2RGNC

Crystal structure of p63rhogef complex with galpha-q and rhoa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
177
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Galphaq-p63RhoGEF-RhoA complex reveals a pathway for the activation of RhoA by GPCRs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein complex
molecule keywords Guanine nucleotide-binding protein G(i) subunit alpha-1,Guan
total genus 44
structure length 177
sequence length 177
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rgnC00
2XOKD 3EA5A 2QY9A 5IK2D 4UXJA 2RGDA 3QBVA 1YU9A 1S1MA 2Z6VA 3AF1A 421PA 2OLJA 1E0SA 3B9PA 1BYUA 4IFEA 1KI8A 3GEHA 4LHZA 4I1VA 1G7RA 3TR5A 1Z06A 3ZZ0A 4QHTA 1CJTC 2FFQA 5HE8A 1GUAA 5JS7A 3W6NA 4HUTA 4ESVA 2QSZA 3H0KA 3A1WA 4XWKA 1I4DD 1B23P 1T3SA 1WDTA 4BE7B 4A15A 1ZAKA 3LX8A 4IDOA 4MGIR 4BFYA 3EPKA 1AS3A 1R5BA 2JIZA 3NBFA 5JECA 3U3KA 1E2FA 3K9HA 4LZZA 1P7CA 4TYQA 4C0JA 1JR3D 1IN8A 3CW2A 4NYJQ 1M8PA 4QL3A 1N0VC 1RJ9B 4DSNA 5L3VA 3RVBA 1E2QA 4S2EA 2IBMA 5HKKA 4JIMA 2WWHA 1RC8A 1Q22A 2W83A 4PQYA 3EASA 4KVGA 2IF0A 3CX6A 3FE2A 1G5PA 3KJHA 4FINA 1TQ4A 2ZJOA 1FQJA 8OHMA 1NVWQ 2VO1A 5FOTA 3KKPA 2O8BB 2WICA 2FF7A 1ZU4A 3C41J 3Q85A 1XTKA 5J4KA 2DWOA 4GMDA 1XXHB 4Q03A 1D8TA 2Z0MA 1ZD1A 4TL7A 2QQ0A 2Q3MA 2AWNA 1G20E 3Q7PA 4M1OA 4F7WA 2QRNA 1SXJB 4L5BA 2QNRA 1OLOA 1XEWY 2G9NA 1S2MA 2QL6A 2OEPA 2C03A 1CR0A 4JMPA 4WA7A 2ECKA 4PO8A 4OBEA 5SZIA 3H86A 5FBRB 1JAHA 1Z0IA 2NO0A 1KDPA 1I2MA 2AD1A 1P61B 3SC3A 2NTYC 4LJ4A 4EPRA 2AR7A 1OKKD 1WF3A 1G291 4LRWA 1VIYA 4FCTA 3UMSA 3RDPA 2VLIA 2D7CA 1ZM7A 4MH0R 4OI2A 4Q4JB 2IWHA 2BMJA 621PA 3TUIC 5L3SA 3QKSB 2CLSA 4QHYA 1JAIA 1OYYA 2WM9B 1HEIA 4W9MC 2JAQA 3GEIA 5KNBA 5BQ5A 3ZS9A 1XJCA 1G5TA 4MRNA 3QKSA 5EE1A 2P0EA 4XWAA 3T1VA 1XJ0A 1A5TA 1SULA 3KZ1E 2W2TA 4KODA 3GLGA 1Z6XA 1E2NA 2YNMA 4H9GA 2RHDA 3Q5EA 4TYPA 1Q3TA 1ZMXA 3GD7A 3CX7A 2EYUA 4ZV4A 2GEUA 4HAUA 2GEVA 1XD2B 5J4VA 1AIPA 3TRFA 2GCPA 2IXFA 4TMXA 3BB3A 3PUYA 3P20A 4LK2A 3WMEA 3K09A 4MUBA 1T8TA 1XXHE 2VP9A 4P32A 4TYWA 3PQCA 4RY2A 1OIXA 4LYJA 3I32A 1RW4A 3MWYW 1N0WA 5FOXA 2C99A 1FL9A 2CL6X 2GXQA 2FFHA 5LB4A 1W4AA 2FGJA 3PCRB 5F3WB 2VEDA 2XX3A 3TJZA 3OZXA 4PSAA 2AXPA 4TQUS 3TIFA 1N5KA 3I1FA 3U61B 2C95A 4TMKA 2QT0A 4K46A 1YRAA 3I92A 1ZBDA 4CEJB 3U3RA 3GFPA 2WOJA 1GITA 4DDUA 3PV0A 4M1WA 3UIEA 2KBEA 1CU1A 1J99A 3KFVA 1KO7A 4US0R 3RS5A 1NI3A 2G6BA 3WYFA 2EVWX 1E2HA 3QVVA 3PFIA 1F3OA 1M34E 3U7HB 2ORVA 1U94A 4XD7A 1QHHA 2D74A 2ZUBA 1S3GA 1R0XA 2P3SA 2WKQA 2O52A 4Q01A 4XSGA 3H84A 2FFBA 4TMWA 3CZQA 4DWJA 1SQ5A 4AWXA 1JXOA 2QAGB 1QHHB 4FMCB 2WSMA 5EUMA 3I8XA 5KDDA 2FSIA 3MCAA 2X2EA 3Q9LA 1IJEA 2IHBA 3BERA 2JJ1D 2A78A 4CDGA 1Z47A 4D0LB 3QUSA 2J0VA 1NG9A 2KB0A 2FG5A 3L8YA 3RNLA 4TT3A 4V02A 1KK1A 1J90A 3AKCA 1JEDA 3O8CA 4YDSA 1BS1A 2GHIA 3EXAA 1FW6A 3Q72A 5AWFC 1G3IA 1SXJD 4R7ZA 1ESNA 2BBSA 5FOWA 4AURA 4ZI2A 1VCOA 5JCPA 3KQKA 5M04A 2WJIA 6Q21A 2WWIA 2ZVQX 1HA3A 1S9HA 2ZJAA 4DUGA 4EIWA 1DARA 2V7QD 2RGNA 1ZRHA 3W34A 3EZFA 4MRRA 4JZKA 4Q1BA 4XSHA 1TEVA 1MABB 2W6ID 3IPYA 3BBPA 4TTQA 3AKYA 3ASZA 1G3MA 2O0HA 2QMEA 4OI4A 4N0DA 1X3SA 4FIDA 4P0TA 2RKOA 4C0KA 4MKFA 3VKGA 1DOAA 1Q21A 5HZKA 1Z5ZA 3L0OA 5GJBA 1JJVA 4UJ3A 3F0TA 4TQ9A 4UXIA 2EYQA 5F2EA 5FBVB 2GDJA 4DSOA 3EZ7A 1PJRA 2WPDA 3QKUA 1JBKA 3MUFA 2CBZA 4JL5A 5BN5A 5CJPA 4LBZA 1CEEA 2BBWA 3U7FB 2Q9BA 1F2UB 4P3YA 2V6JA 1PUJA 2QROA 1KI7A 2A9KA 1C9KA 1T6NA 5KSOA 1IY0A 1Q0UA 3TSWA 1DBSA 3TGPA 2F43A 2D2EA 4Q4JA 4CEHA 1W2HA 1BMFA 3X2SA 3OEED 1YR8A 3CLVA 1F2TB 3NWJA 5HCIA 1Z28A 3C5CA 4ITRC 3MSXA 3H1TA 1T5IA 5KO2A 4LBVA 1YZKA 2HCJB 3MRSA 1DAHA 4TTRA 2GZAA 3ZH9B 2O5VA 2YC4C 4XTRA 1E0KA 1WB9A 2IF2A 1D9ZA 1MRSA 4OQLA 3BB4A 4I1OA 1TADA 3THWB 3IQWA 5E7IA 1G8FA 4D6PA 1E1QD 3CWZA 2ZSAA 4Q1DA 4Z8YA 1R5OA 4B2PA 1CR1A 3U44B 3WNDA 1PLJA 5J47A 2NPIA 3C4JA 4F4CA 1GL9B 4JSTA 4HLDA 1U81A 3I73A 4M9ZA 3S1AA 4LV5B 1Z2CA 4IVPA 1CS4C 1RRGA 3AF3A 1M7GA 4OQMA 2ZRIA 1CRQA 1KGDA 1ZUNB 2IUTA 1UDXA 3A8TA 1BOFA 1GNPA 3GJ0A 3BFXA 3BXZA 3ICQB 1XEXA 1UBCA 3NDPA 2G0NA 4Z51A 4YDHB 1M74A 3T61A 2ZE7A 3QKTA 2NO9A 1L4YA 1U90A 1UBFA 2PBRA 4HB0A 4FMDF 2B8WA 4ILEA 1Z0JA 1YKSA 1JXMA 1II8B 1NKTA 4V0KA 1SVKA 2AFIE 3GQBA 3VAAA 2HCBA 3HPRA 1E2MA 2ZTSA 1Z22A 3C5HA 4JL6A 3D8BA 1KNQA 2OAQ1 2P65A 2J41A 1MH1A 3AP2A 4I4LA 3WRYC 3GJ4A 2CL7X 3PUZA 3EA0A 3B1YA 4GPTA 4XIGS 2VSFA 1KYIA 1XFAA 1OHHD 3OHMA 2Q9CA 1N6LA 1R5NA 3M4YA 5JSZA 1XD8A 2SHKA 1E0AA 1W49A 2ZRFA 2BCGY 2EW1A 1X6VA 3QENA 3ZYCA 1SGWA 4GZMA 4QKQA 2RGBA 3THXA 2OG2A 3SYNA 5C2JB 2VSOA 2WHXA 1RRFA 1L7VC 1SVOA 5IK2A 2PZGA 2CCJA 2YHSA 1AJEA 2WBLC 3AUXA 1QHXA 4CF7A 3VU9B 3DZ8A 4CEIA 3M1IA 1TQDA 4GT1A 4D81A 2WJHA 1DTSA 1S3SA 2L0XA 4C0SA 1OJLA 4B44A 4D26A 3KQNA 3IEUA 3VU9A 4CEIB 1ZP6A 821PA 4QJ4A 2OXRA 1T91A 4X8HA 2ANCA 3ICEA 4PO9A 1OXSC 2VP0A 3KFXA 4R2HA 4B76A 1S4QA 3N5CA 4DLSA 1IXRC 4G5GA 2GZDA 3DKVA 2EFHB 1I4TD 3LA6A 1DO2A 1YR9A 5FOUA 5HE9A 3NTUA 5JJIA 3NG1A 3LW8A 2XB2A 2WJYA 1PUIA 4MYUA 3ZIAD 3T15A 4EAQA 4NZYA 3GP8A 1LV7A 2QP9X 2H7VA 3AF2A 4DEYA 5FPYA 1SVSA 1WRBA 4L16A 2KI5A 4WXRA 4IDNA 2C5LA 2ZSBA 1W4BA 3C15C 