2RGPA

Structure of egfr in complex with hydrazone, a potent dual inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
315
structure length
284
Chain Sequence
ALLRILKETEFKKIKVLGSGAFGTVYKGLWIPVKIPVAIKELRKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMNFYRALMDVVDADEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 4-Amino-6-arylamino-pyrimidine-5-carbaldehyde hydrazones as potent ErbB-2/EGFR dual kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Epidermal growth factor receptor
total genus 85
structure length 284
sequence length 315
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2rgpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2rgpA01
3MVMA 4FEQA 4WHZA 4EYJA 3GC9A 3ZUTA 4UMQA 4ACDA 3CY2A 3MBLA 2Z2WA 3KULB 3E63A 1J91A 3P1AA 3IO7A 2GSFA 4Y5QA 3R7EA 4C4EA 3H9RA 4DEIA 4F6UA 4ZAUA 4R77A 4XOZA 3H9OA 3W18A 3OTUA 2ZB0A 4MYGA 5LXMA 3ZXTA 2VN9A 5IQHA 3WIKA 2PVJA 2W96B 3P86A 4F99A 4DF3A 3O0GA 4L52A 2WU7A 3FUPA 3LFBA 5EW8A 5G6VA 3U87A 1GOLA 1H1WA 3DKGA 4AA5A 4EOOA 4AQCA 4XCUA 3NIEA 3WILA 4GW8A 3Q6UA 4PP9A 1PXIA 5EI6A 4EKLA 2KULA 1YWRA 3DB6A 3GCSA 1YHWA 4DH7A 4NH1A 4W4VA 5DOSA 4YP8A 5HVYA 4JR7A 3GI3A 1H27A 1BUHA 1SYKA 2ZDTA 3I81A 5AAEA 4AGWA 4KNBA 5AAGA 2X2KA 4X2KA 1OKYA 4QTEA 5HIBA 5DWRA 4JDJA 2H8HA 3OY3A 4D58A 1YXTA 4TNDA 4MNFA 5EDRA 3PXFA 2XRWA 4J7BA 5HBEA 2P33A 1NY3A 2RKUA 4YLJA 4NEUA 2VUWA 2F9GA 4X2NA 5M44A 1LEZA 3EIDA 3JY9A 4QOXA 5C4KA 4JAIA 4UZHA 3EWHA 4IAIA 5LQFA 2WU6A 2BRBA 4M97A 2VTOA 4U40A 2BZJA 5FBNC 4LOQA 5BMMA 5L8LA 3KREA 2QO7A 3Q2JA 4GJ3A 2IZRA 3QWKA 2V5QA 1WVYA 4AN9A 3GNIB 5EFQA 4EH8A 2P2HA 5J7HA 1G5SA 3UPZA 1OPKA 3HRBA 2X7OA 4RWLA 2QU5A 1MRYA 4FT7A 5K0KA 2F2CB 4I5CA 4QMSA 2X0GA 4NW6A 3VS3A 4BDGA 5K0XA 4KS8A 2R3LA 3SC1A 3UNJA 4HCUA 3PWDA 3VBTA 3S0OA 4HCTA 4JG7A 2OIDA 2CDZA 1EH4A 2YN8A 2WMUA 2WOTA 3LHJA 4L3JA 5EH0A 4ITHA 4LGHA 4EOJA 5HX8A 4P5QA 1FOTA 4EOLA 3W8LA 1OIYA 1W82A 2C0TA 3COHA 4R5YA 4FK6A 4USDA 5ANKA 4AOIA 1VJYA 3LCKA 3SOCA 2PUIA 2BZIB 2B54A 3DBEA 4HOKA 3U6HA 4G31A 2X4FA 3FQHA 4KKGA 3VWAA 1PYXA 4FTIA 3F88A 1LP4A 2ITUA 2JBOA 4QMNA 2HY0A 5BX0A 4JL9A 3BYOA 1QPJA 4ANSA 4DGMA 4O7VA 4FTJA 1J7IA 4JR3A 4GUBA 4LMUA 1BL6A 2R2PA 2W1CA 5E8XA 3AGMA 3MA3A 2UZDA 5JK3A 5IQFA 3C4ZA 4EWHA 2HZ0A 3DKFA 4ZTSA 1I09A 4DYMA 2O8YA 3NAYA 2UZBA 3ZSGA 5ETIA 1MRVA 2BUJA 2OIQA 1DAWA 3P78A 4PNKA 4MBJA 4D55A 4YJNA 4BDIA 2PE1A 4NKAA 3VHKA 3TNIA 1NT2A 1KOAA 1BX6A 5F4NA 4PMPA 3JS2A 2UZNA 3F7WA 5FGKA 1X8BA 1XJDA 3K5VA 2VTTA 5HNGA 3QQFA 4BI0A 1BYGA 3QKKA 3WZKA 3UVPA 4O7YA 4IX4A 1W8CA 3Q9XA 2C30A 1AD5A 1W0XC 4C0TA 3LW0A 5IH5A 1J7UA 3MTLA 2E2BA 5CNOA 2PYWA 4QRCA 4JXFA 5J9ZA 4UWCA 3AT2A 5ANDA 3D94A 3MV5A 3LMHA 3O51A 3V5PA 2CNQA 4D4VA 4BDKA 4IM3A 4DEGA 2EVAA 2EXCX 4CNHA 5GIPE 1QPDA 3CTHA 3F5UA 3NZ0A 3NYXA 3DJ5A 3FI8A 2C6DA 1KE5A 4UWYA 2REIA 4ZLYA 2IW6A 3QTUA 4FBXA 4RPVA 4JRNA 4LL0A 5BMSA 3K5UA 4IZYA 2W99B 4IVAA 5E7RA 4BZNA 3WZUA 2XK4A 3L9MA 1REKA 2ZMCA 4J71A 3NCGA 5L6WL 5I9YA 3NAXA 4H1JA 4I21A 2PUPA 3C51A 5DHJA 2HYYA 3MB6A 3EN9A 4LOOA 3HAMA 5LMBA 1WVXA 1XKKA 4RJ4A 3FHRA 4QYGA 2GMXA 4J8MA 4XG2A 1ZY5A 2E9PA 2C1AA 2O63A 2WTJA 2PTKA 3CEKA 1Q3DA 1WBPA 3BU3A 3EMGA 3EL7A 2HENA 4S33A 3TKHA 2XIKA 4EH6A 1UVRA 3A4PA 3KKVA 3LLTA 5BVEA 3P7CA 4KIQA 4P90A 4ERKA 1JKKA 1UU8A 3VVHA 4K8AA 4G3CA 4MXCA 4PRJA 1OI9A 1OPJA 2FVDA 4GYIA 4WG4A 4G3EA 3ZSIA 3R9RA 2B52A 3Q9ZA 3D2KA 4EBWA 4XP2A 4H39A 3WBLA 1KE7A 4XS2A 3LFAA 5F9EA 1YXXA 2QHMA 1Y6BA 2Y6OA 5M51A 4FKSA 3QZHA 4L44A 5CF4A 3KMUA 3ZLWA 4IJ9A 3SAYA 4U45A 5FUTA 3HV4A 3NUPA 3QTWA 4U97A 5KE0A 2WXVA 1UWHA 5EOBA 4FIEA 5EHOA 2OF4A 4ENYA 5J9YA 4NM5A 3MIAA 4JDKA 2VTRA 5HX6A 2PU8A 3LFDA 5GIOE 3RK5A 1PXPA 4ZZMA 4B6LA 3GOKA 2CN8A 4C34A 2XZSA 3FEGA 3QRIA 4M84A 2NRYA 4UBAA 4C2WA 4DBNA 5A4LA 3HUBA 3UOJA 4JBVA 3IDCA 4C4HA 3MFTA 4O1OA 3M1SA 4WSYA 3VO3A 4J97A 2WEVA 5AM7A 3EQBA 4ZSGA 1OMWA 5JFSA 4NYEA 3BLQA 5CQUA 4DFBA 5EYKA 4FKJA 4ZTMA 4YTCA 3IONA 4AZSA 4DBXA 4PDYA 4Y85A 3KK8A 2JIUA 3ORMA 5FXQA 3HEGA 1O9UA 3ZSHA 3ZM9A 2ETKA 5B7VA 4OTIA 1BMKA 3UZTA 3BGZA 3AT4A 3D83A 3DCVA 4IXPA 4MF0A 3FMKA 4XHKB 4ZY6A 3TNPC 3ZZWA 3DBDA 4DGLC 2XNMA 4BDDA 5HTCA 4X2FA 2Y7JA 3COKA 3OS3A 3PXKA 4FT0A 4ALVA 4B0GA 2X1NA 3VJOA 3VHEA 1ZOEA 2ITWA 1H4LA 1MP8A 3EL8A 3PA3A 4CV9A 4Z3VA 5HVKA 3R00A 3WZJA 4YPDA 4DG0E 3OXIA 3VW6A 3ZLSA 1FPUA 1Q62A 4FEVA 2PWLA 4TWPA 4C36A 5AR7A 3NNXA 3ORPA 4ANLA 1JBPE 2R3KA 3SG8A 2PVNA 2XEZA 1OZ1A 3MIYA 3VW8A 3NUYA 4RIYA 2FSOX 2XK6A 3Q04A 3TUDA 5BVOA 3G2FA 4ALUA 1H07A 3MPTA 3POZA 4IWQA 4CTBA 3FAAA 2W05A 3VBVA 3CC6A 5DLSA 4IWOA 2YM6A 2YDJA 5C9CA 3ATSA 4EHZA 3V6RA 1CDKA 2YCRA 3UC3A 1UKHA 1ZOHA 2JLDA 2CLQA 4H36A 3ANRA 2YIWA 5EW9A 3UG1A 4G9RA 3HMOA 2BPMA 3ZFMA 1MQBA 4GV1A 4CVAA 2QODA 5HTIA 3SRVA 4D9UA 1TQIA 3KA0A 2VTPA 3PYYA 4IACA 4YNEA 4D2TA 4OTFA 5L2SA 3TJCA 3NX8A 2C5XA 4PUZA 3AGLA 4FZAB 2I0YA 3FLZA 1XR1A 4CGAA 3R7GA 4CYIA 3MY0A 5DN3A 3ROYA 3FLYA 4CYJA 1OL1A 4EH3A 5HO7A 5M08A 5HCXA 3C0IA 3NDMA 4C4JA 3BHHA 3KXXA 3QD2B 3RPSA 5M53A 4IAZA 5E8WA 5JFXA 4GK3A 5K5NA 4LRMA 2VTQA 4CSVA 5HQ0A 3ACKA 4M67A 3MDYA 5HI2A 3VF9A 5TF9A 5ACBC 2J0IA 1JQHA 2GS6A 3UNZA 