2RGPA

Structure of egfr in complex with hydrazone, a potent dual inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
315
structure length
284
Chain Sequence
ALLRILKETEFKKIKVLGSGAFGTVYKGLWIPVKIPVAIKELRKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMNFYRALMDVVDADEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title 4-Amino-6-arylamino-pyrimidine-5-carbaldehyde hydrazones as potent ErbB-2/EGFR dual kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 284
sequence length 315
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2rgpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2rgpA01
1O6YA 4YP8A 3EMGA 3H0YA 4DEEA 3QQJA 3S4QA 3RZBA 4O82A 4IAAA 3FMLA 3L1SA 4IZ7A 3EJ1A 3Q5ZA 1M52A 3MYGA 4JDJA 1H1WA 2YLEA 3GFWA 5CYIA 3SDJA 3ZHPC 3Q4TA 3FSKA 4XG2A 4XLVA 4FTLA 2J7TA 2Y4IB 3QLFA 5AP4A 1Y6BA 4EK5A 4ZTQA 4E6AA 2QKRA 4IZ5A 3OXZA 5M4FA 2WTWA 4QQ5A 1FOTA 2Z7LA 4NFMA 3UE4A 3UC4A 5M07A 1ZYJA 4EK4A 3EH9A 1IA9A 3OROA 4QP6A 2E9PA 2PZIA 4IVBA 4TN6A 5KNJA 5CVHA 3WE8A 3ZFYA 2O3PA 2UZBA 3TWJA 4I5CA 1OVEA 3MVJA 4FA2A 4GL9A 4JX3A 4NW5A 2X4FA 3TJDA 5AFVA 3K5VA 1NVRA 4FODA 3DBEA 5IPJA 5AUYA 2XKEA 2RFSA 2YM6A 4KB8A 2C3JA 3DOGA 2C68A 3R1NA 2CGUA 3R8VA 3HAMA 2WTDA 4KINA 3PTGA 4U45A 2GNGA 5DBXA 4QYEA 3RINA 4FTOA 3WF7A 2XJ2A 2C6LA 2OIQA 3G0FA 3E64A 4ZSLA 2XNMA 3NIEA 4EYJA 1P14A 2R4BA 4LOOA 3RZFA 2PU8A 5DMZA 2VTSA 4S31A 5T68A 3G9NA 5KUPA 2R3IA 4N70A 5DA3A 5J9ZA 4NCTA 3BEAA 4FTRA 4ZSGA 5FWKK 5M4IA 4CMOA 2G15A 3QZHA 3ZDUA 4Q5EA 2PVLA 5B2LA 3EYHA 1PXJA 1PXKA 1PXIA 1UV5A 2WB8A 3Q32A 3QHWA 3VW8A 3DXPA 3COKA 4UB7A 2PY3A 4M14A 2UW9A 3EZVA 4YLLA 4CQEA 3FQHA 3LFBA 2C47A 2B9HA 4KBKA 1G8SA 4XJ0A 3Q04A 1JAMA 2R2PA 4BZOA 5EHYA 4CKJA 1P5EA 5AJQA 5L4QA 4DTAA 2WEIA 2W0JA 4LQMA 2R7IA 4Y85A 4DF3A 4FSUA 4IB3A 3LHJA 5KKRB 5D41A 5D12A 1FVTA 2XNBA 1R39A 3MPAA 5EK7A 3RBWA 