3E5HA 2QAJA 1OFUX 3CPHA 2J7PD 2G77B 4LJ9A 2C78A 2IYYA 2J46A 2XGJA 3FGNA 2BM1A 3PR1A 3QKRB 4JLMA 5AUQA 1VG0B 2WWWA 2XITA 1P9NA 3I8SA 4ZCMA 2NQ2C 2YZ2A 2IK8A 1VG1A 4MRSA 3GPLA 2IS2A 4YXWD 4MGZR 3UATA 2J0UB 2OILA 2QZ4A 3I61A 3K0SA 1SVWA 3OEHA 2XB4A 3EAQA 1UKVY 1LB1B 2VP4A 4IJMA 4XVRA 4EJSC 5GVSA 4EJSA 1KY3A 3L0PA 3QXXA 2IT1A 3WMGA 4IRUB 3UWOA 2ZU6A 4ACBA 2A5DA 2J45A 3VHXA 5SZHB 5FTKA 3E1SA 1JQLB 5FBLB 4YMTA 2ZI5A 2CCKA 1ETUA 2YC2C 2WJGA 4NONA 4JLDA 4RFSA 1GKYA 3NH9A 2WAXA 3O8BA 4JBXA 1UADA 4Z1MD 3U7GA 5FTMA 2IS1A 2I3BA 1JECA 2QGNA 4LPKA 1TMKA 3SZRA 4S35A 5FH9A 1XPUA 3VR3A 1SZPA 2W6IA 1XP8A 1XTIA 3G0HA 5GJCA 2VHCA 5G53C 4QG7A 1EFTA 1AQUA 2ZRCA 3F3YA 4NH0A 3UG6A 1KI6B 2F1HA 2J87A 521PA 2REXB 4G01B 2ZI6A 2OESA 2JLRA 5JCZA 1T4GA 3IHWA 5JHGB 5KHOC 1E1RD 4MYCA 1CF4A 3I3SR 4BLOA 1E9SA 4LI0A 1T5LA 2JLQA 2XXAB 5EZ5A 1HT1E 1ODFA 4B75A 4BQSA 1WBBA 4QBFA 3OFND 4R9UC 4CVNA 1YR7A 2ZRGA 1I4LD 2ZSFA 3N2EA 3U6KA 4HAVA 3EPHA 3LX5A 3QOFA 4Q9KA 1OF1A 1Q1QA 2N46A 1PZNA 2HEIA 4GBMA 4E03A 5C1BA 2VP6A 1NIPA 2O8FA 4TSFA 2NZ8A 4LC1A 5J4LA 2AFHE 3B1WA 1OW3B 4IDQA 4L9WA 3AV0B 1ZD8A 3AGPA 3ECCA 3TK1A 1H8HD 3LW7A 2V3CC 1G3UA 2WVJA 1ZIPA 5L8VA 1LTQA 2VA8A 1NLZA 4C7OB 1P60A 2WSSD 3MFYA 3X1WA 3OAAD 1KAGA 3RS3A 4R2IA 2ZSDA 3KX2A 4KSBA 2FSFA 1RPZA 4BEJA 4CW7A 2FX3A 5GJWC 1YZUA 2PMDA 4A0FA 4DVGA 1W0JA 5AK0A 5FTNA 1O87A 4HZUB 2J3EA 3ETLA 4TYNA 4AIIA 5J4HA 4GZLA 4RKFA 5G41A 2QQEA 2ZRNA 4GOXA 3AVOA 4JLVA 4PHGA 1A2BA 1U9IC 3GJ5A 1AKYA 4AD8A 2D7DA 4FMCF 2NIPA 5IHPA 1G7TA 1OYWA 2GVZC 5C46F 3ZGXA 2OO7A 5CM8B 2CJWA 2BMEA 2PT7A 2CE2X 1GRQA 2V55B 2VP2A 3KKNA 5G3YA 4DEXA 4YQFA 4M4SA 1II9A 4M9SA 5KTYA 2HJVA 4KSCA 4GL2A 5KSZA 3DM5A 3ZZTA 1UKZA 2XZOA 5DNYB 4PSVA 3SJBA 2V9PA 4BLPA 3LH5A 1OXXK 4OHZA 1F2UA 3SHWA 4NCJA 4EKDA 5BN4A 5DI3B 4B47A 1CRPA 1ZVQA 2RGNC 3FB4A 1JPNA 4YC7A 3U3OA 3ZQJA 3K53A 1JPJA 2Z4SA 2BBOA 2WJJA 1YZQA 2HLDD 5L3QA 1W0KA 2FH5B 1F5NA 1ESMA 2GJAA 2ZUDA 1XCMA 3LXRA 2GWHA 4FCVA 5EXXA 3PEVA 3GLIA 2KE5A 3AKDA 2HYIC 5JBQA 4OKSA 4JYCA 1IN6A 4QGFA 3GMTA 3BOSA 5JMTA 4IEEA 4FWTA 1G21E 1P2TA 3QF4A 2RGGA 4OHXA 4P4TA 1JR3E 1FP6A 2G88A 3QBTA 4GP7A 3WXMA 1KZGB 1CTQA 1YVDA 1RZ3A 4IVQA 2FPMA 4IOJA 3T34A 2GJ8A 2NOAA 2Q3FA 3K0AB 3NHAA 3QEJA 3PUXA 3BIFA 5BN3A 1XB2A 1YJ5A 4WZ6A 3NVAA 1E2DA 3QNUA 1P9WA 2IXEA 4NL4H 3WP1B 5L3RA 3EPJA 2OCYC 1E2GA 1U9IA 4JT4A 3KXIA 4ABYA 2BKEA 2F3TA 5JZVA 2F9LA 4DC9A 4D4KA 2O0KA 2ZI4A 2ZXUA 4P4UA 4Z54A 1FUUA 1DAKA 4GNKA 4XTCS 1GKIA 1OFIA 2REOA 3P1JA 1EX7A 3HPQA 4M1KA 2GJKA 4C9BA 1ZNYA 1Z0KA 1SXJC 1GILA 3NBXX 3CF2A 2ZS9A 3K70D 1YZTA 3FKSD 4QGAA 4Q48A 2X1VA 5FR1A 4TLEA 1G8HA 1GP2A 2D06A 1V5WA 5K8UA 1FP7A 5CK4A 1E69A 4A0GA 4TMZA 4UJ5A 3LRPA 3OEEA 2YOHA 4I1UA 4LCBA 4F38A 1R0WA 4LV6A 1COWD 4PHFA 1KHTA 1E0JA 2Q6TA 1KNXA 3KUCA 2IS4A 4JVSB 4POAA 1X8JA 3VR5A 1IHUA 2A5JA 4B33A 3MGCA 3SOPA 3QXHA 2QPOA 4A92A 1H8EA 5EP2A 1OE0A 1W36D 1S96A 1QG4A 3CNOA 1O3YA 4TQAA 2WTUA 2BEKA 5AJXA 4JBWA 2AKYA 2V8OA 4OK5A 4URXR 5F9FA 5FTLA 1Z29A 3C7KA 4I1SA 1Z0FA 2FJUA 4LJ6A 3V9PA 4B3GA 5B57C 3AKEA 4NTZA 3LWNA 4DDTA 4E5UA 4RD1A 2I1VB 2P6RA 3CR7A 3FMIA 1W0KD 1IOZA 1F60A 5CLLA 4JLKA 5FL7D 1CJVC 2JIZD 2ZSEA 1N6IA 1P4SA 4BRWA 4ACAA 4R71A 4JLJA 3P4XA 3RS7A 2RMKA 5CDFA 1LY1A 2Z43A 2IYUA 2DFTA 5CM9C 1EWRA 3KQHA 1GRNA 1QRAA 2FU5C 2UKDA 2WV9A 4PC6A 4QGHA 5FR2A 3RWMB 3ADDA 3U2QA 1K8RA 2OE2A 1HURA 3UK6A 2VHJA 4ZDKA 4UNSA 4EUNA 2HDNB 2YVUA 2A5YB 4PPGA 3Q5DA 1DAIA 1ZCBA 3UKDA 3P32A 4H1UA 4KBFA 1Z3IX 2OBMA 5D3MA 1TNDA 1Z8FA 2WPDD 4JS0A 2GJ9A 1N5LA 2N42A 2XSZD 3TH5A 2DFLA 1GNQA 4K8OA 3VR6A 2RH5A 1GKUB 3AP3A 4JVNA 4AKEA 3FHOA 3DDCA 1ELOA 5EXPA 1T9HA 2X8AA 2WAYA 2VSXA 2B7CA 5KNDA 3B6EA 5P21A 3SQWA 1ZM2A 2DFKB 4JLBA 5FI0B 5EXSA 5LDDC 2A7QA 4KFSA 3AVXA 2CVFA 2PEYA 1KSHA 3QPUA 1KJWA 1CR4A 3AB3A 4B6FA 4Q4HA 5TVKA 1XD9A 2F3RA 1NY6A 2CNWD 2YOFA 1XX6A 3EC1A 1RVDA 3W6OA 1GG2A 4LJ5A 4Y0VA 2OBNA 4NYJR 1B0UA 3GFTA 4C0LA 3TUZC 3CWQA 1Z08A 1LS1A 2OUKA 4NU0A 2A3RA 3P27A 4V0OA 5H1YA 4A36A 3LD9A 1W2GA 1IJFA 2WZQA 2JJ2A 4HB3A 2ZITA 5LD2C 2IYTA 1AN0A 2P67A 2WKPA 4AYWA 1XNJA 4W5HA 3VR2A 5E95A 2J7PA 2A30A 1E2IA 3E2IA 4HZUA 3T1OA 3VX4A 5A4JA 5CB8A 4UNPA 2KBFA 1QHYA 5BW8A 2PX0A 3M6AA 5CITA 2IYZA 2CLDX 5G3ZA 2JDID 4Q4AB 4TLDA 2R2AA 5D3QA 3L2OB 4C30A 3IIMA 4X8LA 4BFTA 5GJVC 3RRNA 2IS6A 1Z6YA 3Q8XB 2YV5A 1WMSA 5D3MB 5B64A 1XCGB 2F9MA 5JFGA 4DT1A 3CRVA 1QF9A 4JLAA 2O8DB 1OIWA 1NSFA 3TW4A 4DCUA 3A1UA 4KI0A 3EW9A 4US1R 4XVUA 4PFSA 2YOGA 4HDOB 3Q7QA 1IXZA 4EDHA 1MO3A 2LWIA 5F98A 4DBLC 4PHHA 2ZETA 3B1ZA 3CONA 2GRJA 4QHSA 1GSIA 1DAGA 4PTLA 1NBMD 4BLTA 3QG1A 2ZRDA 3ZVLA 4ZIRA 1MOZA 2VBCA 1KMHB 2Q0HA 1Z07A 4OQNA 2AL7A 3RANA 5B30A 2QTVB 4KBGA 1OV4A 4B3BA 1W4RA 4ZIRB 1YQTA 3LLUA 4HATA 4HUQA 3B9QA 2OFWA 4GP6A 4W5WA 4DDWA 3GLGB 3DMNA 3AH8A 1N25A 4IOKA 4QC2A 1G16A 1KZ7B 1AGPA 1Q12A 2PLRA 5J5CA 4HUQB 3LNCA 4OHYA 1AGRA 2P6UA 4P31A 3DPUA 2ZJ5A 1TF2A 3D6TB 2GESA 3CNNA 1XBTA 5EP3A 3SYLA 5CDFE 1G4UR 3B7GA 1N2CE 2AK3A 2GJSA 4ZCLA 4XWOA 3W6PA 4TT3D 3QSYA 3UANA 4XJXA 2ZE8A 3A1SA 5JRZA 2FPKA 4RZ3A 3GLHA 1TAGA 1Q3HA 3SBEA 1NMZA 3RWOA 3ZD6A 2OM2A 4JKIA 