2UZLA 3OXTA 2X2MA 1YQJA 4F1MA 3RAHA 3LQ8A 2X9FA 5JZNA 3R1NA 2VO7A 3SRVB 2GNFA 5JEBA 4GH2A 4RIWB 2JIIA 3QL8A 3NLBA 4QYEA 3C4WA 1P4FA 4LV8A 3AMYA 2F7XE 2PVHA 4OT5A 5EYMA 4DG2E 5AP7A 3FSFA 2XP2A 3R9NA 2R7IA 5ANGA 2WTVA 4IB3A 4IZ7A 3FMEA 1CM8A 4CMOA 3P5KA 4EQMA 3W1FA 2VO3A 4M7IA 1J1CA 2IVSA 5AV4A 5JGBA 5D1JA 4FKVA 5HG7A 2O2UA 1V0BA 3NYNA 4X3FA 3DJ7A 1V0OA 3RMFA 4I3ZA 1REJA 5CVHA 5IA1A 4O7WA 4PL3A 3QQUA 3H3CA 3ROCA 3QRTA 4U42A 4FUYA 4O0SA 5DMZA 1ZRZA 3FKOA 3SVVA 2JITA 1OKVA 3FKLA 3I5ZA 4M3QA 4U81A 5ANIA 4FV8A 3SKCA 4D9TA 2BKKA 4F4PA 2QURA 1ZZLA 5AP2A 3HUCA 3U54A 3IDBA 2BAQA 4I0SA 2C6IA 5FP5A 3O7LB 4B8LA 4F0GA 4FSMA 2FUMA 1W98A 5KKRC 3BHYA 2CJMA 3QGWA 5D10A 4YJPA 4ZJVA 2UV2A 2F4JA 3R04A 3PIXA 4BCPA 2J0LA 3V8SA 3QC4A 2W1GA 5IEYA 4FV1A 4IM2A 3OCTA 2PHKA 3UO5A 2OK1A 1ERKA 4M0YA 2Z60A 3HV3A 2GTNA 5IA5A 4DCAA 1H1SA 5E1EA 5M4IA 3MWUA 4B9DA 3MFRA 4PPCA 4YNOA 2WIPA 5IPJA 3A62A 3OOGA 4FIHA 2VAGA 4O0UA 3FY0A 5HG8A 5DVRA 2P2IA 1VR2A 2CLXA 3PPJA 4E8AA 4FOBA 2JGZA 3TNWA 4YJTA 3UGCA 1Q61A 3QCQA 4ANMA 4BB4A 4DEAA 3B2TA 4BF2A 2SRCA 3NUXA 4USEA 3O8PA 5JZJA 3VBWA 2P3GX 3LCOA 5EQPA 4FG9A 3MVHA 1JAMA 4BIBA 2XVDA 4X0MA 5E8UA 4EEVA 5BVNA 5JFVA 4BTFA 1JPAA 1GIIA 4WUNA 1Q4LA 4V01A 4E6QA 2OJJA 3OTVA 4J53A 3UIUA 1LPUA 4GG5A 1WBWA 2F7EE 2ZM1A 5KBRA 3CXWA 4NFMA 1XBCA 4WUAA 4Q5HA 5LMKC 4RVTA 4O0XA 5GZ9A 3ZRKA 3EQGA 4DEEA 5HZNA 4NIFB 2OO8X 2R4BA 3TDVA 4BCFA 1G3NA 2JDRA 2FYSA 2VGPA 3GUBA 5KO1A 3CQUA 3QLGA 3R83A 4QQCA 5L2IA 4E4XA 3B8RA 1H0VA 4GYGA 4RWIA 3ALNA 5AUTA 4EZ7A 5IDPA 4ZLZA 3HAVA 2C5NA 2JKKA 4XV1A 5KMOA 3DDQA 3DKCA 1QL6A 2DS1A 4UEUA 5H3QA 3H30A 3RPVA 3PVBA 3IW5A 2R64A 4GEOA 4JDHA 2ITXA 1YI4A 3QHRA 4JIAA 1M2QA 2C5OA 4FT9A 2YLEA 4EH9A 2IG7A 4FIFA 2QI8A 4OUCA 4A07A 3EQCA 4EH4A 4K11A 3VNTA 3LFNA 4LGGA 3KVWA 5FP6A 4ZLOA 3NNWA 5J87A 3ZBXA 5LVNA 2QKWB 4NTSA 4YHTA 4ZS4A 2GS2A 2A1AB 5EM6A 3BELA 3NUAA 3QX2A 3TI1A 4KUJA 1H0WA 5A14A 5AAFA 4FSRA 4RIWA 2UVZA 2X6DA 5HIEA 2PE0A 4XRJA 2WMBA 3LQ5A 3F2RA 1MRUA 4U3YA 4H05A 3TZ9A 2CCHA 2RG6A 2E9NA 3EZRA 4RVLA 3UG2A 2VWYA 5FM3A 3A7GA 2Y4IB 4UV0A 1WZYA 3FLQA 3U51A 3LOKA 2YIRA 3E62A 3P0MA 5EDPA 3D7TB 4OTDA 3P7AA 4YJOA 4X3FB 2CKQA 5FRIA 4JQ7A 1Q8ZA 5CYIA 5T68A 4WNMA 4QP8A 3ORXA 4YBKA 4ANQA 4R8QA 2IZSA 4WNPA 4L45A 4BDCA 1Y57A 4F1TA 5AWMA 4FKGA 3ZLYA 2WIHA 4IAFA 3HL7A 3P7BA 3R8VA 4J98A 4NWMA 4O82A 3QZIA 4Y83A 3Q52A 5AP5A 1YKRA 2HCKA 1UKIA 5KZIA 4ANNA 2VWIA 4R7IA 1WAKA 1L3RE 5IMXA 3TUBA 4FSQA 4CLJA 4BCKA 4JIKA 3BHVA 4JT3A 2Z7SA 2XIYA 4HZRA 4RWKA 1FVTA 3TG1A 3G9NA 5JQ8A 3D7TA 4O38A 3O23A 4QD6A 1BLXA 3KF7A 4WA9A 2FB8A 3BYSA 3EFWA 4CFWA 4ZJJA 3CPBA 1H01A 4QQJA 2H6DA 5F95A 3R8MA 4D5KA 1W84A 3MH3A 1K2PA 3ENHA 3ZS5A 2PZYA 3GOPA 3FQSA 3AMAA 4LG4A 2WQMA 4LV5A 5DRDA 5L8KA 4DTBA 3LCTA 4XBUA 2YERA 4CKJA 4O6EA 5AR8A 5IMEA 2VU3A 1JNKA 4TWOA 4F6WA 2G01A 1U54B 5AA8A 3ZH8A 4DFXE 4A9UA 3DFAA 5AP4A 2CHLA 2J6MA 2OI4X 2QD9A 3C13A 4XOYA 4DGOA 1ND4A 5KUPA 3W10A 3OZ6A 2JDSA 3FBVA 4C57A 4CLIA 2C5YA 2UZTA 4FT5A 5DEYA 1ZYJA 3AC1A 3BEGA 5E91A 4BWPA 5FTOA 3D5XA 4WOVA 4LYNA 2XJ2A 1BKXA 2OZOA 4RC4A 3COIA 4RGJA 4TZRA 3CKWA 4M13A 2QR7A 2VTMA 4G3DA 4EK4A 2EXEA 2ZV7A 3DQWA 3P79A 4D1XA 2EB2A 5LMKA 2XS0A 4BCQA 4L7FA 1G8AA 3BPRA 4JQEA 3GU4A 4D28A 1F5QA 4WBOA 4D2WA 3E8CA 5JRSA 1CTPE 1AGWA 5H8BA 3HV7A 2NNWB 2I40A 5J95A 1XQZA 4KA3A 1YXSA 5LWMA 4F9CA 2IVVA 3U4WA 5EM8A 5DI1A 4OR5A 2IZUA 4TWNA 5L3AA 4KABA 3KXGA 4L68A 4KIKA 3KXZA 4RBLA 5FQDC 3V8WA 4A4XA 3CD3A 4V05A 4UALA 4G17A 5J1VA 2JDTA 2W4OA 5HD4A 1YHVA 4E7WA 2C3KA 4IB0A 2PUNA 3BE2A 2ZDUA 5CS6A 1U5QA 3L1SA 3ZDUA 4FZDB 4FKLA 4IC7A 3D2IA 4MXAA 4R3PA 3GP0A 2I7QA 2I0HA 2J0JA 4YJVA 4BCJA 2PMLX 3A7HA 4G3FA 2O5KA 2ITQA 3CR0A 5A4EA 3PWYA 1S9IA 2B7AA 4QP1A 4EONA 4KWPA 1FGKA 3RHKA 1MQ4A 3PUPA 1IA9A 3BBWA 3N4UA 4OBQA 4YTIA 1YOLA 3NW6A 4IB1A 3UODA 4A9TA 3PSCA 4X3FC 4PF4A 2WTIA 4XEYA 4YZ9A 1M2PA 3EQFA 4FKTA 4RIOA 4XNEA 3R01A 4KIKB 3TEIA 3KN6A 4K18A 5FDPA 3QQHA 2ZM4A 3QWJA 4OW8A 1CKIA 3PIZA 5L6OA 5DH3A 4TYJA 1YDSE 4O1PA 3EQHA 3VUMA 5AJQA 3VAPA 4CXAA 4D1ZA 2GDOA 3DTWA 5JRQA 4NTTA 5JGDA 2E9OA 2XM8A 3W2QA 4FNZA 3AG9A 4Y5HA 1BL7A 2EB3A 5CF5A 4QMZA 3BWJA 3A4OX 2XBJA 3CGFA 3EKNA 3E8DA 3H0ZA 4Y73A 1ZYSA 3MB7A 3ZO2A 2UZWE 3WZEA 4FEWA 1Q8TA 4L00A 2CSNA 4AUAA 4DTKA 4NT4A 3SOAA 4FR4A 3A61A 2VWZA 2BFYA 3EYHA 4QMWA 3N9XA 4U79A 3TXOA 3PIYA 4BWKA 2X7FA 4O7ZA 4G6NA 4O86A 3R7VA 3TTIA 2WTDA 1NVQA 3EN4A 3TV7A 1CKJA 2VX0A 2DYLA 1GZ8A 3LE6A 3VS0A 3MESA 5IQGA 3Q6WA 3IW6A 2XMYA 1U59A 4FGBA 2YCSA 2DQ7X 4II5A 4WBBB 2J5EA 2YM4A 2CKEA 4IJPA 4QP2A 1QPEA 4IAYA 2OJGA 2RFDA 2PVRA 4OTGA 4FSNA 4CFUA 4PMMA 4E20A 5E9EA 3REPA 3ATTA 3Q4UA 3SGCA 2RFSA 4RA4A 4XMOA 4QQTA 3N4TA 1RDQE 4YZCA 4XG8A 5L2WA 5B2KA 5KCVA 4IW0A 3FMLA 1A48A 5HIDA 3ALOA 3PXRA 2BTRA 2ERZE 3Q2MA 4FV6A 5DFPA 5FM2A 1GAGA 1FQ1B 3HZTA 2C69A 4YR8A 4KSPA 2XNGA 4WRGA 4YGAA 3R9HA 4IVDA 4FL1A 5DR2A 5FG8A 1WCCA 2CNUA 2VTSA 3D7ZA 4CQGA 5IA4A 3CGOA 5GNKA 5EM7A 3V5JA 4FTAA 2WMRA 3HDMA 4HGTA 3PJ2A 2WEIA 2PMNX 2F2UA 3RWPA 4NM0A 4FKQA 3RM7A 4P5ZA 4J1RA 3EQIA 4RLKA 5BVDA 2JKOA 4MEDA 3ZC5A 4GSBA 5IQAA 1Y8YA 3QX4A 3UP7A 3MH2A 5AR4A 3QD3A 3FZPA 5AP3A 