4ACMA 1ZY4A 2C30A 4QO9A 3D83A 2SRCA 3E3PA 4RT7A 2VN9A 1FVRA 3COMA 5E8YA 1LEWA 2O63A 3CKWA 4BB4A 1WVXA 5M56A 4IB1A 4AFEA 5IMEA 3NUAA 2BALA 2GS2A 4ALWA 4V05A 2NPQA 5FLFA 3BRBA 3D5VA 2QOQA 4WUAA 3TUDA 3NW7A 4YC3A 4I92A 3FC2A 4AW5A 4A7CA 2X2KA 2XKCA 4NIFB 4RX5A 3ATTA 2ZAZA 3AMYA 4FEWA 2ESMA 3MPMA 4HW7A 2J6MA 4O7SA 2OZAA 3MESA 4JDIA 4FGRA 4DG2E 2XRUA 3QRTA 3ELJA 3TTIA 4UWBA 4CFXA 3RPRA 4HGLA 4C58A 4C4EA 3PXRA 2RFDA 2QI8A 2E9UA 2XF0A 4J52A 5FDXA 2JAMA 3V5PA 4UZDA 4X2FA 1OL2A 1ZYDA 4D2PA 3GCVA 1IA8A 4GRBA 5IQCA 4BN1A 2YISA 3FMJA 4LYNA 5CZIA 3DTCA 3MVMA 2YERA 5AIKA 2GHMA 4WNKA 1H1RA 4E6CA 4GSBA 3AC2A 3QX2A 2UZDA 3V5TA 2CKOA 4ZSAA 2QOOA 3OWLA 5ANIA 3KREA 3UOHA 1IR3A 5ETAA 5GINE 1KOBA 2GNIA 4GUEA 3WBLA 3DBQA 3R04A 4N57A 2OFUA 4RVMA 2C5VA 5KMMA 1OITA 4O96A 3F2RA 3U4WA 3W2QA 4DGMA 4I4FA 5AUXA 4NUSA 4I23A 2JLDA 3BQCA 3Q6UA 4G6NA 3BX5A 1OL1A 4QMQA 5A6OA 2UZUE 2PPQA 4YJPA 1F5QA 1XR1A 4M13A 4FG7A 3LCKA 5I9UA 3TN8A 3WZUA 4YUQA 2XRWA 3OTUA 3G5DA 1PXOA 3JS2A 3E92A 5A4CA 3PXKA 1JBPE 1I09A 1JNKA 2JKKA 3F5XA 4APCA 3RKBA 2A19B 2OLCA 3EQDA 3SHEA 1QPJA 3GC8A 4WNOA 4EH4A 3HA8A 2RG5A 3V8TA 4FX3A 1OBGA 3HV7A 5EYCA 1H1PA 3BIZA 1W7HA 3IKAA 3L8VA 4IM3A 4PNKA 3EL7A 3KXXA 3PIXA 4QMUA 4AW2A 3CQWA 5JQ5A 5HHWA 5JRQA 2X39A 1WBPA 2C5YA 2WMUA 1A9UA 3P9JA 3QD2B 3QA8A 3UC3A 3ZSIA 3MA6A 2YZLA 4FL1A 5HU3A 3QZIA 5EI8A 1Q5KA 4A4XA 2HCKA 5C1QB 2VTQA 3GGFA 5HI2A 2WHBA 3D5UA 2VWUA 3LCDA 4C02A 1GIIA 1IRKA 4M69A 5FG8A 4FR4A 3UIMA 1X8BA 2VWXA 3WE4A 2OXXA 4CV8A 4H39A 4FIGA 4D4SA 1TQIA 2WMWA 4TWPA 4RQVA 1ZLTA 4OT5A 2IVTA 3MH1A 4U40A 5DVRA 3VIDA 4XEYA 3TZ9A 1PKDA 3PVUA 3ZONA 4F4PA 3DKFA 4O83A 3ULZA 1SZMA 4MH7A 3FKLA 4AZEA 2IVSA 3PP1A 1Z5MA 3FXXA 1OL7A 3Q2MA 1DM2A 2JBPA 3U6IA 1J91A 2Y4IC 4EHVA 4DE4A 1DS5A 2WTIA 4FVPA 3ACJA 2W4JA 4W9WA 1OKZA 4EQCA 2R3RA 4EZ5A 3OHTA 3S0OA 4HJOA 1Q3DA 1PXMA 2ZM4A 3G33A 