RV9A 1JKIA 5ALLA 3I58A 2C2GA 2NV0A 4HAZA 1H66A 4JQSA 1U7DA 4JVSB 1RJDA 3OIGA 2PMCA 1FSSA 1T9BA 4FDTA 4U02A 2H2AA 4W7SA 4E30A 3W8DA 2OGTA 4KFTA 3VVLA 2GM4A 3TSYA 1AURA 1VZ2A 3BH7A 4P4SA 4C2TA 1VE1A 2W2QA 1NN0A 4QQ8A 4Q1EA 4BQNA 2OM2A 1E2KA 4IXWA 4RD1A 2Z5VA 4S35A 3TXYA 1STOA 1Y33E 1DKRA 2HHJA 3CUEF 4MW9A 4CYMA 4P33A 4RTKA 4CNBA 2HRDA 3PEYA 4MCJA 4BJ3A 1PV2A 1C7QA 3S55A 2X1LA 1BXKA 4YO7A 4KNWA 1JKFA 5HZMA 3G8YA 4ZI2A 3DEJA 4ZYTA 2ZUVA 1KSJA 4EECA 2DCUA 3CW2A 2RG1A 4IJ6A 1XZBA 4HADA 4H3HB 4D4IA 2O7RA 2WDZA 2OUIA 1W1IA 2C98A 1PYGA 3L1IA 4IOMA 4BMXA 3IVCA 3PU6A 4TSFD 4AFNA 1FVHA 2JI7A 4XVCA 1EWTA 4PZLA 5EJ9A 4ETWA 2FPOA 3WLPA 4DMFA 4ZOLB 5EKXA 2O3SA 3RK0A 4A1OA 5A5FA 5C5EA 3E53A 1JSLA 3RU3A 1KQFA 1S6YA 1O8BA 3CLRC 3HVHA 3MMSA 3U4IA 3DD1A 3EQ6A 4LJ9A 1JDSA 3L7IA 2YV5A 4TQGA 5EHIA 3RAPR 2C99A 2I2XB 4Q39A 2V59A 2ZSAA 9LDTA 4H1WA 1CQZA 1GVHA 2DJ5A 4ROSA 4QPPA 3GYGA 4B0PA 2EZ8A 2PD6A 1Y3CE 5CM8B 1EB9A 5LL6P 5LYJB 1UPCA 3NIFB 4IIJA 1A9QA 2C57A 2GEVA 4K6KA 1P60A 4AKHA 1JSZA 2XI4A 4LSZA 3H4IA 1E9CA 4KQMA 2ZSKA 1A8SA 1IBMB 5IAOA 4M49A 4EG7A 5JS7A 4LQ4A 1Q0UA 3ZCTA 3TAXA 2I9KA 1QZTA 3EVCA 3EDQA 3X1KA 5AKXA 4U3JA 1URPA 4FYIA 1ONOA 4OBEA 2EGUA 3SXJA 4EW1A 3FDFA 4P53A 3IKMB 1KDZA 2FH5B 1J2YA 5KNCD 2HTFA 2DM6A 2JK0A 1GGNA 3IMEA 4ND8A 4A0RA 2QJRA 4P4TA 1QPBA 3NV9A 4TXNA 4W5QA 2O8DA 3IBTA 4M9UA 4NYMR 1L4NA 3EIOA 3FAZA 4R3NA 2X4DA 4I1PA 1QCZA 1AC5A 2YJGA 3GBPA 3UJ8A 4AZ0B 3G2KA 3BAZA 4RHFA 2QYTA 2DXIA 3AVYA 2ZE8A 2Q4OA 5JTTA 3INGA 5IMSA 4KR7A 4L0DA 3OURA 2CLEB 3ZJTA 1QPGA 4RCVA 4FKMA 4EZEA 1Y4SA 3CH4B 4PWYA 2VTBB 4HN9A 3MOIA 2O3UA 4EW6A 4IIBA 3F2VA 5HS6A 1UM8A 4DBLE 4D9CA 3ZW7A 1BU5A 4W5HA 1C1DB 1WG8A 4UDXX 4O4IB 4Q1DA 3B3FA 5KU1A 3VJKA 3KL4A 4K26A 1F8XA 3G02A 1Z8DA 2WAMA 3HRHA 1QG2A 3KFXA 5FL3A 2FPKA 2P2GA 2YZNA 1CDZA 1XT6A 3JALA 5BSEA 5FNVA 1TYDE 3C6MA 3OTIA 1SUBA 3QYJA 2ZJ3A 2OAQ1 4IDCA 5EE5B 5FTMA 1KVTA 5G1OA 4ZOBA 4U9HS 3LAWA 2IS1A 2Q46A 3LC7O 3KCNA 1CQJA 1SVUA 4CFYA 3ADKA 3G0GA 1UOPA 4ZO7A 1XVVA 4O4IA 5DTJA 2MR6A 3LNCA 