1SVHA 2B9HA 2YIQA 4W4WA 3SW4A 4DLIA 3QF9A 4JS8A 4UMTA 5HE1A 3BGPA 4I23A 4CV8A 4BIEA 4EYMA 3UIXA 3Q32A 3UIMA 4TNBA 4G34A 4F6SA 3KXHA 3QXOA 3IOKA 5CWZA 3RK7A 4E4MA 4EOIA 5CU2A 4FGRA 4CG8A 3S00A 2ZB1A 2XNNA 4R3CA 2IN6A 2UW8A 4O6LA 2YDKA 4JNWA 4HNIA 2PVFA 3OC1A 4EH7A 3FSKA 4NKSA 4ZTQA 4UMPA 1LR4A 2BRNA 1TQMA 4WG3A 2O3PA 3FZSA 2WB8A 2Z7QA 3MVJA 2C47A 4E1ZA 2C3JA 5AFVA 4BFMA 3MS9A 1PMVA 2X8EA 2QOQA 4FZ7A 3QCYA 1APME 4M15A 4QYHA 2HXQA 4RIXA 3RGFA 1PMEA 3Q4ZA 2BKZA 4TYGA 2Z7RA 3GCVA 3C5UA 2VWUA 3EKKA 4IADA 4OTPA 3BKBA 3W2CA 5CI7A 3DLZA 5CAVA 1OVEA 4PMTA 2ETRA 3GC8A 4L7SA 2GPHA 3ZXZA 1WBVA 5J79A 4APCA 1GIHA 4IWDA 5FWKK 3VUTA 3AQVA 3QYWA 3TNQB 5IQBA 2YLFA 4I4EA 2BALA 3F5GA 4IH8A 4CCBA 4TY1A 4F65A 1OM1A 3HV6A 2WTKC 4N70A 1XH5A 3FYJX 4JG8A 5EHLA 3OWPA 3F66A 2OG8A 4ZP5A 3BV2A 5D11A 1WFCA 3RNIA 2BILB 4I24A 4QP7A 4LRKA 1PMUA 2R0UA 3KQ7A 3M2WA 4OTHA 2PSQA 3EN7A 5CT7A 3ZCLA 4EI4A 3NYVA 3IK3A 5I9XA 4QTBA 2X7GA 4UYNA 4AAAA 4MNEB 3DDPA 3FC1X 1T46A 1UNGA 2B9JA 3I6UA 4I22A 2PE2A 4YBJA 5HLPA 3KU2A 4EK6A 4YMJA 2XK3A 4FTRA 2XNBA 4DFLA 3ZUUA 4FKIA 2H96A 4X2JA 2OU7A 1QCFA 4YUQA 4H3QA 4IVCA 5CVGA 4YTFA 5KMNA 4D0WA 1ZARA 2QG7A 3UZRA 2ZM3A 5E90A 5KNJA 4FSYA 1OL6A 4IANA 2GHMA 4RC2A 5H2UA 3ET7A 3DLSA 5CXZA 3OMVA 1O6KA 4AZFA 3VS7A 4ZEGA 4AZEA 4BKYA 4MBLA 3PJ8A 3ZM4A 4EQCA 2NP8A 2W5BA 3OW4A 2W1HA 4PPBA 1JSTA 5ETFA 3LQ3A 4KKHA 2XIZA 3VUGA 4A4OA 2JKQA 1NW1A 4QP3A 3R8UA 3SXSA 3OG7A 4JBQA 3SXFA 3V8TA 4EBVA 5E1SA 2PZIA 5AUYA 4ASXA 4EOQA 1OKWA 5CU0A 3VUDA 3COMA 5L4QA 5CSXA 4B8MA 5ETAA 3F3TA 2VNWA 3GCQA 2GHGA 2ZV8A 5C26A 3H4JA 3QQLA 1I44A 3DNEA 2J2IB 3UJGA 5BUEA 3BEAA 4XBRA 4YLKA 4RJ7A 5EM5A 3PE2A 1PMNA 2XJ0A 4ORKA 1XWSA 1RJBA 3A2CA 4ZMEA 5E8TA 5IUGA 1YRPA 3K2LA 4QMYA 4YJRA 5DPVA 4OBOA 5HE2A 2YAAA 3O2MA 4ZS0A 3SD0A 2IW9A 4AACA 2HZNA 5LVMA 1M17A 3QTSA 3KL8A 3GEQA 4DH3A 4H3BA 4PDSA 2W1FA 2DUVA 3MA6A 2CGWA 4QNYA 4EZ3A 5IH6A 4AZVA 5KKRB 3LZBA 5GZAA 3S2PA 4G3GA 3L9LA 3LAUA 4O22A 4Q5EA 5HCYA 3IW4A 5BQ0A 5M4FA 4GUEA 2VV9A 1XH6A 1XBAA 3Q5IA 3UOLA 3DV3A 1FMKA 4FNWA 3DZOA 4RIYB 3B8QA 3SX9A 4A9RA 1P4OA 4AOTA 4M0ZA 4FICA 3UP2A 4RFYA 4HGLA 2BZHB 2XIXA 1B39A 2Y0AA 3DAKA 4IHPA 5CSWA 3VS5A 5CAPA 2B53A 4FK3A 4GL9A 4ID7A 3BZ3A 4QYFA 4YPSA 1OGUA 1H8FA 3O50A 4XP0A 1XH9A 3BQRA 4BZOA 3GC0A 3V5WA 5HE3A 4FL3A 5F20A 4IB5A 4AA4A 1U46A 4CFMA 2XKFA 4L8MA 2EWAA 3G90X 3OT3A 2LAVA 4AW0A 2OBJA 3MY1A 5A4CA 3P4KA 4G1WA 4ZSJA 3UO4A 2BVAA 2E9UA 3H0YA 4GFOA 1R39A 2UZEA 4IX3A 5EI2A 4QP4A 5T3QA 3JYAA 4Q9ZA 4N6ZA 3C5IA 2C6TA 2F49A 3PTGA 3OD6X 4A7CA 4UXLA 1DM2A 1IG1A 3NWWA 4ZOGA 4DH8A 2PZ5A 3QA8A 2WPAA 4G5PA 3SDJA 1XH8A 4RWJA 4BL1A 3OOMA 1E9HA 4G5JA 3ZO1A 4PDPA 4RX7A 5I3OA 4L67A 4J95A 1VZOA 5CSHA 4K2RA 1PXOA 4U44A 3OWLA 4JBOA 3VUHA 4AT5A 4RZWA 4AA0A 3RWQA 4QNAA 3LFSA 4X3JA 4TYHA 3P23A 4D2SA 3QQKA 4Y8DA 3DFCB 3TL8A 4FVPA 2YITA 3D4QA 2V7AA 4HNFA 4AN3A 5A6NA 4LFIA 2NPQA 4A06A 3HECA 4C35A 1VYWA 4QPAA 4ERWA 2E9VA 3ORKA 3OT8A 2ZMDA 1OECA 2OW3A 3PXYA 3QCSA 5J5SA 3VULA 4D2RA 1FVVA 2CGVA 3D5UA 3RP9A 1Y91A 3BV3A 3FJQE 1WBSA 3LCDA 3FPMA 5AV3A 3NUUA 5AX9A 3VC4A 4ASDA 2PY3A 3HMNA 5HICA 4DH1A 4LOPA 3KCFA 2W4KA 3CBLA 3UIBA 3JR1A 2QO2A 3FL4A 4HYHA 4PV0A 4BTJA 2ITNA 4ZSEA 3IW8A 5EI8A 4AGCA 3E7OA 4EH2A 4MXYA 4F08A 3LXLA 2R3MA 3BU5A 1U54A 3ODZX 4HCVA 4IBMA 4AN2A 4A9SA 3PXZA 2O0UA 3HMMA 4PX6A 4BYIA 5AUZA 1QPCA 4PNIA 4CT1A 4BRXA 4CTCA 5I9WA 1JVPP 4IX6A 2OSCA 1WBOA 4CRLA 5BVFA 1H1QA 3MYGA 3R21A 3CP9A 3BWFA 3UVQA 4EK5A 1UNLA 3L8XA 3PPZA 4XG6A 4ASEA 4FTNA 3DXQA 3FMJA 2GHLA 5HE0A 4O7LA 5E8ZA 5HO6A 4C59A 1FGIA 5AX3A 1PXLA 4J8NA 4AG8A 3QTQA 1TQPA 4UMRA 3R1SA 2YM8A 3MJ1A 2A0CX 4U5JA 5CTPA 3ERKA 4BDHA 5KMKA 4FTMA 1F0QA 2C68A 4RX9A 3W2SA 5I0BA 3WYXA 4MD7E 4FE2A 2CKOA 4EJNA 3GU7A 3TDWA 4HVIA 3PSBA 2NRUA 3Q9YA 3VJNA 4ENXA 2XF0A 5EQYA 4NJ3A 3UO6A 1H08A 3NGAA 4RVMA 3TWJA 3KXMA 2QG5A 4G16A 1E1VA 4GRBA 4HPTE 4YSJA 4QMPA 3PSDA 4K6ZA 4BHZA 3DXPA 2Y6MA 4F70A 4O27B 2C5VA 2G2FA 2GNIA 4ITJA 3U55A 3A7JA 4XRLA 5DE2A 5HG9A 3TV6A 4YHFA 3R7UA 3F5XA 3JPVA 2C6OA 1IAJA 5DYJA 3DT1A 5CSVA 4AT4A 3I79A 4XG7A 4D0XA 3C4XA 4FNXA 2G15A 4FV2A 2WZJA 3QLFA 3A8WA 1XO2B 5EKOA 3FY2A 4UB7A 2EUFB 4UY9A 2C6KA 3C7QA 3WF5A 4RJ6A 4KBAA 4F0FA 2JFMA 5E8VA 4GMYA 2YZAA 4C8BA 3CTQA 1GY3A 3K3JA 3PZHA 5IU2A 3RBWA 3ZO3A 4EHVA 4GK2A 1OIQA 3FZTA 4BGHA 4O0TA 2XNEA 4YZMA 3I60A 1ZXEA 2WQBA 4U6RA 1W7HA 2C4GA 2RFEA 4C7TA 3LFCA 2FO0A 4L42A 4EOSA 3EQRA 4S34A 3RPOA 5FDXA 2WGJA 3BIZA 4BCOA 4EOMA 1Y6AA 2I0EA 4IAAA 1SNXA 2GNJA 5EDQA 3W2PA 5E8SA 4DINA 3PJ1A 3FLSA 3T3UA 2YJRA 2VO0A 2RGPA 4C33A 5B2MA 4C4FA 1FBNA 2GNGA 2QOBA 3OEFX 3HV5A 4NUSA 3LMGA 2BIKB 3AD6A 2IVTA 4FTQA 3WE8A 5AUUA 4MVFA 1R78A 3O8UA 4EHGA 3OCBA 2AC3A 1URWA 1YWVA 2UW9A 3RCDA 4ZIMA 4X21A 2C1BA 3NW7A 3QZFA 3ZYAA 3PE1A 5L2QA 2VWVA 3NPCA 2B55A 2QONA 2QVSE 3DJ6A 5M55A 3C4CA 4FKPA 4I6QA 2JC6A 1SZMA 4EUTA 3D5VA 3D5WA 4QMVA 3BHUA 3FZOA 5KMIA 5KHWA 4NW5A 2XIRA 5LARA 3QFVA 1IA8A 3ETAA 1Q8WA 2W1ZA 3LKMA 2YABA 2ETMA 5HBHA 5AA9A 3MY5A 5AV1A 4TYEA 3PY1A 3K3IA 3OCGA 4F9WA 1VYZA 5M56A 4FV5A 4E73A 4ZTRA 2X9EA 5L8JA 5KZ0A 3H9FA 5A4QA 1GJOA 1CKPA 4X6QC 4XX9A 4HGEA 3GVUA 4KBCA 