2JD5A 1WBNA 4OBPA 2GTNA 2ZV7A 4XCUA 3T8OA 3FI8A 4DFBA 2PHKA 3TNWA 3WZJA 4Q9SA 3IECA 3PY1A 3Q4ZA 5HBJA 2ZYBA 5IUIA 4NKSA 2C69A 3VBQA 1CKJA 2YHVA 3KN5A 4BDFA 4D2SA 1ZOEA 3EQCA 5M57A 1H25A 2X9EA 1OL6A 3M1SA 4MD8E 2YAKA 4X0MA 4EKLA 4IFCA 4TYHB 1FGIA 4USDA 5DEYA 3E8NA 4RRVA 4U41A 5E1SA 5F9EA 1H8FA 3OOGA 4HYHA 5H8BA 3BYMA 3L8XA 5EOBA 2R3FA 4FKGA 4IQ6A 2OIDA 2Y7JA 3I1AA 4QMWA 4WOVA 4EQUA 5EW8A 2X81A 4E6QA 3DY7A 2J90A 5E8WA 2WMVA 2QD9A 3PXYA 1H27A 1SVEA 1WCCA 3Q4UA 3QYZA 4M67A 3LCTA 2YIYA 5TR6A 3UIBA 3I0QA 3LFNA 4U9AA 2GQSA 3ANQA 2JDSA 5HORA 3CTQA 5T3QA 5LXMA 4JVGA 3G15A 2JFMA 3VUIA 1Q99A 3FAAA 3BEGA 3ZEPA 3E87A 4AOTA 5L2QA 3TZMA 3CCNA 3KVXA 3O7LD 4D4VA 4MD9E 3GUBA 3DK6A 4DC2A 4HCTA 3PZHA 4BDDA 4BTKA 2GNHA 1NXKA 4I41A 2XK7A 3MA3A 3FL5A 3TKIA 4YSMA 2NRYA 4EH7A 4I93A 5HCZA 4V04A 3IG7A 3IONA 4BI0A 5IH6A 2J9MA 4O1OA 2R3HA 3II5A 3FY0A 5HNGA 4XG4A 2XCKA 3WARA 5KMKA 2CNUA 5DI1A 4C61A 5KKRC 5HEZA 3UIXA 5IH5A 4FIIA 4TWNA 4D58A 4C38A 3EB0A 2OH0E 1YXVA 2HWPA 3LXPA 3PSBA 3E8DA 2O8YA 3Q5IA 1FGKA 5EW3A 4P5QA 4QMPA 3VWAA 3TZ7A 4FIEA 1CKIA 3PVWA 3WOWA 3NW6A 3KCFA 3TT0A 5EM5A 3QCYA 4QQJA 5IA2A 3F3WA 3R63A 2BMCA 4I3ZA 2QVSE 3E8CA 4FVQA 3UPZA 2OF2A 5BYLA 3GQIA 4WSQA 4ASDA 1Q8UA 3VC4A 1YXUA 5J95A 5D10A 1JKKA 1YOJA 3OY3A 4GYGA 4QNAA 5CWZA 4ZZNA 3QUPA 3MW1A 5FUTA 2CMWA 4RA4A 4AOJA 2P33A 4V0GB 3UZPA 2CNQA 3O51A 2UZTA 5IEYA 3Q9ZA 3NUYA 3VUKA 3P86A 3QD4A 4QP7A 4AUAA 1JKSA 1RDQE 3DJ5A 3PLSA 3RK7A 5CAQA 1KE6A 4GH2A 4CCUA 2QOKA 3UO4A 3H9RA 4O22A 3QTXA 4L43A 3DCVA 4I1ZA 5F95A 1OKWA 2F7ZE 3F2NA 5LMAA 1R0EA 3EN6A 3R2BA 2XK8A 4IJ9A 1Q8TA 2I0VA 4XV3A 4BHZA 1S9IA 2ONLA 4K18A 4AA0A 3MN3A 5E8VA 4QTAA 4BCOA 4D2TA 4O91A 4YMJA 3NWWA 2BHEA 4ZS0A 3NVMB 4MAOA 2UZLA 3L8PA 4JAJA 3QRIA 4W4XA 1ZOHA 4WBBB 1YDTE 4K11A 4RLKA 4UWCA 4RMZA 3Q9XA 1YRPA 2BAQA 2ZJWA 1GZKA 3EFKA 3F69A 4ERWA 4X3FA 3NNVA 