3RABA 1ZM9A 1C1YA 5AJYA 4Q1FA 1BYIA 3T5DA 2PJZA 2DCUA 2YWGA 3BS4A 2CVHA 1ZINA 1PLLA 4PANA 4UQOA 1P3JA 5JI2E 4GOKA 3W5JA 5EZ6B 1W7AA 4ZDIA 2ZM5A 2REBA 2JA1A 2CJWB 1XMJA 4KU4A 4Q1CA 3NBYC 1JB1A 1R8QA 1NRJB 3K9GA 2XNDD 1U0HC 2AN9A 4PXAA 2BCJQ 3LBIA 3C14C 4RD6A 2BEJA 5DN6A 1W5TA 1J8MF 1E9DA 3EIHA 2C8VA 4TLAA 3SJAA 4YMUA 4LC0A 4PQFA 4JBYA 1LS6A 2Z83A 3R20A 1QDEA 3THYB 2RGCA 1R8SA 3R9XA 1E79D 4HYYA 5FI1B 4Q1EA 1CXZA 4DJTA 2QG6A 4F91B 3O47A 3QQ5A 2OBLA 4KO8A 4LOAA 5FPHA 4B3CA 1S0UA 1GL7A 3SJZA 4HI0E 2ZVPX 5DHFA 1J8YF 2DY1A 2EFDB 3LXXA 4RVCA 1UPTA 4PX9A 1FZQA 2QE7D 2H16A 3K0CA 4M8NE 3V4RA 1HQCA 1BO6A 4JT2A 1MKYA 4V0MA 1QHIA 1HT2E 3T1QA 3RC8A 1ZU5A 4Q4LA 3LBHA 1XCPA 2VHTA 1ZUIA 4GDFA 2C9YA 3UMFA 3SU8A 2F55A 1QHNA 3EIEA 1L2TA 2GBLC 4XVQA 3KTAA 4NYIR 1FNNA 4PAQA 3N70A 3GLFE 2JLUA 5JEEA 2C04A 1CJMA 1E2EA 1XZPA 3JZAA 1E1QA 2EWWA 2BHRA 4DLUA 2QGZA 2GVDC 3ADKA 3OIYA 1G41A 1NSTA 1U98A 2NMVA 5HTKA 3EZ6A 5EJEA 2H17A 1G17A 4BFUA 4O25A 4UNRA 1CLUA 4Q7LA 2RGAA 3GJ8A 5ELXA 1JALA 3GCGA 4TLBA 3CZPA 3AP1A 721PA 1IN4A 1TU3A 2VTKA 4NMMA 3W3AA 2FNAA 2C98A 2ZYUX 3JVVA 5FUYA 1OKKA 4JJKA 4CZ2A 1KI6A 1S8FA 2DPXA 3W5IA 4HAZA 1SXJE 4A1FA 3TE6A 4HLQB 5C4GB 5FPKA 2XNSA 2XOKA 2PT5A 4PZZA 1I2DA 3IGFA 4EFMA 4A0RA 3RS4A 1PV4A 5J40A 4Q5IA 1XDBA 4KCGA 3VQTA 5KSPA 3R8FA 3E70C 4TL9A 5DN6D 3BH7A 2MSCB 1PVOA 1XTRA 4A2QA 3THYA 2HF8A 4YLGA 1UBEA 3FMOB 4BLSA 1G7SA 1NVUQ 2QI9C 2RAPA 3FPAA 5AUNB 1NVXQ 2CNWA 4OI0A 1G18A 1NF3A 4IXNA 2IYQA 4TL6A 2EFCB 5CIQA 5JLJA 1W1WA 1DADA 2X19A 4GMXA 3EX7C 3QF4B 1E2JA 2E9SA 2QMHA 2ZS7A 5DH9A 3SDZA 3VR4A 5HR5A 1HE8B 2BIFA 3K0AA 2ZI9A 2QMOA 2Z4RA 3FFBA 1HE1C 5FPSA 2WMNB 4PPQA 4RKEA 4PHTA 1V43A 2F6RA 4PSKA 4BEBA 4C7OA 2AX4A 4V03A 4C3ZA 3CH5A 3NEJA 5TB5A 4QBHA 1GDDA 3SQXA 1XTJA 1IXSB 1D2NA 1A7JA 2BJWA 3LBNA 2HF9A 2IL1A 3TSOA 1ZD9A 3R8CA 3F8TA 3BORA 3U60B 1OSNA 2IXGA 3FKQA 3NXSA 3DKPA 2FSGA 1XEXB 3CRQA 1OH6A 3OIWA 2QE7A 1M1YE 4Q9HA 2F1RA 1E32A 4PQRA 2XNDA 1US8B 4RFVA 4A9AA 3TR0A 5TMPA 1VHTA 1ZJ6A 2PLFA 2VF8A 3FMFA 4P33A 4M1TA 2ZREA 2PH1A 3B85A 3QG5A 1P9RA 1MO5A 3CBQA 4KLNA 3AVTA 4QXAA 1KSJA 4MQBA 4LJAA 1E2PA 4WAUA 3UG7A 3PEWA 1M2OB 3LDAA 1BMFD 5JSZB 2HJGA 4J0QA 4MDFA 4PO1A 3IILA 3MJRA 3K0CC 4IOMA 3I5YA 2R6GA 3ADBA 4I99A 2QBYB 1WP9A 4L8GA 1AKEA 3B8HA 2AKAB 3LLMA 4JL8A 4JVMA 1MR3F 3SFZA 1XWIA 3VNVA 1U8ZA 4LYFA 1F2TA 2J0UA 2X77A 5E7JA 2GXAA 2FN4A 5SZKB 2IYSA 3CUEF 2BKUA 3GJ3A 3OEHD 3LVRE 2PZFA 2ZI3A 2OZEA 2UZ3A 5JI3E 2GXSA 2QA5A 1DEKA 4NPHA 5KPJA 1EFRD 3EWSA 3QPWA 1P6XA 2WKRA 1AA9A 4XH9B 3CF6R 1FMJA 4G1UC 4KHZA 4LHWA 3V4FA 4FD2A 2GTPA 1GTVA 3CX8A 4AI6A 2UZIR 1EX6A 1W4CA 1G8PA 2VHUA 4CRWB 1XMVA 3DM9B 4KV9A 5TDHA 3RC3A 1J2JA 1FTSA 1G1MA 3NH6A 4A2WA 4ZI3A 1NN0A 1UKEA 5AJVB 4KAXA 3BD9A 4FCWA 2D62A 1TQ6A 3GJ6A 1XTSA 2OHFA 2C9CA 2FWRA 2JCSA 5H68A 4OJKA 2ZJBA 2W2VA 3EIQA 3EZ9A 4US2R 1GFIA 3IHLA 2JLWA 4U5XA 3KUDA 4ZKEA 1ONBA 3B60A 1DS6A 3HU1A 3K0EA 4A4DA 1OB5A 3OE7A 3KL4A 1N5JA 4B34A 1OFHA 1GM5A 3SN6A 2B6HA 2WWFA 4B71A 3G82C 4BWYA 1SHKA 2P5SA 1RRPA 4E09A 5FOVA 5J4YA 4EPWA 1GZSA 2R62A 5KDOA 3K0FB 1C4OA 2HXSA 2OFOA 3UWKA 1QBKC 4PZYA 4Y0AA 4KFUA 4M1SA 2ZRKA 3LFUA 4C2TA 3SYKA 3PIRA 1JQJC 1DAMA 1D6JA 2HV8A 2B7BA 3DEFA 1N6NA 1P2VA 2QAGA 5CJ2A 1Q57A 3W8NA 5EQTA 1Z2AA 5DISB 1U99A 2NO6A 3N2IA 5B58C 1ZM4A 1E79A 3T12A 1X8LA 4NDZA 3OFNA 2ZR9A 4M1MA 4EJSB 1VCNA 2YWFA 2D4HA 1WCV1 4NHOA 1VDZA 4A8JB 3X1XA 3K70B 4ZKDA 2XJ4A 2VF7A 1W36B 1OT3A 1T3LA 2DYKA 4B73A 3MWKA 1E4VA 1Z6AA 2DFNA 2G83A 1BH2A 2HYDA 3IUYA 4DUGD 1F6BA 3RAPR 1S9DA 4CT5A 1W47A 4I81A 1Z63A 1UJ2A 2C96A 1CIPA 3WHLA 2GCOB 3L8ZA 1NLYA 1KK3A 1S1CA 1G3RA 3FYHA 1L8QA 4WOPA 5BYKA 3KJGA 4MKIA 5EE9A 1CJKC 5DYIA 1G3QA 3A36A 3C16C 5FUXA 4TL8A 3O8RA 1G9XA 221PA 4TLCA 1KAOA 3GFOA 5A5GA 4RCYA 1Z0DA 4PZLA 4C0AC 4KITB 4F93B 1E9AA 4DRZA 1NY5A 5JEDA 3RYTC 1G7CA 3IBYA 3CR8A 4RFSB 3RRZA 5AR1A 3WMFA 4QNMA 4LJYA 2NGRA 4B3XA 4BLQA 3GLFA 2LKCA 3RHFA 2BC9A 1EGAA 2G1JA 2GEDA 1RKBA 1SVMA 3DMDA 1G8GA 5B2ZA 2AWOA 4AKGA 3EG5A 3PJRA 4F92B 3QI2A 3AF4A 2GF9A 1ZIOA 1KI2A 4G5RA 4WXPA 1J70A 5FL3A 5HCNA 1XMIA 3VKWA 4X8MA 3OAAA 4IKEA 1E9BA 3L82B 2BWJA 5KSYA 3A1VA 3X1YA 3IEVA 2XSZA 2ANBA 3JVUA 3RS2A 4H1VA 2CK3D 3U7EB 1ZW6A 4EPTA 4DLRA 3BH0A 3W9YA 2IEZA 1YRBA 4TZ6A 1KKMA 3D3QA 3K9LA 3NKVA 1K5DA 2J0QA 1EK0A 1VTKA 5FBQB 2CL0X 3HP1A 1IN5A 4RZ2A 1CJUC 1R2QA 4K81B 3GLIB 2V1UA 2XZLA 1FTNA 4NKRA 2IHYA 2YINC 4Q4HB 4TTPA 1A1VA 1G6HA 1P2SA 2RCNA 4M22A 4OQXA 4CT4B 4KXFB 1ZYUA 1UDWA 3QIAA 1KY2A 1SKYB 1EXMA 3RSLA 3ND9A 2GKSA 3TUJC 4DIEA 1DELA 1FQKA 1OHHA 2Z5FA 3U4QA 4CGZA 1FX0A 3D7MA 3ZDQA 4HLUC 4MUAA 1XEFA 2A2ZA 2FMXA 2WSSA 4NCKA 1XPOA 2AK2A 2RB4A 2IW3A 2QM8A 4L9SA 3HU2A 1E9CA 2XTMA 2FE4A 4PC7A 2W6JD 2A5GA 2P6NA 4YXWA 2QMUA 2IX3A 5LB2A 4A6XA 4Q00A 1E94E 2HUPA 4Q21A 2QUZA 1D2MA 3GLGE 2GA8A 2WMOB 1ZNWA 3L0SA 1II8A 4NYIQ 4RD0A 4JKYA 1KTVA 3B78A 4IXMA 1E99A 1CKEA 4M2LA 3VFDA 2OT3B 1QHGA 1R7RA 4RJLA 3TQCA 4O3MA 3TSZA 4MDEA 4EPXA 4NBSA 4PPFA 4JVLA 2FV8A 2NO7A 4JSYA 3H4MA 1JEEA 1FNMA 2WJVA 4D4MA 2A5FA 2CDNA 5HKKD 5H8WA 2PMKA 4WZAE 3X1ZA 4ERNA 5EE0A 3DOEA 3WHKA 5JHHB 