5CT0A 4BR3A 4DAWA 2W06A 4HGSA 4ACHA 2YM3A 4OBPA 3VRZA 4QPMA 4YZDA 5DT0A 2W9ZB 4CMTA 2FH9A 3F2AA 3HDNA 4I5HA 4UWBA 4RJ3A 4JLCA 1SVEA 1PXNA 1UU3A 2BCJA 2VRXA 3CIKA 2VX3A 3GB2A 4W4XA 4FTUA 2BR1A 3DK3A 5CEMA 4MNEA 4I41A 4PL4A 3TNHA 3DBFA 4W9WA 3WZDA 4D4RA 3G33A 3Q60A 2X8DA 2R5TA 1R0PA 5AR5A 4DFYA 2Q0NA 5EW3A 1TKIA 5D7AA 3S95A 2V22A 2W5HA 1Z9XA 3H10A 1H26A 5JSMA 2GFCA 4CFXA 3DBCA 2OZAB 3II5A 4XV2A 1FVRA 4IM0A 4KINA 4I4FA 3EFKA 5LVPA 3SG9A 4WSQA 1KWPA 4XJ0A 5I5ZA 2BRMA 4N57A 4FVRA 4IMYA 4FUXA 5BVKA 4ZTLA 5A46A 4MQ1A 3FXWA 2A27A 3BE9A 4XG9A 4AW5A 3EH9A 3FI3A 4RX8A 4E5WA 4G9CA 2C0IA 2W5AA 2ZAZA 5BYZA 3DQXA 3NUSA 1U5RA 4Q9SA 5EYCA 4LGDA 3QALE 3Q4CA 1Q24A 3BRBA 5ACKA 2F57A 4IIRA 3FC2A 4EUUA 3ZO4A 2WMWA 4EHEA 4RZVA 3NIZA 3QC9A 5CF8A 3VQHA 2XUUA 2P55A 2IO6A 1ZWSA 2J0KA 1BI8A 4TT7A 2G9XA 2A2AA 2WMAA 5DRBA 4EC9A 5AIKA 4KRCA 3W8QA 1ATPE 1URCA 1A06A 2ITYA 2OJFE 2HW7A 3DKOA 4YU2A 5IQIA 3IGGA 3TIZA 4RSSA 3W16A 3IQ7A 5H8GA 4V0GA 3OF0A 4FV7A 3ZBFA 3CLYA 4TKSA 3HP5A 4O7SA 3ZONA 1K9AA 1PYEA 3I4BA 3LPBA 4IZAA 4PDOA 4MK0A 4OLIA 5CU3A 2W1IA 4Z7HA 5L2TA 3LM0A 3I7BA 2YWVA 4C62A 3KY2A 3QTZA 3DB8A 3ZRMA 1QMZA 5LJJA 4FVQA 4RFMA 2I1MA 1YDTE 4PTEA 2J0MB 4BKZA 1RW8A 2B9FA 3AXWA 2CMWA 3DK6A 2J90A 4WD5A 5KHXA 5EYDA 5JKGA 2XYUA 4C2VA 4ZY5A 2QOIA 5CASA 1M7NA 4FG8A 3E93A 4L53A 4HVSA 5I3RA 4LRJA 2QHNA 3TN8A 3KULA 4EC8A 5AADA 5BYYA 5FXRA 2OGVA 4TL0A 4PMSA 4V0GB 2QCSA 1L8TA 3N51A 4CKIA 4M12A 1PXJA 4CT2A 4OT6A 2QU6A 4TN6A 3RINA 4NM7A 3DXNA 5A4TA 2J50A 3CTJA 3VIDA 3PZEA 4GKHA 1P14A 1DI8A 4B7TA 2QQ7A 4LUDA 4EWQA 4PY1A 5DT3A 4ZXTA 3QQJA 3QAME 3R02A 5CAOA 2HZ4A 2BAKA 3LXPA 4YHJA 5J9LA 3MFUA 4Z55A 5CENA 3MH0A 2XCKA 4D4YA 2OICA 5JGAA 4DEDA 2OKRA 4FZ6A 5IEVA 4EZ5A 3JUHA 1FINA 1JKLA 3G0EA 4PTCA 3HNGA 1YI3A 3WE4A 4AZWA 5CF6A 3RK9A 4YZBA 3HYHA 5FD2A 3QHWA 5L6PA 2VWWA 4O96A 2VD5A 1YDRE 4TRLA 1IEPA 3ZU7A 5GHVA 3JY0A 2Y8OA 4LI5A 4WO5A 3MGYA 4OAVB 2XK9A 4CEGA 4MF1A 5CANA 2WQEA 4FIGA 3CJGA 3RNYA 3R2YA 4W8EA 1JSUA 2IWIA 3V3VA 2W9FB 4IX5A 1JWHA 2P4IA 2A19B 3UYSA 4BCMA 4QTAA 3QA0A 3SA0A 3V51A 3CKXA 5FTQA 3RJCA 4U3ZA 2UW0A 4R1VA 4ACCA 5H8EA 5DBXA 4LQMA 3ZMMA 2GS7A 3C1XA 4PQNA 2AC5A 1LEWA 2VTAA 3E88A 4QP9A 3VS4A 5K9IA 2OXYA 5C4LA 3R7YA 3NMUF 4R78A 4BI1A 3ENMA 2OXXA 4W8DA 5CAUA 1SM2A 2XYNA 3RAIA 5EQEA 3ZLXA 2BROA 3RZFA 1Q3WA 2ZVAA 2XJ1A 3O17A 3FI4A 4GT5A 4O91A 2XK7A 4YO4A 3R71A 5CEKA 4DHFA 1O6LA 3MW1A 4Z9LA 2GQRA 3IKAA 2WKMA 4XG3A 3BX5A 3PVWA 5K3YA 4OTWA 3ULZA 1ZMWA 4Q2AA 3EFLA 5HTBA 3HGKA 1HCLA 3GCPA 3M11A 1JKSA 5CZHA 3CSVA 5KMLA 3GFEA 1ZMUA 1TVOA 3HLLA 1YHSA 4WT6A 4KD1A 4WNKA 4YC8A 5JN2A 3DPKA 2YISA 3E92A 3F3WA 3LJ1A 1B6CB 1Q8YA 5C8KA 3F61A 3UBDA 2A4LA 4IFCA 2VGOA 2KTYA 3F5PA 5AIRA 5FEEA 4E26A 3TIYA 3TTJA 1ZYLA 3R8ZA 3GC7A 3UQGA 5JQ5A 4RMZA 2UZVA 3MPMA 4CD0A 5J5TA 3A60A 3TJDA 3ANQA 4ZTNA 3VS2A 3QYZA 2R3IA 3GENA 3LFEA 4ZY4A 5DG5A 4JX7A 3R73A 2ITPA 4F7JA 3D14A 2QLUA 1OBGA 2NO3A 1DS5A 2GFSA 3IPHA 3ORZA 2WAJA 2Y4IC 3R22A 3TZ8A 4RJ5A 2FGIA 4KIPA 3MSSA 3NSZA 4YJSA 2P0CA 5EHYA 4Y72A 3UC4A 4JBPA 5IUIA 2ITTA 2RG5A 2EU9A 5DA3A 5A3XA 4PPAA 4AXAA 1M2RA 4UN0C 3V5QA 2X2LA 1ZYCA 4TYHB 4BHNA 1KUTA 4K0YA 3BYMA 3KCKA 4BDAA 2WQNA 2CGXA 4KBKA 4LL5A 3QUDA 5TE0A 4ASZA 3PRFA 3GU5A 1IAHA 3VF8A 5HU3A 4XH6A 5D12A 3VBYA 4F9BA 2PMOX 3WIGA 3ZFXA 2IPXA 4NM3A 1K3AA 2OJ9A 2WFYA 2BHHA 4I92A 4RFZA 1OBDA 2UVXA 3DNDA 4KIOA 4BDFA 2Z02A 2OFUA 4I20A 2FSMX 1OKZA 1OUYA 4FKWA 4TTHB 4QMOA 3UVRA 2QC6A 2F7ZE 4FT3A 4IAKA 1J3HA 3QZGA 4QP6A 5EK7A 4L6QA 1OITA 4O7RA 4V04A 4I93A 5FEDA 3T9IA 3CQWA 5IISA 1SNUA 1PJKA 2BDFA 2XKCA 5HEZA 2QOOA 3ACJA 4CCUA 3OFMA 4EOPA 3R9DA 3TV4A 3BGQA 3EHAA 2IJMA 4JQ8A 4U9AA 3DY7A 3TCPA 4CZTA 2W17A 3RZBA 2FA2A 3UQCA 3PFQA 3AT3A 4ZTHA 4AS0A 3EFJA 2C6EA 4ZSAA 4DT9A 2YHVA 2FSLX 4QQ5A 4FTLA 4BGGA 1JKTA 2CPKE 4ZK5A 3L9PA 2PL0A 3DZQA 5I4NA 4X2GA 4YC6A 3BYUA 2WNTA 3KXNA 3C0GA 2O64A 4S31A 5TT7A 4CKRA 4XYFA 4AOJA 4EORA 1XBBA 3OWKA 1KOBA 4USFA 5D7VA 4ITIA 5J7BA 4C02A 1PKDA 2I6LA 2BRGA 2OXDA 4CFNA 4ONAA 3I1AA 4YJUA 3R1QA 5HESA 5I9ZA 3QRUA 4HZSA 2B9IA 4HYIA 4O7TA 4QT1A 4RA5A 2BFXA 2JAVA 2QR8A 4FKUA 4FODA 4MXOA 2VWBA 2C6LA 4R6VA 4O7NA 5IQEA 3R28A 2BDJA 1ZZ2A 4GT4A 4KRDA 3HX4A 3RAWA 4I6HA 3LXKA 1P5EA 5HO8A 3MTFA 2PZPA 3QXPA 3JXWA 5T6KA 3W55A 4F7NA 4I6FA 3FLNC 3LIJA 5AV2A 4O0WA 3UMWA 2H9VA 3CQEA 2IZTA 5CQWA 3IOPA 2BHEA 1J7LA 4OGRA 3PG1A 4LMNA 5HD7A 3OUNB 5CY3A 1CMKE 4M14A 3JVSA 2JD5A 3PJCA 2ESMA 1U4DA 3Q96A 3GT8A 2Q83A 3R30A 5CI6A 5DR6A 2VZ6A 4H3PA 3ULIA 1UV5A 3ORLA 5CALA 4HVDA 5BUIA 4FV3A 3ZHPC 3C50A 5A6OA 5CEIA 4FTTA 3F2NA 3NYOA 4I0TA 4E93A 1Y8GA 2ZV2A 4C3FA 2I0VA 5HNBA 4D2VA 5A9UA 2ZV9A 4N4SA 4YTHA 4CFVA 2VTJA 4GJ2A 4M68A 3GU6A 4NK9A 3KRWA 4MXXA 2VTIA 4FG7A 2YA9A 5DNRA 5AP6A 2J7TA 4O81A 4W9XA 4L43A 4BVUA 4MTAA 2QNJA 2O65A 3V6SA 4D1SA 2AUHA 2YWPA 4FSUA 4XLIA 3UPXA 5M06A 4GT3A 2ONLC 3NR9A 3MH1A 5EOLA 4MHAA 1VEBA 4K77A 1GNGA 2ACXA 5K4JA 3KVXA 4R7HA 3LCSA 4NCTC 3L9NA 4FEUA 2YM7A 4FL2A 4RQKA 3PA4A 1YOMA 1H28A 3HRFA 3AC4A 4F9YA 3KRJA 3ZC6A 1OL7A 2BMCA 4LUEA 5HORA 3SW7A 1G8SA 2WMXA 4IVBA 5IQDA 3PP1A 2OH0E 4L9IA 3F82A 3OWJA 2HELA 3OEZA 3K54A 4EJ7A 