4N5DA 1J4AA 1DLIA 2DULA 3A1CA 3RAFC 1V2GA 4C4OA 4DA8A 1PL8A 3SVLA 1JR4A 2M9MA 2OZPA 4BX9A 2WSIA 4G8BA 3SVZA 4RHXA 2Q9CA 3STHA 1SD1A 2HWYA 5BN3B 1LX7A 3RSCA 3TTYA 4AQ7A 1OR8A 2HD4A 1LTHR 1YGPA 1P3DA 1IU9A 4NDNE 3PXBA 1CRLA 4XCXA 1RKBA 1ECLA 4XTCS 2OFWA 3TTTA 1ZSYA 4GDFA 2FB9A 4AZ0A 2O7VA 4L8FA 1HNZB 1FUYB 1P6XA 2JKYA 3BRCA 1VE9A 4MWTA 2GZRA 2J59A 3EQ9A 3Q6IA 4RTJA 1RM5A 5BSHA 4RMJA 4YIHA 5TQ0A 2HRBA 3MEQA 3B5IA 5GZ6A 4ND8B 1P4AA 1UBNA 1YOBA 2FLKA 4BTVA 3NWJA 3M82A 3W7VA 2IU3A 3I3SR 4LXYA 3C6QA 3CBGA 3SC2B 3I0ZA 2WM3A 4JYMA 3FWHA 1MMFB 3BPSA 2IWHA 2O2DA 5FBKA 4NBVA 1ZJ6A 1JS1X 4Q34A 4IWXA 1GPWB 4LYAA 4L6AA 2PKQO 3MWEA 4HYEA 4XWYA 5HQJA 3V4VB 2IYZA 1XU4A 1KNXA 3DBHB 3ESYA 1GKUB 1AHIA 1P31A 1WCIA 3T3EA 3K0HA 4NX2A 5BWLA 2WOJA 3CX3A 2VKQA 2WKQA 4JASB 3B12A 5IAAA 3NNDA 2O2GA 4M1MA 5JYBA 2FMUA 1RP1A 4GLLA 4K5QA 2RKWA 4KYUA 2H4JA 3E82A 2QN3A 4RXTA 4PRKA 4HLUC 5DLQC 2PS3A 4G3XA 3GARA 4URYR 3U9SA 3HFGA 1OTYA 1WCYA 5D7NA 1I7PA 3T7RA 2CD9A 4DUGD 3L4JA 4X7BA 2OB1A 2GEJA 1CETA 3H0CA 2IY7A 1NNSA 5HRAA 2HLDA 4MR8B 4WK4B 4MVJA 1S2NA 4HSEA 5JAPA 4NV1A 3PR1A 3UT6A 2IH4A 3UMGA 1W4ZA 1GNVA 3KXDA 3L6CA 3AHJA 3FPHA 2BZGA 1B8OA 1UC5B 4D3DA 1MDBA 3KZKA 4JI7B 2B35A 3HP4A 3K0EA 2GLTA 3DT6A 1M1ZA 5ARCA 3NTRA 4HVLA 2HEIA 5D85A 2JANA 1O8CA 3F9RA 4F3RA 4IVQA 4BVAA 1MJGA 3KIPA 2A5JA 3QU9A 2XIQA 4G4GA 4JBLA 4XYBA 1A82A 3JVIA 5CEEA 4WN9A 2HK7A 1ZOOA 2JGIA 1LLUA 2Z08A 1O9HA 3LXUX 1L1FA 4CVNA 4E03A 4BO3A 1CR4A 1P61B 4PFQA 3MGGA 1K5GA 1JQAA 2X9VA 5DO9A 4RJKA 5I47A 1UXHA 2I99A 2IITA 2AHRA 1EUDB 1UDAA 4IYRA 4KQ6A 1UAGA 3YASA 4IAOA 1TA0A 3NBKA 3JRXA 4GM4A 4E2FA 2RGEA 4ZZ3A 1FQJA 1KS9A 2PH7A 2XQKA 2VZ9A 4N4AA 3CEPB 3JD4A 4MPDA 1MDFA 2C2OA 3GP5A 4RD4A 5IHXA 1JIXA 5DCWA 3AO0B 4Y8VA 3BWYA 4Q7KA 1FVFA 3UH1A 1PR3A 3Q7EA 4NYIQ 2C5GA 5DN6D 3N07A 3KE9A 2G80A 1XZGA 5IK2A 3UA3A 1YIAA 3C3DA 4XYGA 3G7UA 4R9UC 4V0MA 1P33A 1BJRE 3B6ZA 2VT2A 1UBSB 4QECA 2N1MA 1Z2EA 3NHAA 1LWNA 1UIRA 3P2IA 3CEAA 3PCRB 4OQYA 1K75A 2ZYHA 3JWPA 3L4EA 1YB2A 2O7SA 4UNPA 3TSAA 4J90A 3VGJA 