2MMGA 3H2YA 5GADl 4V0NA 3R9WA 1SXJA 5EE3A 2FPLA 4EQ6B 4Q7KA 3TQFA 1YR6A 4YMSA 3AEZA 2MMCA 3JZMA 1UM8A 2KSQA 1IONA 3WYAA 2AHOA 4DCVA 4ZDJA 5KNCA 3THXB 4QRHA 3AUYA 1T0HB 3CKLA 1X86B 2J9RA 4B2IA 3KDSE 5DI3A 2ODWA 1II0A 3UPUA 4GFDA 2B8TA 1KMHA 1GIAA 2CE7A 2BDTA 3LV8A 4HEJA 4OYHA 3SR0A 3VKHA 2ODBA 5AJZA 4M9QA 3A1TA 4ON9A 1SKYE 4NCIA 5JWHA 2JJ1A 3BAFA 1KKLA 2NG1A 1RRCA 3G5UA 1W5SA 2IYWA 4LV8B 3P26A 4G0NA 4DCSA 1ANKA 4R98A 2E1RA 3UXMA 1G6OA 3PEUA 3REGA 5A0FA 1FX0B 1W0JD 1VCMA 5C4MA 3NC0C 1AM4D 2ZRPA 3PUWA 1HUQA 4RD3A 4QNRA 2QTFA 4M21A 2IYLD 1VPLA 1EG7A 1VIAA 3BK7A 4PC3A 2EFEB 1FPMA 1LNZA 3K9NA 4D4LA 1OXTA 1YZLA 4M1YA 4DKXA 2O8EB 3CM0A 4EFLA 5FUVA 3I4LA 4ASUA 4DSUA 1H8HA 1UKYA 4AYXA 1NVVR 4RSGA 1DO0A 1E2LA 3Q3JB 1EWQA 2W2XA 3SNHA 4WZBE 2I1QA 3DOFA 3ZVMA 4FMDB 3SFVA 5CYOA 2BJVA 4LYAA 1ZUHA 1E9EA 4AK9A 4N3NA 5E3HA 5FFMA 1MO6A 5IT5A 3W3ZB 2CLCX 2OCPA 5TV2A 2DR3A 3NEYA 1TPZA 3K0FA 3ZLJA 1XEWX 2Q3HA 1KI9A 3KKQA 3W8RA 3FFAA 2R6FA 3X1DA 3RS0A 2MSEB 3DVLA 1G19A 3K09C 3MWJA 5LBIA 2GETA 1NBMA 2QRZA 3ONWA 5JJKA 3QXJA 1KK0A 4PC2A 4HLUA 5CLQA 1LFDB 2CK3A 3QKRA 1Q20A 2ZEJA 3CIOA 4RZXA 2W6JA 3FHTA 4OI1A 4B3DA 1EESA 4IHQA 1XU4A 4U02A 1P2UA 5DIFA 4PC1A 3CB4A 4FI3C 3KJIA 4Q19A 2GAOA 2NO1A 2VYFA 4QGGA 4X8OA 4AKIA 4HB2A 4URZR 3A58B 4NE2A 4PPNA 5EXTA 1R0ZA 3SJCA 3OESA 2H57A 1XJQA 2IYVA 4FMBB 4LWZA 4C0HA 1F48A 4RD4A 1DG3A 4HB4A 2LKDA 2FFAA 4TYYA 1CBUA 3FDIA 1HY3A 1VYTA 3AVQA 3FTQA 4NCHA 5TXGA 1OB2A 1RYHA 2GNOA 4FXPA 1AZTA 1WQ1R 2JLZA 1KO1A 3I62A 2WOOA 1J7KA 2ORWA 1MO4A 3NDBB 2J1LA 1P75A 1KO8A 2O8BA 1WA5A 2ZJ2A 5AUPB 3HDTA 2FZ4A 4G5SA 3TLXA 1LVGA 1TF5A 1YE8A 2ZANA 4MGYR 4MRPA 1GAJA 1K6MA 2Y8EA 4L4UA 3K70C 1M7BA 1RE0A 1KJZA 1PLKA 2WWGA 3QEOA 3IKJA 3BFVA 4RD2A 2YJTD 2JEOA 1KSGA 1EFHA 1DE0A 4YMVA 3WNBA 3OIVA 4BLRA 1TUEA 1R10A 1FMLA 1EFCA 1NJGA 4OQFA 2EU8A 4JYBA 2D2FA 2GAAA 1NL3A 1Z83A 4HAYA 4IDHA 2B92A 4W5JA 3RLFA 2ZRJA 1U8AA 4B6EA 3U6BA 1UEJA 3I72A 3ZIAA 5JWRA 2EQBA 2XJ9A 3EARA 4ZPXA 3GLHE 1KDOA 1NVVQ 3IO5A 4FWIB 4KLZA 3CPJB 4IW3B 4LHYA 2JGNA 2ZJ8A 2BMDA 1MRNA 3MJHA 4QFMA 3SI7A 4NYMR 5DE3A 4DLTA 3RRMA 3SHFA 2WIAA 3BE4A 2IUUA 1W46A 4LX0A 5CYPA 3A4LA 1EFRA 4BUJA 2YWHA 1SVIA 3TNFA 3VR1A 2OSBA 3BGWA 1YZNA 4KYIB 1JNYA 2QP4A 5H70A 3VMFA 2QTHA 1WXQA 5ANRB 3WBJA 2ERXA 1DAFA 2ZR7A 2G3YA 2F7SA 2ODNA 4JLNA 4A8JA 5K8TA 3PVSA 3QF7A 1G8YA 1E98A 5EP4A 5EP1A 1FFHA 4IVRA 3SE0A 2O8FB 3OF5A 3PENA 3HJNA 3U3MA 3R7WA 3VX3A 4QJ5A 3AVYA 1KJYA 2JJ2D 4UXHA 5GVRA 3WY9A 4F4IA 4UNQA 1WE2A 2ZE6A 5E7MA 4URYR 1VHLA 1RJ9A 1NN3A 4MRVA 4AG5A 1VYUA 3KB2A 1VG9B 2G0TA 4GSYA 4G5QA 4Q02A 2IA5A 2OCBA 1D2EA 4TSFD 2W58A 2ONKA 4TMTA 2P5TB 1NMYA 2GF0A 3FKSA 2ZRBA 2O8EA 5FUWA 4O2RA 3U3JA 3VTKA 5K8LA 1MV5A 4M0LA 2JLXA 5TARA 2ZPTX 3B5JA 1BIFA 4QM6A 1P72A 1QVAA 2QN6A 3PUVA 4BECA 1CULC 3CPEA 1HQYE 3QE0A 4YMWA 5DLQC 1N3BA 1Z6TA 3RSOA 3GLFB 4V0ME 5FL7A 4BZPA 4DB2A 2R6DA 2ZJYA 3QPVA 2QP3A 3KB1A 1N5IA 5JRJA 1KO5A 4URVR 1E2KA 2ERYA 121PA 5CB6A 4B48A 2HLDA 1IAQA 4OK6A 2BV3A 3GJ7A 4MYHA 2GBLA 2Q21A 4QM7A 2ZS8A 5EUQB 3TKLA 2JATA 5KDLA 4QBIA 1NLFA 4BPBA 2ATVA 3CO5A 4PAOA 3REFA 3LO5A 2ZQ5A 3TMKA 3CRMA 2YKGA 4KYUA 1AQYA 1N6RA 4NCNA 1RIFA 2X2FA 3BFKA 4ARZA 1HH4A 4RZUA 4TWZA 3LQQA 3ZJYA 3A6PC 4Q7MB 2EWVA 2C77A 3IIJA 3NHBA 4MGKR 3BC1A 4C4PA 3I5XA 1QZXA 1R0YA 2ZYWX 3DO6A 5KUTA 3FWYA 1QG2A 2TMKA 4DLYA 4Z1MA 4Q9LA 4DLWA 2V6IA 1AS0A 4BFSA 2QSYA 1NNEA 5BXQC 1DPFA 2BOVA 1P5ZB 4D0GA 1IY2A 3T1TA 4TZ0A 1P62B 4DSTA 4LJ7A 1XD2A 4PAMA 2J5XA 4Q18A 2G1KA 4HSEA 4FW9A 2HXYA 1U8YA 3ZZUA 3LY5A 3VNUA 2GXUA 4B32A 4DLXA 5AJWA 1IM2A 2QORA 1UAAA 1JR6A 3TAUA 2OV2A 2ZYTX 4EFNA 1KO4A 2BBTA 3F5FA 3KKOA 2C9OA 1HTWA 5K8IA 1KK2A 4OL0A 1TQ2A 1YZGA 3VHLB 4BZXA 1XRJA 2GCNA 2XAUA 2XZPA 4URUR 1H65A 1P73A 5DO9A 4HAWA 4WIAA 1ZC4A 3AVUA 2CEAA 4LYHA 4CYMA 2H8KA 2PZEA 2UVQA 3HYTA 4LBWA 4DHEA 2WIBA 4CEJA 4L15A 1IQPA 4URWR 3V00A 4DXAA 2PCJA 1KSFX 1W48A 2FDCA 2JLYA 1KIMA 4KJZA 2GK7A 4MITA 4P4SA 4QJ3A 1N6PA 3P4YA 1US8A 4GI7A 1K5GA 2ZRAA 2DWPA 1OIVA 1E1RA 1ZNZA 2H18A 3GEEA 1NBME 3IIKA 3KXLA 4A8JC 4IDPA 1M6NA 2OLKA 2ZYVX 2W0MA 2R6CA 2E87A 4UKDA 2CXXA 4DCTA 4ARZB 5HZHA 2DWQA 2C2HA 2IYRA 1UF9A 2NZJA 1VG8A 4XOIA 1ZNXA 4A82A 3B82A 1X8KA 4V0LA 3D31A 3IO3A 4QOSA 4Q66C 4EPVA 2FSHA 1Z0AA 2F1JA 2W0SA 1Y3AA 1XZQA 5KU1A 4AG6A 3AF0A 4E22A 1KDTA 5FBWB 5DYGA 1KI1A 2GZHA 2HT6A 2RGEA 2JLSA 2QENA 2VP5A 1E3MA 1COWA 1E96A 1SKQA 2CHGA 1OH8A 1OPXA 2RHMA 4QBGB 3ADCA 2W00A 1IBRA 4M9XA 1T3HA 1XMSA 1GNRA 1TX4B 1T0JB 4II7A 3DL0A 4ZDWA 3U44A 3MD0A 5KPDA 3THOA 2LCFA 1UFQA 4PR0A 1R4AA 2OAP1 2ZRHA 2QAGC 3A37A 3BH6A 3S1AB 2BVNA 3SBDA 1U0JA 4AYTA 2KWIA 2XTZA 2VQSA 4TN1A 3LAWA 1G64A 4LHXA 4C0QC 2OXCA 1LF5A 4E07A 4HZIA 1X1SA 3K8YA 2ZUCA 3MLEA 5C18A 1U2RA 3KKMA 1N6HA 4DDVA 1HYQA 3GLIE 4MYTA 3TAHA 4IEIA 3U5ZB 3HWSA 4B3FX 3BWDD 1RYFA 3IDQA 1TL7C 3FVQA 4AY2A 4MKHA 5IRCD 3AVPA 4TMVA 2N1BA 4YONB 1NJFA 4A2PA 1KOFA 1SVLA 2PX3A 4WVFA 3QY0A 4LY6A 4U7DA 2ZR0A 3OIUA 1GOTA 5AUOB 2OFXA 2F1IA 1DVRA 4P4SB 3QJYA 5DHAA 4DLZA 4EQ6A 2R65A 5HPYB 1A2KC 4BFVA 2ZAMA 1KI4A 1NG1A 1R6BX 3FHCB 1XTQA 4BGDA 1GWNA 1NKSA 1VECA 3GJXC 