4GFMA 3CKXA 4CZTA 4BVUA 3ZM9A 4QPAA 3AD6A 3GCPA 2CN8A 3OW3A 2XYUA 3C0GA 4IZYA 4H36A 2QODA 4C4JA 4FSYA 3U6JA 5DNRA 3QL8A 1KUTA 2ITVA 4AW0A 3HP5A 3E88A 1PXNA 3ZU7A 3VVHA 5IG1A 3AC5A 3SOCA 1KE5A 1J7IA 2VNWA 4YJUA 4BZDA 5CZHA 2ZM3A 3W55A 2C6TA 3N4VA 2F2CB 4TXCA 2AYPA 2Y9QA 2VV9A 4QYHA 4DGNA 3HGKA 4M0YA 3R8LA 4L53A 2BAJA 3RI1A 4FKUA 1KWPA 2EWAA 3Q2JA 4AFJA 2WMAA 4A07A 2RF9A 3PSCA 2C3IB 4YJOA 3HV5A 4CCBA 1QL6A 2H34A 4ZJIA 4MXCA 3EKKA 4R6VA 1O9UA 4F0FA 2OW3A 5JRSA 2XNGA 1ERKA 2ITTA 4FIJA 3FSFA 5IH4A 5CU3A 4FV1A 3KMUA 2VTHA 1LR4A 2RFNA 2OO8X 3OC1A 3QQFA 2ZM1A 3D15A 4R3PA 1HOWA 2VTRA 4G1WA 4RIYA 4LGDA 2ZV2A 4KSPA 1SM2A 3PSDA 2V7AA 2CDZA 3TUBA 3FLQA 3F7ZA 4CFNA 4UZHA 3VHEA 1MUOA 4E8AA 4DH5A 4QQTA 3CQUA 2Z60A 2R3JA 4OBOA 3EN9A 4XP2A 4S2ZA 2OI4X 5HE0A 3R01A 5L6PA 3F3UA 4G6LA 4RC4A 2C6KA 3S00A 3OTVA 3IW6A 5AX3A 3UJGA 4I4EA 2XUUA 5BVFA 5M53A 3CTHA 3KRRA 2UW0A 4E4MA 1OUKA 3QD3A 3OD6X 3QALE 3ZRKA 4C36A 4RX8A 3MFRA 2NO3A 3BBTB 2O5KA 3RAHA 5HD7A 5KZIA 4U44A 4J8MA 1P4FA 3WF6A 3UMWA 3CTJA 5A4QA 3C51A 3HEGA 4Y8DA 1WAKA 2CNVA 3BYOA 4FBXA 2J0KA 4TWOA 1ZMWA 1UVRA 4AN2A 3GCSA 1UU8A 3E3BX 5K0KA 3RTPA 3V5WA 4EK6A 3OT8A 4K6ZA 4J96A 1JSVA 3O7LB 3HRFA 5TT7A 5LMKC 4RJ5A 1ZARA 3BHTA 3AT3A 3WZKA 2X7OA 3OWJA 5K5NA 4YHJA 3UP7A 3UBDA 4OAVB 1SVGA 5HICA 1YOMA 3HUCA 1E1XA 2JDOA 5HVYA 5H8GA 4BWKA 1XBAA 4UMQA 3ATSA 1FINA 3BKBA 3RAWA 3SLSA 1OUYA 3UQGA 5L6OA 4Z7HA 5JGBA 4WHZA 3EL8A 5ANJA 4JXFA 3RPOA 1JWHA 2WTCA 3OF0A 1BKXA 3M42A 3E93A 4KRCA 1R78A 4RG0A 5HCYA 4A06A 4AS0A 2B1PA 3LMGA 3A8WA 3UZTA 4ZP5A 3FHRA 4LUDA 3CJGA 3BLRA 1UU3A 3W33A 4DLJA 2Q83A 1BX6A 4U81A 5DLSA 3LFFA 4O7ZA 3U87A 3FPQA 1GZ8A 4JR7A 3ZO4A 4C4IA 4DTBA 2PUIA 3E7OA 1B39A 5KHWA 1JSTA 2QOCA 2EB3A 4FK3A 4MNFA 2QU6A 4XUFA 3R8ZA 3P78A 3CD3A 2HK5A 3NIZA 2HZ4A 4R7BA 3VN9A 3MJ2A 4PP7A 5BYYA 1M7QA 3O0GA 5K4JA 3VS6A 2NP8A 5CEOA 4MXZA 