3EQDA 1M52A 1DAYA 3CD8A 3PP0A 3O8TA 4YC3A 2PMIA 2CGUA 3L8SA 4ZMFA 5IG1A 3DBQA 3UYTA 3WOWA 5JH6A 4FMQA 2C0OA 3TKUA 3I0QA 4FV4A 5DEWA 4Z16A 2Y9QA 3R2BA 4ACGA 5IEXA 3BI6A 3HP2A 3Q4TA 4FYOA 3DGKA 3NS9A 4AU8A 4BBFA 3FMDA 4C4IA 1IRKA 1PY5A 4E4LA 2YACA 4M66A 3KN5A 1W83A 3KK9A 3FZ1A 4FYNA 1KSWA 4I1ZA 3HMIA 3KMMA 4BCGA 5FTGA 4MCVA 2V7OA 4YURA 3BHTA 2YFXA 3UQFA 3ZZEA 2HWOA 3NVKI 5AV0A 4QMUA 4J96A 3RI1A 4EH5A 4WNOA 1OIUA 4FI1A 3IG7A 3ORTA 3OP5A 5HG5A 3G5DA 4NSTA 4G6LA 4P4CA 5C03A 1KE8A 2GQSA 4BDEA 4D5HA 4DFUA 3VBQA 2UZUE 3KB7A 4ZZOA 4KAOA 1WMKA 4S2ZA 1UWJA 3AC5A 2WTWA 5JT2A 1NA7A 2HZIA 2QOLA 3PRIA 4U80A 4CFFA 5GINE 3BCEA 3QTXA 1Q99A 4MXZA 3E8NA 3AC3A 1Z5MA 4YLLA 4E3CA 3Q5ZA 2VTHA 3C0HA 3EQPA 4DE4A 5C1QB 2BZKB 4CZYB 3EOCA 4DFZE 3VN9A 4TXCA 4NIFA 4EK8A 5HNIX 2G1TA 4ALWA 3AC2A 3V5TA 2W4JA 3F3VA 3ZTXA 3ZDIA 3QD4A 2GNLA 2HOGA 2V0DA 4EQUA 1GZKA 4GCJA 4E6AA 2X4ZA 4I6BA 4JX3A 4C37A 1GIJA 4JVGA 2H34A 2ERKA 3OY1A 4MH7A 2Z7LA 3G0FA 4MWIA 4BZDA 1WVWA 4NL0A 3QUEA 3R7OA 3R63A 4F64A 3UDBA 4F1OA 5ANOA 4A4LA 2R3QA 3F69A 3QCXA 1IASA 1KV2A 3U8WA 2YAKA 2YIYA 1V1KA 4AGDA 5M09A 1B38A 3B2WA 3T8OA 4L3PA 2AYPA 2FSTX 4E4NA 4JDIA 2R3NA 5CLPA 1ZAOA 4MD8E 3UNKA 5KMMA 2YCQA 5M4UA 3FMHA 4GIHA 3VBXA 4C4GA 2R0IA 3GGFA 3W2OA 4BCHA 3FDNA 2C6MA 5M4CA 1M14A 3FV8A 5AUXA 4OAUC 2V62A 2RL5A 3DAJA 3SHEA 5HVJA 3DA6A 3GXLA 3VQUA 5HU9A 3FWQA 1YXVA 1E1XA 3D15A 4MQ2A 3R8LA 2WTCA 4FTCA 2WHBA 3P08A 1CSNA 1H24A 2JAMA 5AUVA 3UOHA 4M8TA 4ANBA 2R3RA 4ANOA 1H1RA 2GTMA 4BCNA 3MVLA 4AT3A 1XHAA 4QMMA 2J5FA 2OWBA 3DAEA 4AWIA 2QOCA 3PY3A 3KF4A 4HPUE 4RIXB 3WARA 1OB3A 3NNVA 4GS6A 3FKNA 4QTCA 1OPLA 4W4YA 4S32A 2R3GA 5AMNA 2BAJA 4K33A 2J9MA 4Y95A 3MFSA 2YIXA 4HVHA 3A7FA 3OBJA 2V55A 4FKOA 4DCEA 3KMWA 4FC0A 4O21A 5GZ8A 3OROA 4JAJA 5KMJA 4K1BA 5E92A 2XBAA 4NZWB 3LVPA 3RHXA 3RPRA 4BCIA 3NW5A 4G2FA 4PL5A 5DT4A 5F1ZA 2R3JA 4DGNA 2VNYA 2VWXA 4U41A 5LCJA 1PRYA 4FX3A 1PF8A 4FSWA 5IH4A 5G1XA 3OUKA 2WQOA 4J99A 4O0RA 4U0IA 5AEPA 2UZOA 2ZYBA 4IFGA 4RVKA 3G51A 3QKLA 4BI2A 1OL5A 4AX8A 3WF6A 4DFNA 4DEHA 3TM0A 1Q97A 3WF9A 2W1EA 5FLFA 2QOHA 1YW2A 2JEDA 2GCDA 4GK4A 2W1DA 3L8VA 4B4LA 1SMHA 5IA0A 1YXUA 3G6HA 5CSPA 4E5AX 1STCE 3CCNA 4D4SA 2ITVA 3BU6A 3THBA 2GU8A 2R3FA 4FNYA 3F3ZA 4ARKA 1O6YA 1KE6A 3AOXA 3UMXA 2Z8CA 3EZVA 3MN3A 4IDVA 3CS9A 4DC2A 5D9HA 4FIIA 2B4SB 4E6CA 2QLQA 3QRKA 4FIJA 1M7QA 3ZFYA 4DG3E 3KFAA 4TW9A 2PVMA 1KE9A 1XH4A 4APPA 4RX5A 2RFNA 2XH5A 5C8NA 5HLNA 3N4VA 3HRCA 2UW7A 4CRSA 4E5BA 1Z57A 4ACMA 3IGOA 1OUKA 2HK5A 3FXXA 1Q5KA 4N0SA 3G6GA 5AUWA 2XM9A 3QBNA 4IE9A 5HLWA 5J1WA 1V0PA 4XLVA 4F63A 3Q3BA 2WO6A 3TZ7A 3TZMA 4AW1A 4ZZNA 4WKQA 4BGQA 3E3BX 4F9AA 3LLAA 3PDTA 5B2LA 3IW7A 3LJ0A 5LVOA 4YO6A 5E4HA 4B99A 4BC6A 2JFLA 4FSZA 1R1WA 1PW2A 1S9JA 1ZLTA 3DS6A 4YJQA 3NRMA 2VTNA 4R3RA 4AF3A 4IQ6A 1WBTA 3AMBA 2HAKA 3BQCA 3BBTB 2G2HA 1F3MC 1UU7A 2R9SA 3QU0A 5AR3A 5DIAA 2XKEA 3C4FA 3RALA 4O0VA 4BIDA 2C3LA 3U6IA 4F09A 3SLSA 4F7SA 3RKBA 3EN6A 1WBNA 4FTOA 4BBEA 4TPTA 5ICPA 5EG3A 4O0YA 1AQ1A 2ONLA 5CEQA 2CCIA 4RC3A 5HOAA 2J51A 3IS5A 3LFQA 3PJ3A 5GJGA 5LMAA 5IF1A 5JMSA 5E8YA 2PUUA 2WOUA 2J4ZA 3D9VA 2X39A 1H25A 5ANJA 4XUFA 3CY3A 4QPSA 4QYYA 2VO6A 2X81A 4MBIA 4AP7A 3A7IA 4GKIA 2G2IA 5FBOA 3R0TA 4A9YA 4HJOA 4JJRA 5KBQA 2WMTA 4I94A 4HVGA 4DTAA 3R1YA 1DI9A 2OH4A 3P9JA 5CU4A 5CXHA 3RPYA 4FA2A 4O84A 4MX9A 3FQEA 4KKEA 3HMPA 2C3IB 3ZEPA 4L46A 4XG4A 4ZSLA 3BYVA 3UOKA 4BKJA 2HWPA 3ODYX 5GJFA 3RCJA 3WF7A 5HCZA 3GCUA 1PXMA 4D2PA 3F6XA 3GU8A 3FYKX 4JRVA 4AW2A 4UX9A 2PK9A 4FF8A 4I5PA 3KEXA 4MWHA 5LVLA 4C61A 5EKNA 3IDPA 2R3HA 4X7QA 3DK7A 4XV9A 3F3UA 1J1BA 2GQGA 2VX1A 3C4EA 4MD9E 5AP0A 4C38A 5DR9A 4FV9A 4CZUA 3U6JA 3W33A 3QUPA 4P2KA 4C3RA 1R3CA 5ETCA 2UW5A 5FEQA 1YOJA 3EN5A 1YWNA 2HY81 3Q53A 3QKMA 1PKGA 4L3LA 4P7EA 5DGZA 4EKKA 3U9NA 2UVYA 3QTIA 3R6XA 2IW8A 3TACA 5HBJA 2B0QA 2XRUA 5F94A 2R3PA 3VUKA 1RE8A 3GBZA 4IEBA 4FZFB 2WMQA 3G15A 3BLRA 1H1PA 3AC8A 3KRRA 3NCZA 3KC3A 4WG5A 2XB7A 4HYSA 5CX9A 3FLWA 4DGGA 4DH5A 2WD1A 4KSQA 5IA2A 3BLHA 3KGAA 5TKDA 5AP1A 3PXQA 3VS6A 4YZNA 5CAQA 3I7CA 3AD5A 5ANEA 3C9WA 2ZOQA 3LXNA 4BY9E 1IR3A 1JOWB 4UYAA 2W0JA 4EK3A 5I9VA 3CE3A 3OXZA 1LUFA 4K9YA 3PVUA 2B1PA 5C8MA 3F7ZA 3I6WA 4H58A 2XKDA 4AE9A 5BNJA 2X6EA 3KRLA 4DEBA 3MJ2A 4R1YA 3RVGA 4MAOA 2WMSA 4QMLA 5H9BA 2PVKA 4QMTA 5AR2A 4U7ZA 2BIYA 4GU6A 4DITA 2HW6A 1T45A 4KS7A 1PHKA 4FTKA 3U4UA 1A9UA 4PP7A 4RG0A 1NVSA 4I5MA 4HYUA 5B0XA 4NCTA 1PXKA 3I5NA 3W2RA 2QOFA 2W7XA 2RSVA 1ZY4A 4S30A 5HKMA 4N6YA 4JG6A 3Q9WA 1YVJA 3L8PA 4O2PA 4FSTA 4WIHA 5IKWA 3EJ1A 1SVGA 4RT7A 4XV3A 5CEOA 4FKRA 2X8IA 2PVYA 3SV0A 4X6RA 4CG9A 2R7BA 4DN5A 1MUOA 3QTRA 4RJ8A 4YSMA 3V04A 4BYJA 4L01A 2JIVA 4H1MA 1UA2A 3ZUVA 4UMUA 3WYYA 3LFFA 3O71A 2OIBA 3PA5A 3POOA 3IECA 3QQGA 4MKCA 5K4IA 2JDOA 2CN5A 3V5LA 5KX8A 3PY0A 4M69A 3VS1A 2IVUA 2XA4A 1GZNA 3D0EA 3OHTA 4RLLA 4QO9A 5CU6A 4U8ZA 5GJDA 3CJFA 3OCSA 3VUIA 4DA5A 5BVWA 5FXSA 3VRYA 4BDJA 4GFMA 5IUHA 5LOHA 5CVFA 3I0OA 4U43A 4Z7GA 2CKPA 4G6OA 1UU9A 3HA8A 3ORIA 3ZRLA 2XCHA 3GFWA 2HIWA 1P2AA 3OW3A 3SQQA 3ZOSA 5HHWA 2XNOA 3E7VA 3FZRA 3NUNA 5D41A 2LGCA 3RAKA 3DOGA 3SXRA 3T3VA 4FV0A 3O7LD 4BN1A 