2XXAA 4G3XA 4N1AA 4OHVA 4A0HA 3BJIC 5L3SB 1FOEB 4EPYA 4IOLA 3ND8A 1N6OA 2ATXA 1M7HA 2ZRMA 3NC1C 4HAXA 1VCIA 2H1LA 1X1RA 3ZVRA 3HYRA 1UBGA 5JS8A 3EWAA 4DCNA 2NPFA 2DB3A 3SS8A 1H8ED 1Z6GA 1VKJA 2QPAA 1E9RA 2IUSA 4D2IA 2V54A 1NMXA 2ZAOA 2QT1A 3KQLA 1G5RA 1HV8A 3L43A 2QU8A 3LVQE 3HU3A 2R8RA 5DI9A 1OH7A 2PL3A 3B1XA 3RRYA 1GRRA 3BRWD 3IBGA 3R7WB 4NP6A 3GLHB 3HR8A 2ZU0C 3PG5A 2MSDB 4JLPA 2BMFA 4HDCA 3IQXA 5TY0A 4JLOA 4OJQA 2FZLA 1KI3A 3M0EA 2DHRA 2FGKA 3FOZA 1Q1ZA 5IF9A 1UEIA 3QVUA 4GRAA 4LBYA 4LUCA 2YWEA 2PEZA 3O8DA 4BFWA 3SEAA 4B35A 1OFTA 3CRRA 5CIWA 4DLVA 1L4UA 2ZE5A 3EZ2A 4G5OA 2IEYA 3WNCA 3DZDA 2JASA 5FTJA 1D5CA 3B2EA 4LHVA 2IC5A 4MA4A 3HR7A 3TW8B 3QXCA 1JJ7A 2O0JA 3EC2A 3UMRA 3MMPA 2GILA 3OE7D 4B74A 1AK2A 1TEXA 1TU4A 2O8DA 4D80A 2H5EA 3WBKA 1CP2A 5IDVA 3FMPB 3MAAC 3QXSA 2QBYA 1CR2A 3CF0A 4CIDA 4LPSA 1VMAA 2O8CB 4BFZA 3T06B 5JJLA 1XPRA 2Q9AA 2WWYA 3ZVNA 3KQUA 1DG1G 1E9FA 4MKGA 4XD7D 3WRXC 2J0SA 1RFLA 2R44A 3AGQA 2O8CA 2R9VA 4WBSA 5CK5A 1T8UA 4RCZA 2V7QA 1OH5A 1W36C 4Q47A 3AM1A 2JLVA 3L0IB 1AZSC 2PCLA 4O0MA 2VH5R 2VIIA 2CMKA 2VRWA 1E6CA 4JJZA 1NIJA 4NYMQ 4BRUA 4DB4A 5L3QB 3B13B 4Q1AA 4W7SA 3R9IA 1ZCAA 2KJQA 2ZIAA 4M53A 3DHWC 4IFBA 4OHWA 3MG9A 3THWA 3PEYA 1NN5A 3A4MA 1EFUA 3KTAB 1GL6A 2VL7A 2VPPA 5DGXA 4C0BA 5JWOA 2V4ZA 1A82A 1Q1EA 5BWMA 1LF0A 3A4NA 3ZS8A 1A4RA 1OXUA 1MABA 5LD2B 2H92A 1N0UA 2IYXA 4U00A 3KXKA 3PITA 1Y63A 3BB1A 1NN1A 1IY1A 1ZC3A 2ASEA 4LJ8A 2HT1A 1KMQA 2VHQA 4UNNA 4HLCA 5FPTA 4LGMA 2I4IA 4D82A 4AKHA 3LQRA 4Q9IA 2ZRLA 3AVWA 1LW7A 1WBDA 1JR3A 1Q44A 4O2LA 2AD5A 3NIBA 4Q7JB 1XXHA 4BFXA 2K5UA 4GOJA 2QM7A 3CNLA 1N6KA 2ORIA 1FUKA 2YYZA 3AQ4A 2EFGA 4C2UA 2XTNA 2CHVA 2JJ8A 1OXVA 2DBYA 1BKDR 2J7KA 4FN5A 3J81k 1W44A 3MWLA 1QVRA 4KFRA 1GVNB 4DZZA 2F43B 4CEHB 4ZO4A 1TF7A 3WP0A 2OCAA 3PXGA 3EPLA 2ONJA 1QHSA 3ASYA 2BM0A 4BASA 2FEMA 1TUIA 1ZM3A 3TBKA 4ZCIA 5E4FA 5KYKA 3CH4B 4Q9JA 1NP6A 2JDIA 1MT0A 4A6PA 2ZROA 4LSGA 5FOSA 5DSZA 1YHNA 1TTTA 4D25A 4BZQA 4F4JA 1XF9A 2GK6A 5F9HA 1DAEA 5UKDA 1IN7A 1Q1BA 2D3WA 5LPNA 2V1XA 4HDQB 4KFTA 4B2LA 3C8UA 3U4QB 2J59A 4OK3A 5KOYA 3CRW1 4D0NA 4N0EA 3ZQ6A 4ASUD 1KDRA 2RGXA 2CCGA 2ODEA 2XEXA 2AXNA 3WYGA 1SHZA 3B1VA 2WWXA 2ZI7A 1VYVA 1G4AE 5G40A 3ZD7A 4AC9A 2ZJZA 2PJRA 4DIDA 2GCOA 4B43A 3AVVA 2QEQA 3TVDA 1AS2A 4Z8XA 4Q4AA 2FEOA 5SZJA 4WW0A 1E4YA 1JI0A 4D4JA 2R6AA 3T5GA 3W90A 4LDJA 5BYJA 1D9XA 2B21A 3K1JA 3NBZC 3KJEA 2FOLA 2P2LA 3TVTA 3IPXA 4DT1B 2IWRA 4ESHA 1U0LA 2CHQA 5EE5B 2FA9A 3T35A 2QPTA 4KVAA
chains in the Genus database with same CATH superfamily
5TEVA 3L04A 3R4CA 4UCFA 5LQSA 2IE0A 4HEA1 4WKNA 4PZDA 4MULA 3LX4A 3AEUB 2VC2B 1YQ9A 2WJZB 3EXFB 3CXRA 1L1FA 1ORTA 1B0AA 1P7PA 1D2AA 3NBKA 421PA 4FLFA 3B9PA 4NNJA 1NT4A 4MQEA 2PFSA 2WFAA 3LDUA 5BWOA 1IXYA 4I1VA 1G7RA 2VATA 1FS4A 2AF4C 3TR5A 2CXHA 5ALJA 1JJIA 3DP9A 4E31A 2J6BA 5KYTA 1U0BB 3DEAA 2PX5A 3GNQA 4HUTA 1PI3A 4NOJA 4PTZA 1P17A 3ZJ4A 1G59A 4PFKA 3IAM1 2P2NA 3PFWO 4BE7B 2EW8A 5KQLA 4CEIA 1NX9A 3EA4A 3R3UA 4IDOA 4S1VA 4BFYA 1POWA 4BHTA 1NA5A 1I36A 4AG3A 1R5BA 2NACA 4BE9A 3L4EA 3QTLA 3T9AA 1NXXA 3CQ9A 1Y6GA 2R6JA 2Y0BA 2VYCA 3I09A 5A3SA 1P7CA 1JR3D 5EQJB 1IN8A 3PQ6A 3CW2A 2FHSA 2HLHA 2X7HA 1QOPB 1ZD2P 1UMCA 3GMIA 1DQYA 5H80A 4DSNA 4PYNA 3L7YA 1ODIA 1T36B 3RVBA 2IBMA 2D54A 1ZH8A 1YDMA 5LNK6 3Q3HA 3JR3A 3REQB 1ZI9A 3DPIA 4PQYA 4JBLA 4QQFA 2XDAA 3RU3A 1AUOA 3ROXA 5KVCA 4ENVA 3BBLA 1G5PA 3FM9A 3P9RA 3MB5A 1TQ4A 3JZIA 1FQJA 1M67A 3HC7A 3I9OA 5CW1A 5AW4A 4I1PA 1RMYA 2WJAA 3LP5A 4OP1A 3GOHA 2O8BB 1QDUA 2BMVA 1P8AA 2FF7A 2FPGB 4MJLA 1XTKA 4H35A 1BFDA 3AX6A 4GMDA 1D8TA 4OL9A 4YRSA 2X0FA 4J0DA 3T4UA 4DMMA 3FCXA 4QNNA 2GO7A 5B4TA 5E1OA 2FX2A 3Q7PA 5K4HA 1WCWA 2QRNA 4IDBA 1Y33E 4L5BA 1W34A 2EKZA 3DEIA 2O1SA 1E3DA 1DUSA 3F6EX 3AU8A 4X20A 4I6EA 4RJ2A 2G9NA 4BX0A 5LOVF 3UMYA 5JBNA 2C03A 3CZRA 3WLEA 5FNVF 4JMPA 4WA7A 2ECKA 5DTIA 3VC7A 5SZIA 1GQ2A 5AK3A 1JAHA 4KO1S 2NO0A 1VQ1A 1V16A 2AD1A 2H7XA 1PVDA 2IEIA 2PKEA 4EPRA 2AR7A 2P4QA 1WF3A 1G291 2WIKA 1ODLA 4PYOA 2WC1A 5BMVF 3UUWA 1KJ9A 4AUKA 2BM9A 5LM3A 1C8LA 1D3AA 1OR8A 5ALNA 4YAKA 3KSBC 1QRRA 2O14A 3QKSB 5DCWA 1OYYA 3OWOA 3GBVA 4D92A 1C0PA 3GP3A 3MCWA 1GQQA 2M6SA 3R3YA 3K72B 3DDWA 4JA2A 4O2BB 4ARSA 2IEBA 1G5TA 4KQ1A 1IRXA 2XR1A 1YS9A 3H5VA 3AERA 3BMCB 4L50A 4MRNA 3FPCA 2PRKA 4ZJYA 5JISA 4LWQA 4D8WA 3UJ6A 4Q24A 1XK7A 1QGOA 2ACWA 5K0GA 1R8JA 2W2TA 4KODA 5D5QA 1GXSA 1L7RA 3GLQA 4PZUA 4H9GA 1ZCZA 1SC1A 4OQ4A 2B9VA 2RE8A 2UUAB 5DHRA 1CY2A 1ZMXA 4YB8A 1LV8A 4FFPA 1DT5A 4ZV4A 5GZ3A 3DJFA 1VMIA 1HDZA 3ILYA 2GEVA 1SBYA 5TSDA 4BYGA 1ORVA 4CFYA 5BRJA 1NQWA 1PFWA 2Y05A 3TRFA 4BQRA 1X94A 4CKEB 2IXFA 3H87A 1WMDA 2CL5A 2QS9A 3PC2A 3BB3A 4LK2A 3P20A 3TW6A 4R8MA 2W48A 5JS6A 5KMGB 3K6SB 2R8XA 3MHPA 1U28A 2QD4A 1W1IA 4H7FA 3PFKA 4P32A 3O8OB 4ZAYA 4RY2A 5B1YA 2GD0A 3HCNA 3MWYW 1N0WA 1QIDA 2EGUA 2F9FA 3FVTA 1FL9A 2CL6X 3OM8A 4QOJA 4W5RA 5K3OA 4LSZA 4P3KA 3N74A 3B2QA 2EEPA 3TPCA 2B83A 5F3WB 2XX3A 1VKNA 1ZL0A 4KSYA 1T5TA 5AESA 3OZXA 2AXPA 1QRTA 4M0KA 4RMGA 3EOZA 4EHBA 3A2LA 3PRJA 4HNHA 3LCJA 3U0BA 3WLPA 3UT0A 4TVSA 3Q41A 3GY0A 1EUCA 1YIDA 