1U8XX 5TMPA 2QX9A 1HPLA 3ABZA 3MQ2A 2QAGC 2Z2XA 1X92A 4QTYA 5IKXA 1KZ1A 2HAEA 5IABA 4GPIB 3EDYA 3Q7RA 4RMNA 2R96A 4DSTA 1VHWA 3LOPA 2GK6A 4K2HA 3KJEA 4LTNA 3R3SA 5H80A 3KALA 2A9PA 3L8FA 1IAVA 2P0EA 4MUEA 4DNFA 1P74A 2VUIB 3PC8A 3IV9A 3P71T 3WB2A 2W6ZA 2C5FA 4P3XA 3SBOA 2GMWA 2VLBA 4U7JA 4MHOA 4CGZA 3TH5A 2QSJA 3EVTA 1O4WA 3E0QA 4CQLA 4UBLA 3P32A 5IF3A 4WPGA 4EW2A 3U40A 1D1TA 1MRSA 4QICA 5JDCC 3MWLA 1A7JA 1HOTA 4C4RA 3R7DA 3P9ZA 5JI2E 3OPYB 1JFRA 2QJOA 4TXHA 1QH1B 3HU2A 3OFVA 1V35A 1F7VA 2FN9A 4MYTA 5CLLA 3H19A 4Q1BA 4YFVA 2R68A 3FA2A 2XUPA 3HZHA 4P3PA 2MWMA 3A6GA 5BT9A 2GD0A 2IYXA 1G4HA 1WHSB 2BKAA 4KN9S 4PZPA 5IYZF 4PLCA 3IRUA 2WJJA 5CW1A 1JG2A 4HOYA 2OHVA 4UATA 1RMTA 1FLAA 3AJRA 3ZZTA 5NULA 5BUQA 3Q3CA 2ZOSA 1ZQ1A 4P1ZA 1V8OA 4Q3BA 4DVJA 1A77A 1E5XA 1TM7E 2Z57A 2CKDA 2DE0X 4X0EA 4ZEWA 3K53A 1YXMA 5EQTA 2YR0A 4PLZA 1P4JA 1XLWA 2X0KA 4NDAA 1YL6A 2PQ2A 1P5HA 1I7QB 1GR1A 3BCUA 4PRYA 2QX6A 4KO8A 2KMLA 3H1AA 3STWA 3WZLA 2GJ8A 2FSGA 3ENZA 3QEBZ 1G2PA 4DG8A 1N8TA 3RT9A 3QVMA 4DWVA 4NSNA 1OJ7A 5KWSA 2VSOA 4Z1OA 5LWQA 3LDFA 4BO9A 3GF4A 3UMVA 1JDBC 1JKXA 5AI8A 3FCOA 4JI0B 3KJZA 2Q3HA 1KAGA 3NWPA 2NT4A 2RD2A 4JSTA 4M7WA 2A0WA 4MIEA 1MEJA 1VKNA 4MPRA 4V2IA 4XGRA 1DRVA 4ZEXA 2JCXA 2R9VA 2XAAA 3CG4A 3OLXA 1E3SA 4CPDA 4DCMA 4JI8B 4Z99A 1U0TA 2WUGA 2CZQA 2R00A 4FJ1A 4G4IA 3ZV6A 3P26A 2A0UA 4YAIA 4ZTZB 1YS7A 4XPIA 3LA6A 4C76A 1QB7A 5J4VA 2VCHA 4QPNA 1PFVA 3KU1A 3MK31 3OLWA 4M7RA 2XDQB 3MW8A 4BQOA 1E64A 2RGAA 2RKOA 1WB5A 1IBCA 1V7QA 5K3EA 3WFJA 4OXNA 1CR6A 1T1IA 2FK8A 1CUYA 1VI6A 1OXKB 4R1NA 4FVTA 2C83A 3LBAA 4GX0A 5G1PA 3D7RA 1K2WA 4IOLA 4MPTA 3ILSA 3NIWA 1DTSA 1EK6A 4AX4A 1SJ9A 1SRQA 3DBLB 5E8JA 1VBNA 3TQSA 4XJTA 1MJNA 1C9JA 1T6BY 1U2QA 3D4LA 1OQAA 4XASA 2YYZA 3WSVA 5D01A 3SFZA 3GJZA 4LNHA 5BMVB 2RK3A 1ZCZA 1T9GR 2C5HA 5E1MA 3AEYA 3DHNA 2H5LA 4G9GA 3JQ8A 3F7MA 3CE9A 3SDSA 3WE7A 3PNYA 4A2WA 1X7HA 1RE0A 2D7CA 2FZEA 3CINA 3Q10A 3PWSA 1KIMA 2E49A 1COZA 3KR9A 4A6XA 1UKBA 1XTBA 2CHUA 2GF9A 1BMTA 1MJ5A 3R6WA 2PIAA 2GPTA 4G5QA<