3MI9A 3TKIA 3E87A 3E3PA 5IA3A 3TT0A 4J52A 3HA6A 3R9OA 4CQEA 2XEYA 2WELA 4GVJA 1R0EA 2YEXA 2UW3A 3A8XA 5TO8A 4GVAA 2QOKA 2BTSA 4BICA 1BI7A 3RM6A 4TWCA 3GQIA 5JFWA 4FEXA 4BBMA 1GZOA 2RIOA 2ZJWA 4I0RA 2OLCA 3EYGA 1NVRA 2RF9A 5AM6A 1OL2A 5CZIA 2VTLA 4E6DA 3QRJA 3FMMA 1HOWA 5TOZA 3UZPA 5TR6A 3O96A 4TYIA 4RRVA 1ZOGA 2OF2A 3G9LX 3FMNA 3LM5A 4OTRA 3LJ2A 5IQCA 3W32A 2UW4A 4NJDA 4R5SA 4FOCA 4LM5A 1ZMVA 1JLUE 1XH7A 4JOAA 3PG3A 3HVCA 3GQLA 2HXLA 4GIIA 4F7LA 3AD4A 4WRSA 2GNHA 1H00A 1HCKA 2ITZA 3WF8A 1Q41A 2PPQA 2Y4PA 3RTPA 4UXQA 2QO9A 4OTQA 2WTKB 3UTOA 4F0IA 3NNUA 4KB8A 4XP3A 4IC8A 1ZYDA 3CPCA 2QKRA 3DTCA 2YM5A 2YZLA 3ITZA 3NEWA 3EB0A 4O83A 1FMOE 5CNNA 4BTKA 2JBPA 2DWBA 3QD0A 4O2ZA 2UUEA 4BWXA 2EXMA 2OFVA 3T9TA 2UW6A 4UZDA 2BRHA 2JDVA 2YCFA 4R7BA 5M07A 4EOKA 3FE3A 2WMVA 4BTMA 1NXKA 5BYLA 3ID6C 3R8PA 3F9NA 3FI2A 2CNVA 5C01A 2XNPA 3QGYA 4NFNA 4RQVA 5C27A 4CMUA 3PLSA 4BDBA 2YDIA 4GFGA 1RQQA 5J8IA 5A54A 4JI9A 4NU1A 3M42A 5HGIA 5LCKA 5BUJA 3HKOA 1OIRA 4GU9A 3S4QA 2R3OA 3FL5A 2PZRA 4QMXA 3PLAE 3UE4A 4QTDA 3E64A 3PPKA 2PULA 3OBGA 3PVGA 3ELJA 4ZJIA 3V01A 5IZFA 5I9UA 4M69B 4AFEA 4AE6A 3NVMB 2PVLA 3KRXA 3U9CA 4DT8A 3R7IA 3S3IA 3A99A 2JKMA 3FPQA 3E8EA 4IZ5A 2Q0BA 4C58A 1UNHA 3FXZA 5LWNA 3MPAA 5M57A 2BDWA 1JSVA 3LMIA 3JVRA 3ORNA 2OJIA 3WI6A 4IWPA 4C3PA 4HW7A 4IDTA 4AZTA 3FHIA 5ITAA 3OVVA 2YJSA 4PWNA 3DU8A 3E5AA 1KV1A 1Q8UA 4GG7A 4DLJA 2XK8A 4AFJA 3S1HA 5CEPA 5IDNA 2OZAA 3ZEWA 4EL9A 4QMQA 5BPYA 2ITOA 4Y46A 3TUCA 4PTGA 1YI6A 4AGUA 5K5XA
chains in the Genus database with same CATH superfamily
3MVMA 4FEQA 4WHZA 4EYJA 3GC9A 3ZUTA 4UMQA 4ACDA 3CY2A 3MBLA 2Z2WA 3KULB 3E63A 1J91A 3P1AA 3IO7A 2GSFA 4Y5QA 3R7EA 4C4EA 3H9RA 4DEIA 4F6UA 4ZAUA 4R77A 4XOZA 3H9OA 3W18A 3OTUA 2ZB0A 4MYGA 5LXMA 3ZXTA 2VN9A 5IQHA 3WIKA 2PVJA 2W96B 3P86A 4F99A 4DF3A 3O0GA 4JMQA 4L52A 2WU7A 3W0PA 3FUPA 3LFBA 5EW8A 5G6VA 3U87A 1GOLA 1H1WA 3DKGA 4AA5A 4EOOA 4AQCA 4XCUA 3NIEA 3WILA 4GW8A 3Q6UA 4PP9A 1PXIA 5EI6A 4EKLA 2KULA 1YWRA 3DB6A 3GCSA 1YHWA 4DH7A 4NH1A 4W4VA 5DOSA 4YP8A 5HVYA 4JR7A 3GI3A 1H27A 1BUHA 1SYKA 2ZDTA 3I81A 5AAEA 4AGWA 4KNBA 5AAGA 2X2KA 4X2KA 1OKYA 4QTEA 5HIBA 5DWRA 4JDJA 2H8HA 3OY3A 4D58A 1YXTA 4TNDA 4MNFA 5EDRA 3PXFA 2XRWA 4J7BA 5HBEA 2P33A 1NY3A 2RKUA 4YLJA 4NEUA 2VUWA 2F9GA 4X2NA 5M44A 1LEZA 3EIDA 3JY9A 4QOXA 5C4KA 4JAIA 4UZHA 3EWHA 4IAIA 5LQFA 2WU6A 2BRBA 4M97A 2VTOA 4U40A 2BZJA 5FBNC 4LOQA 5BMMA 5L8LA 3KREA 2QO7A 3Q2JA 4GJ3A 2IZRA 3QWKA 2V5QA 1WVYA 4AN9A 3GNIB 5EFQA 4EH8A 2P2HA 5J7HA 1G5SA 3UPZA 1OPKA 3HRBA 2X7OA 4RWLA 2QU5A 1MRYA 4FT7A 5K0KA 2F2CB 4I5CA 4QMSA 2X0GA 4NW6A 3VS3A 4BDGA 5K0XA 4KS8A 2R3LA 3SC1A 3UNJA 4HCUA 3PWDA 3VBTA 3NFGB 3S0OA 4HCTA 4JG7A 2OIDA 2CDZA 1EH4A 2YN8A 2WMUA 2WOTA 3LHJA 4L3JA 5EH0A 4ITHA 4LGHA 4EOJA 5HX8A 4P5QA 1FOTA 4EOLA 3W8LA 3BL7A 1OIYA 1W82A 2C0TA 3COHA 4R5YA 4FK6A 4USDA 5ANKA 4AOIA 1VJYA 3LCKA 3SOCA 2PUIA 2BZIB 2B54A 3DBEA 4HOKA 3U6HA 4G31A 2X4FA 3FQHA 4KKGA 3VWAA 1PYXA 4FTIA 3F88A 1LP4A 2ITUA 2JBOA 4QMNA 2HY0A 5BX0A 4JL9A 3BYOA 1ST0A 1QPJA 4ANSA 4DGMA 4O7VA 4FTJA 1J7IA 4JR3A 4GUBA 4LMUA 1BL6A 2R2PA 2W1CA 5E8XA 3AGMA 3MA3A 2UZDA 5JK3A 5IQFA 3C4ZA 4EWHA 2HZ0A 3DKFA 4ZTSA 1I09A 4DYMA 2O8YA 3NAYA 2UZBA 4O4CA 3ZSGA 5ETIA 1MRVA 2BUJA 2OIQA 1DAWA 3P78A 4PNKA 4MBJA 4D55A 4YJNA 4BDIA 2PE1A 4NKAA 3VHKA 3TNIA 1NT2A 1KOAA 1BX6A 5F4NA 4PMPA 3JS2A 2UZNA 3F7WA 5FGKA 1X8BA 1XJDA 3K5VA 2VTTA 5HNGA 3QQFA 4BI0A 1BYGA 3QKKA 3WZKA 3UVPA 4O7YA 4IX4A 1W8CA 3Q9XA 2C30A 1AD5A 1W0XC 4C0TA 3LW0A 5IH5A 1J7UA 3MTLA 2E2BA 5CNOA 2PYWA 4QRCA 4JXFA 3TYKA 5J9ZA 4UWCA 3AT2A 5ANDA 3D94A 3MV5A 3LMHA 3O51A 3V5PA 2CNQA 4AXEA 4D4VA 4BDKA 4IM3A 4DEGA 2EVAA 2EXCX 4CNHA 5GIPE 1QPDA 3CTHA 3F5UA 3NZ0A 3NYXA 3DJ5A 3FI8A 2C6DA 1KE5A 4UWYA 2REIA 4ZLYA 2IW6A 3QTUA 4FBXA 4RPVA 4JRNA 4LL0A 5BMSA 3K5UA 4IZYA 2W99B 4IVAA 5E7RA 4BZNA 3WZUA 2XK4A 3L9MA 1REKA 2ZMCA 4J71A 3NCGA 5L6WL 5I9YA 3NAXA 4H1JA 4I21A 2PUPA 3C51A 5DHJA 2HYYA 3MB6A 3EN9A 4LOOA 3HAMA 5LMBA 1WVXA 1XKKA 4RJ4A 3FHRA 4QYGA 2GMXA 4J8MA 4XG2A 1ZY5A 2E9PA 2C1AA 2O63A 2WTJA 2PTKA 3CEKA 1Q3DA 1WBPA 3BU3A 3EMGA 3EL7A 2HENA 4S33A 3TKHA 2XIKA 4EH6A 1UVRA 3A4PA 3KKVA 3LLTA 5BVEA 3P7CA 4KIQA 4P90A 4ERKA 1JKKA 1UU8A 3VVHA 4K8AA 4G3CA 4MXCA 4PRJA 1OI9A 1OPJA 2FVDA 4GYIA 4WG4A 4G3EA 3ZSIA 3R9RA 2B52A 3Q9ZA 3D2KA 4EBWA 4XP2A 4H39A 3WBLA 1KE7A 4XS2A 3LFAA 5F9EA 1YXXA 2QHMA 1Y6BA 2Y6OA 5M51A 4FKSA 3QZHA 4L44A 5CF4A 3KMUA 3ZLWA 4IJ9A 3SAYA 4U45A 5FUTA 3HV4A 3NUPA 3QTWA 4U97A 5KE0A 2WXVA 1UWHA 5EOBA 4FIEA 5EHOA 2OF4A 4ENYA 5J9YA 4NM5A 3MIAA 4JDKA 2VTRA 5HX6A 2PU8A 3LFDA 5GIOE 3RK5A 1PXPA 4ZZMA 4B6LA 3GOKA 2CN8A 4C34A 2XZSA 3FEGA 3QRIA 4M84A 2NRYA 4UBAA 4C2WA 4DBNA 5A4LA 3HUBA 3UOJA 4JBVA 3IDCA 4C4HA 3MFTA 4O1OA 3M1SA 4WSYA 3VO3A 4J97A 2WEVA 5AM7A 3EQBA 4ZSGA 1OMWA 5JFSA 4NYEA 3BLQA 5CQUA 4DFBA 5EYKA 4FKJA 4ZTMA 4YTCA 3IONA 4AZSA 4DBXA 4PDYA 4Y85A 3KK8A 2JIUA 3ORMA 5FXQA 3HEGA 1O9UA 3ZSHA 3ZM9A 2ETKA 5B7VA 4OTIA 1BMKA 3UZTA 3BGZA 3AT4A 3D83A 3DCVA 4IXPA 4MF0A 3FMKA 4XHKB 4ZY6A 3TNPC 3ZZWA 3DBDA 4DGLC 2XNMA 4BDDA 5HTCA 4X2FA 2Y7JA 3COKA 3OS3A 3PXKA 4FT0A 4ALVA 4B0GA 2X1NA 