1YRAA 1ZBDA 3CGWA 1VE7A 2RG1A 3UMGA 3LC2O 3LT2A 3VTFA 1GITA 1N1DA 1PJSA 3JV7A 1I1NA 1N8NA 1QFZA 3PHLA 2AGVA 2ODAA 3BMQA 4US0R 1J42A 2HBQA 2WUFA 3CT6A 1T4MA 3WHPA 1ADFA 1E2HA 4QOFA 3PFIA 3UHOA 1SKMA 1DXYA 4ZU6X 3P4UA 5JC8A 1VL1A 4HQLA 2DT5A 1N7HA 4EKNB 4WLVA 4MW9A 4CIBA 2FFBA 1O94D 3K20A 1PGQA 4HNAA 4TMWA 4OFBA 1Z5VA 5LIPA 3HDHA 4O4LF 2DC1A 1UDCA 2OGUA 5KDDA 4OHRA 2GLTA 4BJ5A 3MCAA 1LVHA 2XD4A 3MWEA 3K6JA 3ZD8A 4IG9A 2W98A 3GF4A 2ZCVA 4IY1A 3IPLA 4DMKA 5CDTA 4HNAB 1NG9A 1D07A 2GCGA 2KB0A 3RNLA 1K2WA 1RP1A 3ZZMA 3SF0A 1J90A 1LWNA 4GBED 4FP9A 5IUNC 2XYHA 2NTNA 2VBIA 3O8CA 3GO4A 2VJMB 1ES9A 1NAIA 3EXAA 3H2ZA 5AWFC 3OOHA 5KTSA 2J6CA 4YYZA 1FW8A 4ZI2A 4AURA 4QRIA 4H1WA 1VCOA 3QU2A 4MVYA 5EXEA 3JASA 5J2TA 5M04A 1A8HA 3NRJA 2WJIA 3KQKA 2G28A 5HKBA 2QD3A 1EVLA 2DKFA 2J08A 2WWIA 3L4BA 4L85A 4BBPA 3AJ9A 2HRCA 1S9HA 5BN3B 1CCWA 2HMAA 3PXAA 1BWRA 1WB6A 3EF1A 4MVJA 2H0AA 4MRRA 4ZCRA 5AJHA 1XDWA 4XSHA 4ECAA 1TEVA 1MABB 4RS3A 1M76A 3KVNA 3NWBA 3IPYA 3F97A 4AS2A 3GN2A 3HUFA 1KMMA 3IVCA 1FNBA 1V47A 3L9XA 1G3MA 3GFGA 2H1FA 1BHO1 4PLHA 3DMFA 3J81A 4H4CA 3FKJA 5A03A 2ZWPA 4PE5B 1CDZA 1XKLA 1KRWA 1GCIA 4C0KA 1U5CA 4QU5A 1DOAA 1GV1A 4K0RA 2QTRA 1F8YA 1X14A 4C3UA 2KYRA 3PEFA 3F0TA 4M1ZA 3JPWA 1YL7A 2FHPA 1CB7A 1GPH1 4PS0A 4S1PA 2ETVA 4U8GA 4RA9B 5FBVB 1PQWA 1NNLA 4XLZA 3G2LA 4Z9AA 3UICA 2OL4A 2QPLA 4C4OA 5JU6A 5T3YA 3Q8MA 1O0CA 2Y2UA 4JL5A 1PJQA 1TCUA 5THKA 1G8MA 5BN5A 1F1BA 1Y34E 2BBWA 2BFCB 1X38A 2Q9BA 1GHTA 2RBGA 2GZMA 3DMYA 3JQFC 4GR4A 4IH4A 4RZIA 1FVHA 1QVZA 4ER5A 5KI6A 2VRBA 1RSZA 3E2PA 4NMWA 2BTEA 1T6NA 3F5QA 3C74A 3EDYA 4JQOA 3OQIB 1Q0UA 1U8UA 4QAJA 1DBSA 3V8MA 2KLBA 1V2HE 1MVNA 5HF8A 4AM8A 1TAQA 4OCZA 4ZO9A 3PQFA 5ALDA 1DZ3A 3OEED 5JR3A 2YV1A 1ZBQA 3DDSA 3CLVA 4HEHA 2VTVA 1F2TB 4MV9A 4WN3A 2J4FA 4YO8A 2B98A 3M9XA 1CUYA 1SFRA 3C5CA 4BAUA 4ITRC 1GQFA 4HDRB 1T5IA 4M0EA 2DLNA 3K30A 3LCVB 1YZKA 5DV9A 5EJ2A 3W4IA 5JANA 1SK8A 2DP4E 4TTRA 4GQIA 3E7FA 5JMOA 2YC4C 1NC1A 3R23A 4K6HA 1XZHA 4KE8A 4OU4A 4BS9A 2XKAA 4OQLA 3ABSB 2GLXA 2XUQA 1H4QA 5EIBC 5IJ9B 3BWCA 4LZLA 1VMDA 5E7IA 4D96A 5K6AA 2GOYA 2ZIXA 1Z5OA 3FR7A 3KRTA 4G4IA 4XCXA 4DLBA 5EWMB 1F7VA 3BXGA 2ZJ6A 3WGNA 2HMTA 2XCOA 4I6JA 3U44B 1WVIA 2HLPA 2YFKA 1GKLA 4FE4A 1LH0A 4E30A 1SHUX 3T5AA 5HGXA 4FFWA 4X9XA 1Z8NA 3C5WP 5HIAA 4ZO8A 3F98A 2PGAA 2J3LA 3HDQA 4MVJE 4OQMA 2X1MA 2HFJA 1UDXA 1GNPA 3Q3EA 3UJAA 1X1CA 4XGRA 4J9VA 3WAJA 2UUOA 2NU9A 3EOAI 1UBCA 3IP7A 3H4IA 4C14A 1G5HA 2PBFA 2ZK7A 5AYVA 3TQSA 5A4FS 1E1MA 4MEJA 3T61A 4LQLA 2NO9A 1VSQA 4CODB 3M5CA 1UBFA 4F60A 2PBRA 4IHKA 4I9HA 3RUAA 1Z0JA 3ROQA 1G2OA 1YKSA 1TFRA 1OBCA 1Q0QA 4V0KA 5D1HA 2E5LB 1SVKA 3G0CA 3JQ9A 3GQBA 5EFZA 2O3JA 3E9DA 2HCBA 3HFSA 2PMWB 3NAZA 1OFVA 3BE6A 2F67A 2PVSA 2AW5A 3D8BA 5CFNA 1KNQA 4EUSA 4DA7A 2P65A 4WLFA 4BJ1A 3P9KA 2J41A 3VSAA 3WBFA 3ZV5A 1RR6A 3HWRA 2Q4RA 3AP2A 4RHFA 3USZA 1DBVO 3GJ4A 4YJ2B 2DKOA 2CB0A 4GPTA 5ESRA 3LT5A 1GDHA 1KYIA 1XFAA 2HDHA 3BSYA 1OHHD 1RQRA 4LWOA 5JG7A 1P0MA 2UVPB 2V7PA 2NUBA 2OB1A 3DVSX 3M4YA 8AT1A 5JSZA 2R47A 3L0DA 3BGVA 1UIMA 2NYUA 2BGWA 1DCFA 4HQ0A 3O03A 4LI3X 2QN8A 4HX2A 4QKQA 1J25A 1XTTA 2YXDA 4BQIA 5IJZA 1AGNA 2B8NA 2QJTA 3LC0A 2TYSB 3SYNA 5F4ZA 1PZEA 3ZW8A 4DCCA 5BPHA 1SVOA 3G13A 2PZGA 5IJ0B 2YHSA 3RLIA 3QUAA 1AJEA 3OZEA 4RACA 4TTIA 1JLHA 1JKFA 1Z6PA 2PA3A 4WASA 1Z82A 3H9JA 1QO9A 4GT1A 3BILA 3CN9A 1L4BA 1ZJWA 2WJHA 4N39A 1DTSA 4WGFA 5IWCA 5JNWA 2ZUFA 2OK7A 2VXOA 1N8TA 2L0XA 1JDVA 1V11B 3HGMA 4B44A 3IJPA 2TMGA 2X1LA 1E7YA 3BQMB 3L6RA 5ALYA 3KQNA 4YP9A 3IPAA 4XGQA 4DUPA 3KV3O 5FI3A 5C5DA 2F00A 2HUNA 4C43A 4XDHA 3N5CA 4OLJA 4DNPA 5CIYA 1IK4A 4G5GA 6LDHA 3F47A 1U1EA 3QUQA 1I4TD 3CYFA 3KZKA 4EFDA 3UPTA 1IH8A 3C1AA 2DUUA 5FOUA 3O21A 3NTUA 4ZQGA 3ZYZA 4JUAA 5JJIA 1YD7A 4G8CA 2V7XA 4LQCA 2RAUA 3ZCSA 4F5EA 1IB0A 3ZIAD 4MYUA 1A76A 3QU4A 2YMMA 4RVGA 4EHAA 4EAQA 3X43A 4A3SA 4NZYA 4LJRA 1MEOA 2AJLI 1KBOA 2HBRA 4INZA 5D1NA 2XIJA 3UFBA 2R1UA 5DBHX 3TLYA 3TYXA 4FD3A 4L16A 4WDRA 3X2FA 5LR6A 2H7YA 4WXRA 5LQRA 1KJ8A 2C5LA 3A70A 2ZSBA 4JMLA 1W581 4P3PA 5F7JA 4B1FA 1TYBE 5AXDA 4DMGA 1V3UA 2L69A 1IDOA 3FGZA 3MAJA 4S0XA 1W94A 2IJGX 4BKOA 2FUKA 2H4WA 2PPVA 1PSZA 3HKBA 2CT8A 1SR8A 4NBUA 2F64A 4QRDA 1D04A 4BNGA 2C78A 2YL2A 3A7DA 5M3BA 4F72A 4B7ZA 1C4KA 5E6UA 3FGNA 3OQNA 3PR1A 1U2ZA 3GEGA 3JD4A 4WCFA 3QKRB 4F04A 1JJFA 2MSLA 2AJ8A 1HETA 3KYDA 2FRXA 2VZEA 4NBRA 5EWJB 5FWXA 4TTTS 3MW8A 1VG1A 1A5SB 3FSGD 1H22A 1UXKA 5BYKA 1FDOA 1M0EA 4AKTA 4YDQA 1KJJA 2Q3BA 3R9XB 1YBVA 4CIXA 1WPQA 1QU2A 2WIFA 4H0NA 4H77A 3EAQA 3NKFA 4IJMA 1YMQA 3DOHA 2COUA 5IJ0A 2K6GA 2YN2A 5K6AC 2QVLA 3L06A 4NPAA 4WEOA 3NX4A 2A5DA 2CYAA 1WVMA 2UZ4A 1YDGA 3I3OA 5SZHB 3VHXA 3JQRA 2F8SA 3DDOA 2CFTA 3PE3A 3AY6A 4KAJA 2D6FA 1P4GA 4YRIA 2DSTA 3JYNA 4S1TA 2IHZA 4B3MB 1ZGHA 4J75A 4JLDA 1PEKE 4ZXFA 3I9V1 3NH9A 4UFPA 1AXRA 1NR5A 5EAIA 2OTCA 2BTQB 3ZH2A 3UMVA 4Z1MD 2IS1A 2I3BA 5AOBA 2QGNA 3BREA 4WNAA 5G0SA 3WK5A 1TMKA 1KR5A 5HYVA 1SBHA 1SZPA 1XTIA 3HJBA 4I7EA 4QTTB 1E8NA 3RBZA 2R86A 4PF1A 5I5GA 3T3MB 1EU1A 2G5GX 1X1AA 4QG7A 1KFEB 2EX1A 3NB0A 4UTPA 4BATA 2F1HA 2J87A 4JENA 2DSNA 1WCIB 521PA 5CT8A 1PL0A 3N87A 4WK0B 3WWCA 2LZ0A 2Y1CA 1RI3A 1STOA 5DBFA 5CA1B 2OESA 2Y1FA 2JJQA 5KHOC 1T4GA 4WN9B 5A4KA 2I6TA 4YMIA 3X0DA 1OWMA 3ZGNA 2XCRB 2I22A 3ITKA 3ZEAA 1CF4A 3I3SR 3GT7A 3VAYA 1UINA 2C2WA 4MQ5A 4ML3A 1UPFA 5E0KB 4BB5A 2CFCA 1UZNA 4P7FA 2AQIA 1U2GA 4S12A 4IWYA 2DOKA 2DULA 1HT1E 2ILVA 2VWQA 2PD6A 3DKKA 3K4QA 5FV7A 4B75A 3OFND 4XFJA 4F5DA 1GZ3A 3E3LA 3NTXA 4DMRA 3AI2A 1AOXA 3OKAA 4LMRA 3Q3CA 1IZ9A 2QLJA 3BTSA 4CMAA 5K8CA 3IUEA 4ZN6A 1OF1A 2E5FA 3GPIA 2HEIA 5C1BA 1YR1A 2HEGA 2VP6A 4L07A 4E2YA 4RLSA 2KX7A 3SMVA 2OBBA 1ZR2A 2O8FA 1NDUA 4JAVC 1JA9A 1SG6A 1K0UA 1FYVA 1J1IA 2AFHE 4IJQA 2C3YA 4UU8A 4DAEA 3BFPA 2EZTA 3T7KA 1A98A 2WVJA 2OYCA 4TKUB 4CM9D 1ZIPA 4QVGA 1ID1A 2Q3DA 2WINI 1PE0A 2H4HA 1ND5A 4N0MA 1JSLA 4HXGA 4C7OB 3UUGA 5CXXA 2ZBRA 2OC9A 3QNWA 1IPFA 1ULBA 4PVCA 3E23A 1NQXA 4G81A 2PLWA 1VBFA 4R2IA 3PGMA 2FSFA 3SM3A 4QXMA 2Q49A 3C8ZA 3OQMA 4AJOA 1PTJC 3T3OA 3BHJA 4RM2A 1YZUA 1JAYA 1DDIA 2P41A 2FPGA 1K4MA 3HXMA 2JFHA 3ETLA 2ZAYA 3A6FA 5ITZA 1MAHA 3ZN2A 4OATA 3O9ZA 1JIJA 4GZLA 3WQBA 3VPDA 4GOXA 4RS4A 1NQVA 1T8YA 3ITNA 3E9CA 1EBBA 3DEHA 3WLIA 3L7NA 4FFBB 3STTA 1AKYA 4CDNA 4AD8A 4MWBA 3VC1A 2NIPA 3JYHA 1G7TA 2WY2D 2FW8A 3OOJA 5JY6A 4ISCA 2XUPA 4YP5A 3C0KA 4DMUB 2WUVA 5M29A 1HYHA 2CJWA 2A86A 1H66A 4TUYA 2WIGA 5I3ZA 8MHTA 4RXUA 4ZT4A 2XZDA 5G3YA 3BJRA 5F51A 1EVYA 3TG8A 1O9GA 1II9A 3A9RA 4M9SA 1IZ7A 3Q9NA 5I9BA 4BLUA 4GYYA 2ZTLA 1HYGA 5KSZA 1NM5A 1WW8A 1Z5WA 5D5HA 3ZZTA 4AX8A 2JKYA 4BQQA 2V9PA 4BLPA 3LYAA 3BRQA 3O3MB 3SHWA 1OU0A 1SIUA 3EQ2A 5AQ1A 4HAIA 1NYLA 2Q4EA 2BFDA 1W85A 1O9HA 5DI3B 2JFPA 1YUBA 1ZVQA 4B47A 4BNVA 9LDTA 1CRPA 1VMEA 3RUCA 1G20B 1DPGA 1QQTA 3U3OA 3D3KA 3TTTA 2Z4SA 5A3QA 3BTUA 1YZQA 5L3QA 3NBQA 2JH3A 4AJLA 3HVIA 4XQ9A 2I54A 2FH5B 2ZUDA 5EXXA 3ROEA 3D8HA 5HQTA 3PEVA 2R8BA 2UYOA 1TZKA 1C4WA 1TCBA 2B1RA 2G4VA 1SD2A 4QGFA 1TVCA 5EJIA 5JPIA 2GN8A 2PV7A 3NZEA 3L7CA 2RD2A 4CUZA 4FWTA 2RGGA 4OHXA 4OXXA 2B4TO 2G88A 1IBMB 2I8AA 4C7KA 1THTA 4IVQA 4MEBA 5TEWA 2FPMA 4ZC1A 3TXAA 2CMFA 1PYGA 4IOJA 2GJ8A 2NOAA 2OV6A 4PYLA 4MYDA 4BRSA 4G36A 1H2YA 1HOXA 4WZ6A 4IF4A 1E2DA 1F06A 1XG5A 1U3VA 3G23A 1NBOA 3L9WA 3NWEA 1ECFA 4UAVA 4KV7A 4JT4A 1KAHA 3LKBA 4H17A 1NJ8A 5EESA 2CV0A 2YWCA 2PRZA 4ZOLF 1FFXB 4M8KA 1I2CA 3E8MA 3WSWA 1K7FB 3D8RA 4MKXA 4NESA 1T9KA 1FUUA 1XA0A 2IVFA 4RGVA 1GKIA 4M88A 2GPYA 2ZB2A 1RP7A 4C5CA 1EX7A 3HPQA 1G2PA 2GJKA 4MLCA 5AIAA 5J9FA 2COKA 3SC6A 1SXJC 1U7ZA 4W1SA 4G0MA 1YZTA 5EIHA 1T5HX 5TMBA 1LSOA 3CCCA 3ZHZA 4TLEA 1OY1A 3O38A 1C9MA 5K8UA 1FP7A 4DGQA 1OLUA 1MP0A 4W6ZA 3LRPA 6ADHA 3DWEX 4MQEB 1WBJB 1UBNA 1EDEA 4DRXB 3SNKA 1AZWA 4LV6A 4Z7QB 4G2NA 1JIVA 3LPMA 2OO3A 4PHFA 4KR6A 3E82A 3GAFA 1DKUA 3RC1A 3DBLA 2C0QA 3O2QB 2HT1A 1ENYA 1KNXA 1MB2A 3A6GA 3I9MA 3GVCA 3KUCA 3LGAA 2QL9A 4JVSB 3MUOA 4KW7A 1IHUA 2A5JA 2FDRA 4TSKA 3WMRA 4OBWA 2AS0A 2WV7A 3DDHA 4K6GA 3JW8A 1QKKA 1RC1A 3P9IA 3QJGA 2IXBA 5GP1A 3T3IA 1ZN2A 4JOSA 2AKYA 2WT4A 4OK5A 3U40A 4URXR 5I7VA 2OGSA 2D2IA 5F9FA 5IVIA 1Z29A 1XF1A 5DHQA 4Z0PA 1Z0FA 2VYND 2FJUA 2QUHA 3C1UA 1SAYA 3OTHA 4IKOA 4LJ6A 5ERYA 1DEXA 1PWHA 2W8BA 2WF5A 3AKEA 3P0RA 1R0CA 4H7KA 3NUQA 2I1VB 3OZSA 1I5EA 3AHHA 3CR7A 2CXNA 3KCNA 1U1DA 3D8NA 3ORQA 3L0CA 3F6SA 3ZE7A 3QH4A 3ZZNA 2XNKA 2GLUA 1CJVC 2ZSEA 1P5HA 3VOAA 4BRWA 4EBFA 2VS1A 4K9SA 3OMWA 3N2KB 2JI7A 3EZGA 2RMKA 4YV2A 4F3RA 3QMVA 1WU7A 3UJ3X 5AKXA 1IN1A 2DFTA 3C3JA 2QJRA 4F6RB 1UMBA 2GUWA 3CUTA 1GRNA 1QRAA 1NLUA 2FU5C 1CFZA 4PC6A 1ZVVA 3ADDA 1WCXA 3C5EA 1UWKA 1T8WA 1ZVJA 2PSDA 1I3KA 3P0EA 4OXYA 4CIVA 1HURA 3CFYA 3WLFA 4GKBA 3N2GA 2Z8YM 4CG0A 1BS2A 4PPGA 2POQX 1VPVA 3Q5DA 4BVBA 2XLBA 3D7NA 1ZCBA 1QO0A 3UKDA 2CF6A 1XNHA 3JYPA 1EE9A 1MDFA 1TNDA 1YS6A 3IP3A 2UYYA 4PXSA 5E8RA 5EQFA 1T5DX 3EDCA 3ZWQA 3OI7A 5D84A 1QRSA 3PJDA 3VH4A 2J31A 2DFLA 1GNQA 3MTIA 1CUXA 4M83A 3KB6A 3SJCA 4NX2A 4CQMA 2B5OA 4N47A 2AQKA 1MMFB 3FHOA 1USWA 3DDCA 4Y67A 4URFA 1CEYA 4D9CA 3ZX4A 3CBGA 2J3IA 1T9HA 2X8AA 2X22A 3ZK7A 2VUHB 5KNDA 4G37A 4LRTB 4F4HA 1ZM2A 2X5XA 4DJAA 5LDDC 4FFNA 4GEGA 2P0YA 1KSHA 1DFIA 1CR4A 1KJWA 4FDTA 1YFKA 4GE0A 2V5UA 3F96A 3WIEA 4ZMSA 5LQNA 1T2CA 4I5EA 3SSAA 4B7XA 4FC7A 1IZZA 2B4AA 1NKVA 4IIJF 1RVDA 4X60A 1GG2A 3OUTA 3HA5A 2OHOA 1B0UA 4JEHA 4P4GA 3G02A 4KVFA 3TUZC 1Z08A 2CFOA 5IJWA 1J00A 4RM3A 3G5TA 4WNCA 1D2CA 5EHZA 1IJFA 3SSNA 5HS6A 1YA6A 2FZWA 2O1EA 1NU6A 3V7UA 4AW9A 4LDNA 2P67A 4QDKA 3QW2A 3IODA 4ZOLB 4E5YA 5CHEA 5F2KA 5A4JA 1QIHA 3KTOA 1Q84A 5CGQB 5AI5A 4UNPA 2R751 1JG6A 1L8XA 4GUAA 1P7YA 4P3XA 4U2EA 4YP6A 2W6MA 3ME5A 5EWLB 4LOIA 4OXIA 1GSHA 1CYEA 1KZ9A 1BXGA 1Z25A 2CYCA 3L07A 5ARDA 2DUNA 5SYNA 2EKPA 4Q39A 2QNBA 4Y30A 4YCAA 3TPZA 4C30A 3W0LB 5K3CA 1RZRD 2C42A 4WESB 4BFTA 4CQLB 3EDOA 2OXTA 2QTZA 2I8LA 3DE2X 3U9SA 4JP3A 3H2SA 1TM5E 5J5VA 3Q8XB 1FTQA 3COYA 4FHZA 1ADBA 1XCGB 1N2JA 2VA9A 2GKGA 5A3JA 4DQUA 5INTA 1NSFA 4MAMA 1VGRA 4O0LA 2Z1DA 3NO4A 1I8TA 2GPTA 4KI0A 1LRLA 5LU9A 5EUCA 1PN3A 5IFKA 1VB5A 3E27A 4XVUA 4J9UE 3V1NA 5JZSA 1IXZA 5LU8A 1QHFA 3ICPA 4PHHA 1Z2NX 5HS4A 3ZJ5A 3CONA 2GRJA 4DZRA 5B7PA 3TRHA 3FNFA 2H29A 4I50A 3NYIA 3QG1A 