3VJOA 3VHEA 1ZOEA 2ITWA 1H4LA 1MP8A 3EL8A 3PA3A 4CV9A 4Z3VA 5HVKA 3R00A 3WZJA 4YPDA 4DG0E 3OXIA 3VW6A 3ZLSA 1FPUA 1Q62A 4FEVA 2PWLA 4TWPA 4C36A 5AR7A 3NNXA 3ORPA 4ANLA 1JBPE 2R3KA 3SG8A 2PVNA 2XEZA 1OZ1A 3MIYA 3VW8A 3NUYA 4RIYA 2FSOX 2XK6A 3Q04A 3TUDA 5BVOA 3G2FA 4ALUA 1H07A 3MPTA 3POZA 4IWQA 4CTBA 3FAAA 2W05A 3VBVA 3CC6A 5DLSA 4IWOA 2YM6A 2YDJA 5C9CA 3ATSA 4EHZA 3V6RA 1CDKA 2YCRA 3UC3A 1UKHA 1ZOHA 2JLDA 2CLQA 4H36A 3ANRA 2YIWA 5EW9A 3UG1A 4G9RA 3HMOA 3AKJA 2BPMA 3ZFMA 1MQBA 4GV1A 4CVAA 2QODA 5HTIA 3SRVA 4D9UA 1TQIA 3KA0A 2VTPA 3PYYA 4IACA 4YNEA 4D2TA 4OTFA 4AQKA 5L2SA 3TJCA 3NX8A 2C5XA 4PUZA 3AGLA 4FZAB 2I0YA 3FLZA 1XR1A 4CGAA 3R7GA 4CYIA 3MY0A 5DN3A 3ROYA 3FLYA 4CYJA 1OL1A 4EH3A 5HO7A 5M08A 5HCXA 3C0IA 3NDMA 4C4JA 3BHHA 3KXXA 3QD2B 3RPSA 5M53A 4IAZA 5E8WA 5JFXA 4GK3A 5K5NA 4LRMA 2VTQA 4CSVA 5HQ0A 4O4BB 3ACKA 4AXDA 4M67A 3MDYA 5HI2A 3VF9A 5TF9A 5ACBC 2J0IA 1JQHA 2GS6A 3UNZA 2UZLA 3OXTA 2X2MA 1YQJA 4F1MA 3RAHA 4DHZA 3LQ8A 2X9FA 5JZNA 3R1NA 2VO7A 3SRVB 2GNFA 5JEBA 4GH2A 4RIWB 2JIIA 3QL8A 3NLBA 4QYEA 3C4WA 1P4FA 4LV8A 3AMYA 2F7XE 2PVHA 4OT5A 5EYMA 4DG2E 5AP7A 3FSFA 2XP2A 3R9NA 2R7IA 5ANGA 2WTVA 4IB3A 4IZ7A 3FMEA 1CM8A 4CMOA 3P5KA 4EQMA 3W1FA 2VO3A 4M7IA 1J1CA 2IVSA 5AV4A 5JGBA 5D1JA 4FKVA 5HG7A 2O2UA 1V0BA 3NYNA 4X3FA 3DJ7A 1V0OA 3RMFA 4I3ZA 1REJA 5CVHA 5IA1A 4O7WA 4PL3A 3QQUA 3H3CA 3ROCA 3QRTA 4U42A 4FUYA 4O0SA 5DMZA 1ZRZA 3FKOA 3SVVA 2JITA 1OKVA 3FKLA 3I5ZA 4M3QA 4U81A 5ANIA 4FV8A 3SKCA 4D9TA 2BKKA 4F4PA 2QURA 1ZZLA 5AP2A 3HUCA 3U54A 3IDBA 2BAQA 4I0SA 2C6IA 5FP5A 3O7LB 4B8LA 4F0GA 4FSMA 2FUMA 1W98A 5KKRC 3BHYA 2CJMA 3QGWA 5D10A 4YJPA 4ZJVA 2UV2A 2F4JA 3R04A 3PIXA 4BCPA 2J0LA 3V8SA 3QC4A 2W1GA 5IEYA 4FV1A 4IM2A 3OCTA 2PHKA 3UO5A 2OK1A 1ERKA 4M0YA 2Z60A 3HV3A 2GTNA 5IA5A 4DCAA 1H1SA 5E1EA 5M4IA 3MWUA 4B9DA 3MFRA 4PPCA 4YNOA 2WIPA 5IPJA 3A62A 3OOGA 4FIHA 2VAGA 4O0UA 3VONA 3FY0A 5HG8A 5DVRA 2P2IA 1VR2A 2CLXA 3PPJA 4E8AA 4FOBA 2JGZA 3TNWA 4YJTA 3UGCA 1Q61A 3QCQA 4ANMA 4BB4A 4DEAA 3B2TA 4BF2A 2SRCA 3NUXA 4USEA 3O8PA 5JZJA 3VBWA 3P5JC 2P3GX 3LCOA 5EQPA 4FG9A 3MVHA 1JAMA 4BIBA 4AXFA 2XVDA 4X0MA 5E8UA 4EEVA 5BVNA 5JFVA 4BTFA 1JPAA 1GIIA 4WUNA 1Q4LA 4V01A 4E6QA 2OJJA 3OTVA 4J53A 3UIUA 1LPUA 4GG5A 1WBWA 2F7EE 2ZM1A 5KBRA 3CXWA 4NFMA 1XBCA 4WUAA 4Q5HA 5LMKC 4RVTA 4O0XA 5GZ9A 3ZRKA 3EQGA 4DEEA 5HZNA 5BV3A 4NIFB 2OO8X 2R4BA 3TDVA 4BCFA 1G3NA 2JDRA 2FYSA 2VGPA 3GUBA 5KO1A 3CQUA 3QLGA 3R83A 4QQCA 5L2IA 4E4XA 3B8RA 1H0VA 4GYGA 4RWIA 3ALNA 5AUTA 4EZ7A 5IDPA 4ZLZA 3HAVA 2C5NA 2JKKA 4XV1A 5KMOA 3DDQA 3DKCA 1QL6A 2DS1A 4UEUA 5H3QA 3H30A 3RPVA 3PVBA 3IW5A 2R64A 4GEOA 4JDHA 2ITXA 1YI4A 3QHRA 4JIAA 1M2QA 2C5OA 4FT9A 2YLEA 4EH9A 2IG7A 4FIFA 2QI8A 4OUCA 4A07A 3EQCA 4EH4A 4K11A 3VNTA 3LFNA 4LGGA 3KVWA 5FP6A 4ZLOA 3NNWA 5J87A 3ZBXA 5LVNA 2QKWB 4NTSA 4YHTA 4ZS4A 2GS2A 2A1AB 5EM6A 3BELA 3NUAA 3QX2A 3TI1A 4KUJA 1H0WA 5A14A 5AAFA 4FSRA 4RIWA 2UVZA 2X6DA 5HIEA 2PE0A 4XRJA 2WMBA 3LQ5A 3F2RA 1MRUA 4U3YA 4H05A 3TZ9A 2CCHA 2RG6A 2E9NA 3EZRA 4RVLA 3UG2A 2VWYA 5FM3A 3A7GA 2Y4IB 4UV0A 1WZYA 3FLQA 3U51A 3LOKA 2YIRA 3E62A 3P0MA 5EDPA 3D7TB 4OTDA 3P7AA 4YJOA 3TMOA 4X3FB 2CKQA 5FRIA 4JQ7A 1Q8ZA 2X0OA 5CYIA 3W0SA 5T68A 4WNMA 4QP8A 3ORXA 4YBKA 4ANQA 4R8QA 2IZSA 4WNPA 4L45A 4BDCA 1Y57A 4F1TA 5AWMA 4FKGA 3ZLYA 2WIHA 4IAFA 3HL7A 3P7BA 3R8VA 4J98A 4NWMA 4O82A 3QZIA 4Y83A 3Q52A 5AP5A 1YKRA 2HCKA 1UKIA 5KZIA 4ANNA 2VWIA 4R7IA 1WAKA 1L3RE 5IMXA 3TUBA 4FSQA 4CLJA 4BCKA 4JIKA 3BHVA 4JT3A 2Z7SA 2XIYA 4HZRA 4RWKA 1FVTA 3TG1A 3G9NA 5JQ8A 3D7TA 4O38A 3O23A 4QD6A 1BLXA 3KF7A 4WA9A 2FB8A 3BYSA 3EFWA 4CFWA 4ZJJA 3CPBA 1H01A 4QQJA 2H6DA 5F95A 3R8MA 4D5KA 1W84A 3MH3A 1K2PA 3ENHA 3BLAA 3ZS5A 2PZYA 3GOPA 3FQSA 3AMAA 4LG4A 2WQMA 4LV5A 5DRDA 5L8KA 4DTBA 3LCTA 4XBUA 4DDGA 2YERA 4CKJA 4O6EA 5AR8A 5IMEA 2VU3A 1JNKA 4TWOA 4F6WA 2G01A 1U54B 5AA8A 3ZH8A 4DFXE 4A9UA 3DFAA 5AP4A 2CHLA 2J6MA 2OI4X 2QD9A 3C13A 4XOYA 4DGOA 1ND4A 5KUPA 3W10A 3OZ6A 2JDSA 3FBVA 4C57A 4CLIA 2C5YA 2UZTA 4FT5A 5DEYA 1ZYJA 3AC1A 3BEGA 5E91A 4BWPA 5FTOA 3D5XA 4WOVA 4LYNA 2XJ2A 1BKXA 2OZOA 4RC4A 3COIA 4RGJA 4TZRA 3CKWA 4M13A 2QR7A 4AAYA 2VTMA 4G3DA 4EK4A 2EXEA 2ZV7A 3DQWA 3P79A 4D1XA 2EB2A 5LMKA 2XS0A 4BCQA 4L7FA 1G8AA 4DHIB 3BPRA 4JQEA 2NYAA 3GU4A 4D28A 1F5QA 4WBOA 4D2WA 3E8CA 5JRSA 1CTPE 1AGWA 5H8BA 3HV7A 2NNWB 2I40A 5J95A 1XQZA 4KA3A 1YXSA 5LWMA 4F9CA 2IVVA 3U4WA 5EM8A 5DI1A 4OR5A 2IZUA 4TWNA 5L3AA 4KABA 3KXGA 4L68A 4KIKA 3KXZA 4RBLA 5FQDC 3V8WA 4A4XA 3CD3A 4V05A 4UALA 4G17A 5J1VA 1TZDA 2JDTA 2W4OA 5HD4A 1YHVA 4E7WA 2C3KA 4IB0A 2PUNA 3BE2A 2ZDUA 5CS6A 1U5QA 3L1SA 3ZDUA 4FZDB 4FKLA 4IC7A 3D2IA 4MXAA 4R3PA 3GP0A 2I7QA 2I0HA 2J0JA 4YJVA 4BCJA 2PMLX 3A7HA 4G3FA 2O5KA 2ITQA 3CR0A 5A4EA 3PWYA 1S9IA 2B7AA 4QP1A 4EONA 4KWPA 1FGKA 3RHKA 1MQ4A 3PUPA 1IA9A 3BBWA 3N4UA 4OBQA 4YTIA 1YOLA 3NW6A 4IB1A 3UODA 4A9TA 4LV7A 3PSCA 4O4DA 4X3FC 4PF4A 2WTIA 4XEYA 4YZ9A 1M2PA 3EQFA 4FKTA 4RIOA 4XNEA 3R01A 4KIKB 3TEIA 3KN6A 4K18A 5FDPA 3QQHA 2ZM4A 3QWJA 4OW8A 1CKIA 3PIZA 5L6OA 5DH3A 4TYJA 1YDSE 4O1PA 3EQHA 3VUMA 5AJQA 3VAPA 4CXAA 4D1ZA 2XAMA 2GDOA 3DTWA 5JRQA 4NTTA 5JGDA 2E9OA 