2C3OA 2IZOA 4OXKA 4QICA 3TE7A 4GI1A 3KOUA 3ZVLA 4CJXA 5KTRA 1ZWLA 3LFTA 1NUPA 3HN6A 4HQNA 4E5DA 5AKEA 5BSFA 2AL7A 3SVLA 2AI3A 2EL9A 3H7AA 3PPVA 4FFVA 5AHKA 3LSTA 1QV6A 1DXQA 3BX1A 2BGUA 1QE3A 2BKXA 1W5AA 2H2FA 4HATA 5E38A 1F0PA 4HUQA 3EGWA 4GP6A 2OFWA 1YB6A 4YJ2A 2G5PA 4DDWA 3GLGB 6AT1A 4IFTA 1YA8A 3OLWA 3EH2A 1N25A 4UHFA 1AGPA 2PLRA 3FRIA 5REQA 4C22A 3ST7A 3KLNA 3HSYA 2BEWB 4PNZA 2O2EA 2PZBA 2YICA 3DPUA 5ALHA 1PNRA 2P91A 2H4YA 4K03A 3ONNA 1AHIA 2E6KA 2A9PA 3CNNA 4XYGA 3TZ6A 1ECBA 3UAVA 5DBOA 5LYJF 1H1DA 2AK3A 4ZEWA 4ZCLA 5J58A 2CC2A 1RVV1 1VSUA 4QSHA 1E8DA 4OA8A 4F2WA 4RJTA 3L8DA 2XQFA 3VSDA 3A1SA 4MPJA 5JH7B 1L8OA 3OJEA 4RZ3A 3NAQA 5LJLA 1Q3HA 3SBEA 1K3TA 1TT7A 2R5WA 4LISA 4LXGA 5JCJD 3ZD6A 2PA0A 4JKIA 4IMIB 1DJOA 2AOTA 2XQKA 4RIFA 3RSZA 4Z9XA 4HWPA 3R3XA 4RTKA 1JWAB 2YWGA 5JE8A 2R8PA 4CV2A 1QLJA 2PGOA 2CVHA 5LXTB 4D0SA 3DWIA 4HXFB 1YDHA 3UGQA 1USVA 3I0MA 1YOBA 2GGSA 5JI2E 1E1CA 2SCUB 5G1PA 5B1EA 1K7CA 2IZ0A 3G1UA 2RHLA 3OBBA 1WSAA 1N7IA 5HUJA 1V6CA 2REBA 3VH1A 5BW5A 2NZVG 1CQIA 1QGZA 1REQA 3RV3A 5KEIA 3EXFA 1PGPA 1XZDA 3K9GA 4AU1A 1MQAA 1U0HC 1P74A 1R12A 3UAXA 4YX9A 1BMTA 3M9WA 1DC5A 4AZ3A 1DWPA 2ZULA 2E89A 2JGKA 3VO1A 1DKLA 3O92A 2AEFA 1E9DA 3F9RA 4HDKB 1T1IA 4KXQA 3VOBA 3A3PA 3L40A 1RHRA 5AM4A 4GH5A 5EIWA 1E2BA 4UTOA 1PG5A 1Z2OX 3FXAA 1UP6A 3MWDA 4QUDA 2RGCA 1R8SA 2QUAA 5HFJA 7GPBA 3ZWOA 1CDOA 2C2MA 1CXZA 2A5LA 4Q1EA 3MTGA 5C8VA 3O47A 1OWOA 1UZUA 1U0SY 4KO8A 1C3XA 3OE4A 4MCAA 1GL7A 4MV5A 3SJZA 1EFVA 3KYIB 3RC7A 3HQ4O 2IGTA 2IPXA 4Z4CA 3ZU3A 4P6VF 4TKLA 2VDQB 1UDAA 4IRMA 3JVIA 4RVCA 3UT5B 2QE7D 1R9GA 1IEWA 1HE5A 1HQCA 2E82A 4MR8A 2BAGA 1MKYA 1P1FA 1KVUA 1PQPA 3KTFA 3M81A 4KL8S 5G0UA 3DEYX 4W5OA 4GZ5A 4Q4LA 3LBHA 4GDFA 4TTAA 1Y81A 3OM0A 3VVCA 2C9YA 3NIGB 1F8GA 4IDCA 1Q0LA 4HVTA 1QHNA 3EIEA 4IS2A 1ZWKA 4IFIA 3EXG2 1CB0A 1L2TA 5K3BA 4BKPA 4D0RA 4Q4DA 2QZPA 4XVQA 3E4DA 2GD6A 4UOQA 5E3IA 2CXQA 4PAQA 1O95A 2YJGA 4E14A 2JLUA 4MI6A 1FFDA 2XV1A 2JAOA 4KRXA 3HNOA 2VH2A 3C6XA 4DLUA 1ECCA 2D5IA 1PQ4A 4QOIA 3UXYA 1C1XA 5HZGA 1A9TA 1SOVA 3AK4A 4WESA 2QGZA 2GVDC 4CQLA 4E1BA 1G41A 1NSTA 3FPLA 1U98A 1JF8A 2WU1A 3EZ6A 5EJEA 3FCOA 4DNQA 1G17A 2YIVX 3AHCA 3TDMA 1U6KA 2P75A 3WGYA 1DU4A 2H9IA 2JGMA 4DGSA 4EYOA 1LRKA 3DZBA 3QX8A 3N3BC 4YJHB 1IN4A 1TU3A 5D00A 6NULA 2PRYA 4N8SA 4NMMA 3OG9A 3W3AA 2WHRA 4HPJB 3JVVA 4A16A 1GL3A 1EQ2A 1OKKA 1YE5A 2ZXEA 4CZ2A 2X0RA 2WUEA 1S8FA 3HCDA 4YFYA 1EAYA 1SXJE 2YJ4A 3OPXA 4YJHA 2P5YA 3LL4A 5FPKA 1YE3A 2Q8QA 4G67A 3KR1A 2O7NA 4PZZA 1EFPB 3IGFA 4ZI7B 4DNXA 4MW7A 3RS4A 1E64A 2E6UX 1H5QA 3MGAA 4WUVA 2O05A 4KG7A 5J40A 3R7DA 5KVVA 4KCGA 3R8FA 2FZEA 1OZHA 2JAPA 1OTHA 2JKVA 1XTRA 1E3WA 2ZAGA 4A2QA 5AVVA 1LDBA 3K2QA 4AO6A 4IZ6A 1W35A 1IWOA 4OM8A 3FPAA 2QI9C 5EWJA 1UMCB 2BE9A 2WHEA 1NVXQ 3HJCA 3O75A 1FY2A 1NF3A 3QVKA 3LHSA 2F3SA 2AC4A 4P81A 2M1XA 1WB5A 3ZWKA 1U2QA 1GRCA 4Q15A 2IYQA 5AD1A 2EFCB 3LPLA 5WRFA 5JLJA 2B78A 2WTXA 1K6JA 3UBMA 5KTPA 3LP6A 2L19A 2QMHA 1NRXA 2Z95A 1UPBA 2JGDA 5BN1A 3QLTA 2HRQA 1P29A 2JHAA 3N28A 4R81A 4ZOAA 5NULA 3T3HA 3ZXSA 1U8XX 2W6QA 5DM70 2ZI9A 3F49S 3BRWA 1JAXA 2QMOA 5E4TA 1CW2B 1DBPA 3EZYA 3JRNA 4A91A 2WMNB 4E13A 4F0JA 2ORYA 1XOIA 2PZLA 4QPZA 2TS1A 5E1BA 4BEBA 3BE5A 4MUKA 1UT5A 4C3ZA 4UVIA 2DPGA 4IIVA 1FK8A 2OZLA 1YL6A 3SQXA 4V3BA 3TINA 5EMHA 4DV1B 1QMPA 1KKUA 1BXZA 4C6TA 1IJKA 1A71A 1HG1A 1D2NA 3IP9A 4OA5A 1ADJA 1A7JA 1XGKA 2WWTA 3ESZA 2HF9A 3VVLA 1Y1TA 3TSOA 3QRWA 4X7BA 1C2TA 2ID4A 3F8TA 3QA9A 4KKXB 4P5PA 5LZ7A 3WYEA 2H3HA 2I34A 3FKQA 2FSGA 4WOJA 5CX4A 3GJSA 3V8BA 4EX6A 4E94A 1LNSA 1UOOA 1YBFA 5JS2A 3WZMA 2QE7A 2QVCA 3ZNNA 4Q9HA 5L45A 1LRJA 1R0RE 5L6MB 4PQRA 2J32A 3GFVA 4ZARA 4ZT3A 1X7YA 2YVAA 4RFVA 4DQDA 5C1OA 3FMFA 2XHZA 5FX2A 1C1DB 3V2GA 4F56A 1U2SA 3B85A 3TIXB 3V55A 3GXBA 4Y6OA 3SZOA 5JXWA 3PEWA 2O1WA 1K06A 4XDGA 4U39A 3EGDA 3EBPA 4YTEA 4PO1A 3ZHCA 2IV2X 1Y3IA 3JQ7A 3R3WA 4YJ3A 3WDKA 4KIGA 2H1CA 4RENA 3EIOA 3FAZA 3PPWA 3HG7A 3CB2A 1AKEA 3A9CA 1UJCA 3GRFA 1CQWA 4LYFA 2X77A 1SBQA 3LI2A 2GXAA 2BDUA 2FN4A 3HB1A 4H1TA 4KO2S 4LXTA 3RVJA 1MO2A 2OZEA 3IAUA 4N8EA 3OZFA 2FSVC 3G17A 2WB4A 2GXSA 2H65A 1XRNA 2XDWA 3H1EA 3G2NA 4NPHA 1J21A 1EFRD 3EWSA 2JHGA 3G2OA 3CF6R 5A7FA 3NI2A 1Q74A 4MQMA 3AR8A 3NV9A 2DWCA 4LHWA 4GZ3A 2PWYA 3BIOA 2GTPA 3AM5A 3H8JA 3CX8A 2HNKA 4KGVA 4MB2A 2UZIR 3LDGA 2VHUA 5ALQA 4AI6A 4CRWB 1BVHA 1XMVA 2ZVDA 3INRA 1HFJA 5D6NA 5TDHA 2YY5A 1ODJA 3AB8A 1L9XA 2X9GA 4WCVA 4F3NA 4IQGA 3ZK8A 3ZU2A 4A2CA 1U31A 1NDHA 3NH6A 1F1JA 5IMBA 4A2WA 5CNJA 3QFCA 3NT2A 2XVAA 4ERXA 4KAXA 2WE8A 4GW3A 3SHQA 1XI2A 3GRCA 4RKRA 1XTSA 3GGSA 4UARA 1GYQA 3HEBA 2Q3LA 2WM3A 1DSSG 4OGGA 1DAOA 4D98A 2C4UA 4HQ6A 2ZJBA 2W2VA 3EZ9A 3BQ9A 4EGCB 1GFIA 3FVWA 3PGKA 3C4QA 3LX6A 4NAVA 4X94A 2CEKA 3K0EA 1PTKA 5BQOA 1OB5A 4XM0A 4PX5A 3KL4A 1BU8A 1N5JA 3AHGA 4B34A 1L5RA 1EE1A 1Z4PX 3SD7A 1GM5A 1KVSA 2NUAB 3UCXA 5ESDA 1P1JA 4IIXA 4MAFA 2VT2A 2W37A 4PZPA 3W2GA 4V3CA 4RA9A 1E59A 4PR3A 4U7PB 3DLIA 2H11A 3VSEA 1RRPA 5JRDS 1GDTA 5FOVA 4F8YA 4DXHA 5AW3A 4EPWA 1QGDA 4I5GA 5BY2A 3V2UA 5ALFA 5KKNB 3F71A 2HXSA 3T94A 1QBKC 3D3EA 3UHAA 1YV9A