2XM8A 3W2QA 4FNZA 3AG9A 4Y5HA 1BL7A 2EB3A 5CF5A 4QMZA 3BWJA 3A4OX 2XBJA 3CGFA 3EKNA 3E8DA 3H0ZA 4Y73A 1ZYSA 3MB7A 3ZO2A 2UZWE 3WZEA 4FEWA 1Q8TA 4L00A 2CSNA 4AUAA 4DTKA 4NT4A 3SOAA 4FR4A 3A61A 2VWZA 2BFYA 3EYHA 4QMWA 3N9XA 4U79A 3TXOA 3PIYA 4BWKA 2X7FA 4O7ZA 4G6NA 4O86A 3R7VA 3TTIA 2WTDA 1NVQA 3EN4A 3TV7A 1CKJA 2VX0A 2DYLA 1GZ8A 3LE6A 3VS0A 3MESA 5IQGA 3Q6WA 3IW6A 2XMYA 1U59A 4FGBA 2YCSA 2DQ7X 4II5A 4WBBB 2J5EA 2YM4A 2CKEA 4IJPA 4QP2A 1QPEA 4IAYA 2OJGA 2RFDA 2PVRA 4OTGA 4FSNA 4CFUA 4PMMA 4E20A 5E9EA 3REPA 3ATTA 3Q4UA 3SGCA 2RFSA 4RA4A 4XMOA 4QQTA 3N4TA 1RDQE 4YZCA 4XG8A 5L2WA 5B2KA 5KCVA 4IW0A 3FMLA 1A48A 5HIDA 3ALOA 3PXRA 2BTRA 2ERZE 3Q2MA 4FV6A 5DFPA 5FM2A 1GAGA 1FQ1B 3HZTA 2C69A 4YR8A 4KSPA 2XNGA 4WRGA 4YGAA 3R9HA 4IVDA 4FL1A 5DR2A 5FG8A 1WCCA 2CNUA 2VTSA 4BJJB 3D7ZA 4CQGA 5IA4A 3CGOA 5GNKA 5EM7A 3V5JA 4FTAA 2WMRA 3HDMA 4HGTA 3PJ2A 2WEIA 2PMNX 2F2UA 3RWPA 4NM0A 4FKQA 3RM7A 4P5ZA 4J1RA 3EQIA 4RLKA 5BVDA 2JKOA 4MEDA 3ZC5A 4GSBA 5IQAA 1Y8YA 3QX4A 3UP7A 3MH2A 5AR4A 3QD3A 3FZPA 5AP3A 1SVHA 2B9HA 2YIQA 4W4WA 3SW4A 4DLIA 3QF9A 4JS8A 4UMTA 5HE1A 3BGPA 4I23A 4CV8A 4BIEA 4EYMA 3UIXA 3Q32A 3UIMA 4TNBA 4AXCA 4G34A 4F6SA 3KXHA 3QXOA 3IOKA 5CWZA 3RK7A 4E4MA 4EOIA 5CU2A 2IF8A 4FGRA 4CG8A 3S00A 2ZB1A 2XNNA 4R3CA 2IN6A 2UW8A 4O6LA 2YDKA 4JNWA 4HNIA 2PVFA 3OC1A 4EH7A 3FSKA 4NKSA 4ZTQA 4UMPA 1LR4A 2BRNA 1TQMA 4WG3A 2O3PA 3FZSA 2WB8A 2Z7QA 3MVJA 2C47A 4E1ZA 2C3JA 5AFVA 4BFMA 3MS9A 1PMVA 2X8EA 2QOQA 4FZ7A 3QCYA 1APME 4M15A 4QYHA 2HXQA 4RIXA 3RGFA 1PMEA 3Q4ZA 2BKZA 4TYGA 2Z7RA 3GCVA 3C5UA 2VWUA 3EKKA 4IADA 4OTPA 3BKBA 3W2CA 5CI7A 3DLZA 5CAVA 1OVEA 4PMTA 2ETRA 3GC8A 3AKKA 4L7SA 2GPHA 3ZXZA 1WBVA 5J79A 4APCA 1GIHA 4IWDA 5FWKK 3VUTA 3AQVA 3QYWA 3TNQB 5IQBA 2YLFA 4I4EA 2BALA 3F5GA 4IH8A 4CCBA 4TY1A 4F65A 1OM1A 3HV6A 2WTKC 4N70A 1XH5A 3FYJX 4JG8A 5EHLA 3OWPA 3F66A 2OG8A 4ZP5A 3BV2A 5D11A 1WFCA 3RNIA 2BILB 4I24A 4QP7A 4LRKA 3PFYA 1PMUA 2R0UA 3KQ7A 3M2WA 4OTHA 2PSQA 3EN7A 5CT7A 3ZCLA 4EI4A 3NYVA 3IK3A 5I9XA 4QTBA 2X7GA 4UYNA 4AAAA 4MNEB 3DDPA 3FC1X 1T46A 1UNGA 2B9JA 3I6UA 4I22A 2PE2A 4YBJA 5HLPA 3KU2A 4EK6A 4YMJA 2XK3A 4FTRA 2XNBA 4DFLA 3ZUUA 4FKIA 2H96A 4X2JA 2OU7A 1QCFA 4YUQA 4H3QA 4IVCA 5CVGA 4YTFA 5KMNA 4D0WA 1ZARA 2QG7A 3UZRA 2ZM3A 5E90A 5KNJA 4FSYA 1OL6A 4IANA 2GHMA 4RC2A 5H2UA 3ET7A 3DLSA 5CXZA 3OMVA 1O6KA 4AZFA 3VS7A 4ZEGA 4AZEA 4BKYA 4MBLA 3PJ8A 3ZM4A 4EQCA 2NP8A 2W5BA 3OW4A 2W1HA 4PPBA 1JSTA 5ETFA 3LQ3A 4KKHA 2XIZA 3VUGA 4A4OA 2JKQA 1NW1A 4QP3A 3R8UA 3SXSA 3OG7A 4JBQA 3SXFA 3V8TA 4EBVA 5E1SA 2PZIA 5AUYA 4ASXA 4EOQA 1OKWA 5CU0A 3VUDA 3COMA 5L4QA 5CSXA 4B8MA 5ETAA 3F3TA 2VNWA 3GCQA 2GHGA 2ZV8A 5C26A 3H4JA 3QQLA 1I44A 3DNEA 2J2IB 3UJGA 5BUEA 3BEAA 4XBRA 4YLKA 4RJ7A 5EM5A 3PE2A 1PMNA 2XJ0A 4ORKA 1XWSA 1RJBA 3A2CA 4ZMEA 5E8TA 5IUGA 1YRPA 3K2LA 4QMYA 4YJRA 5DPVA 4OBOA 5HE2A 2YAAA 3O2MA 4DHJA 4ZS0A 3SD0A 2IW9A 4AACA 2HZNA 5LVMA 1M17A 3QTSA 3KL8A 3GEQA 4DH3A 4H3BA 4PDSA 2W1FA 2DUVA 3MA6A 2CGWA 4QNYA 4EZ3A 5IH6A 4AZVA 5KKRB 3LZBA 5GZAA 3S2PA 4G3GA 3L9LA 3LAUA 4O22A 4Q5EA 5HCYA 3IW4A 5BQ0A 5M4FA 4GUEA 2VV9A 1XH6A 1XBAA 3Q5IA 3UOLA 3DV3A 1FMKA 1W2FA 3DZOA 4FNWA 3B8QA 4RIYB 3SX9A 1P4OA 4AOTA 4M0ZA 4FICA 3UP2A 4RFYA 4HGLA 2BZHB 2XIXA 1B39A 2Y0AA 3DAKA 4IHPA 5CSWA 3VS5A 5CAPA 2B53A 4FK3A 4GL9A 4ID7A 3BZ3A 4QYFA 4YPSA 4BJJA 1OGUA 1H8FA 3O50A 4XP0A 1XH9A 3BQRA 4BZOA 3GC0A 3V5WA 5HE3A 4FL3A 5F20A 4IB5A 4AA4A 1U46A 4CFMA 2XKFA 4L8MA 2EWAA 3G90X 3OT3A 4QDEA 2LAVA 4AW0A 2OBJA 3MY1A 5A4CA 3P4KA 4G1WA 4ZSJA 3UO4A 2BVAA 2E9UA 3H0YA 4GFOA 1R39A 2UZEA 4IX3A 5EI2A 4QP4A 5T3QA 3JYAA 4Q9ZA 4N6ZA 4QEBA 3C5IA 2C6TA 2F49A 3PTGA 3OD6X 4A7CA 4UXLA 1DM2A 1IG1A 3NWWA 4ZOGA 4DH8A 2PZ5A 3QA8A 2WPAA 4G5PA 3SDJA 1XH8A 4RWJA 4BL1A 3OOMA 1E9HA 4G5JA 3ZO1A 4PDPA 4RX7A 5I3OA 4L67A 4J95A 1VZOA 5CSHA 4K2RA 1PXOA 4U44A 3OWLA 4JBOA 3VUHA 4A9RA 4RZWA 4AA0A 4AT5A 3RWQA 4QNAA 3LFSA 4X3JA 4TYHA 3P23A 4D2SA 3QQKA 4Y8DA 3DFCB 3TL8A 4FVPA 2YITA 3D4QA 2V7AA 4HNFA 4AN3A 5A6NA 4LFIA 2NPQA 4A06A 3HECA 4C35A 1VYWA 4QPAA 4ERWA 1VLRA 2E9VA 3ORKA 3OT8A 2ZMDA 1OECA 2OW3A 3PXYA 3QCSA 5J5SA 3VULA 4D2RA 1FVVA 2CGVA 3D5UA 3RP9A 1Y91A 3BV3A 3FJQE 1WBSA 3LCDA 3FPMA 5AV3A 3NUUA 5AX9A 3VC4A 4ASDA 2PY3A 3HMNA 5HICA 4DH1A 4LOPA 3KCFA 2W4KA 3CBLA 3UIBA 3JR1A 2QO2A 3FL4A 4HYHA 4PV0A 4BTJA 2ITNA 4ZSEA 3IW8A 5EI8A 4AGCA 3E7OA 4EH2A 4MXYA 4F08A 3LXLA 2R3MA 3BU5A 1U54A 3ODZX 4HCVA 4IBMA 4AN2A 4A9SA 3PXZA 2O0UA 3HMMA 4PX6A 4BYIA 5AUZA 1QPCA 4PNIA 4CT1A 4BRXA 4CTCA 5I9WA 1JVPP 4IX6A 3O5AA 2OSCA 1WBOA 4CRLA 5BVFA 1H1QA 3MYGA 3R21A 4FRFA 3CP9A 3BWFA 3UVQA 4EK5A 1UNLA 3L8XA 3PPZA 4XG6A 4ASEA 4FTNA 4I6LA 3DXQA 3FMJA 2GHLA 5HE0A 4O7LA 5E8ZA 5HO6A 4C59A 1FGIA 5AX3A 1PXLA 4J8NA 4AG8A 3QTQA 1TQPA 4UMRA 3R1SA 2YM8A 3MJ1A 2A0CX 4U5JA 5CTPA 3ERKA 4BDHA 5KMKA 4FTMA 1F0QA 2C68A 4RX9A 3W2SA 5I0BA 3WYXA 4MD7E 4FE2A 2CKOA 4EJNA 3GU7A 3TDWA 4HVIA 3PSBA 2NRUA 3Q9YA 3VJNA 4ENXA 2XF0A 5EQYA 4NJ3A 3UO6A 1H08A 3NGAA 4RVMA 3TWJA 3KXMA 2QG5A 4G16A 1E1VA 4GRBA 4HPTE 2XALA 4YSJA 4QMPA 3PSDA 4K6ZA 4BHZA 3DXPA 2Y6MA 4F70A 4O27B 2C5VA 2G2FA 2GNIA 4ITJA 3U55A 3A7JA 4XRLA 5DE2A