1J7LA 1B38A 5KBQA 5FEQA 2QOIA 3MY1A 3FXZA 3REPA 3SG9A 4RVTA 2A27A 4G5JA 3ZXZA 1CKPA 2WGJA 2BRMA 3PA3A 3QQLA 2R7BA 5FGKA 4BDJA 4KA3A 4EWQA 4YJNA 3IW4A 2JKQA 1A48A 2E9NA 3VNTA 4AQCA 4WT6A 2OICA 3ALOA 4L44A 4XP3A 4BTJA 1M2QA 4WG5A 2A1AB 4FSQA 4M97A 3ZUUA 4MNEB 4X2NA 2BPMA 4Z7GA 4RBLA 2FSMX 4EOQA 5GIOE 2F2UA 4G3CA 3A7IA 3BYSA 4QP4A 5AM6A 3V51A 3IDCA 4ZTSA 2QU5A 3R8MA 4MQ1A 2WMBA 3MH0A 3EQFA 4YNEA 4YR8A 3HKOA 3CY3A 3KULB 4YC8A 4EOPA 2DS1A 2WMXA 3GU6A 2ETMA 4PDOA 5BVDA 4Y5QA 4E3CA 4ZTRA 4JRVA 3NUSA 3O71A 3H0ZA 1Q8ZA 5ANEA 3V01A 3RCJA 2X2MA 3T9IA 2EU9A 4EOIA 4G3DA 5AR5A 4EZ7A 2YITA 2RL5A 3LLAA 3SXRA 2OSCA 1ZZ2A 1UNGA 4DG3E 5E1EA 4ITJA 4BDEA 3LFCA 3NYXA 2ACXA 3VO3A 1XO2B 3AC8A 4JRNA 2WIHA 4A4OA 4F9AA 4JG7A 3QQKA 5A3XA 3D5XA 4BBMA 3VUHA 3TUCA 3FL4A 1GIJA 4LRMA 4DH1A 1OL5A 4ZZMA 2FYSA 5FXQA 3O2MA 4X21A 4XRJA 1V1KA 3E7VA 3OEFX 4PWNA 5GZ8A 2QKWB 4O86A 4DN5A 2PZ5A 2QR8A 2YM4A 4OTQA 1O6LA 2LGCA 1OIRA 2XVDA 4DEGA 3OWKA 3R7UA 5JFWA 5HESA 3MBLA 2GNLA 5KO1A 2ZDUA 3MDYA 5EKOA 5HIEA 2C6OA 5HVJA 4M3QA 1GZOA 4R3RA 4Q9ZA 5FXRA 4W8DA 4R3CA 3VQHA 2W1CA 3FQSA 3CGOA 3NUUA 4IVAA 3JY0A 4RFYA 2XIZA 5AR7A 4QD6A 3EFWA 3DFAA 3FI3A 2PVNA 3UVQA 4G16A 4E26A 2QG5A 4JQEA 4BKYA 3MFTA 5HE3A 4RX7A 4CLJA 2F9GA 2W4KA 2WXVA 4AZFA 3BGZA 3NPCA 4RPVA 2V55A 4QPMA 3FJQE 4Y95A 3O23A 4KIKB 4FT0A 3R6XA 5ANOA 2PZYA 2GTMA 3R2YA 2Y6OA 5D1JA 4UXLA 1URCA 1XQZA 1LUFA 5AR8A 3QF9A 5GHVA 3VHKA 4ANOA 1XH8A 4YZNA 3T9TA 4BI1A 4C8BA 5KMLA 4H1MA 5I9WA 2R0IA 4O7VA 4NEUA 3CLYA 3EFLA 3R9NA 2WEVA 2I0EA 2B9IA 4GMYA 4LFIA 4L67A 4O6EA 5AP2A 4MVFA 2F49A 4FV7A 5DRDA 4DGLC 3NEWA 4GVJA 3RNYA 4JJRA 2Y0AA 3D4QA 2PMNX 4YSJA 3QYWA 2PVMA 2BKKA 2PTKA 2YWVA 4EOOA 3AXWA 2VRXA 3I7BA 4JX7A 5L3AA 1WBVA 2XBAA 5DR9A 2WTKC 5ETFA 1OIYA 3E5AA 4PRJA 2GNFA 4WD5A 5IQDA 2YACA 2X2LA 5DPVA 4CGAA 3G6GA 1Q3WA 4JDHA 2HYYA 2XM9A 2UVZA 2W5HA 4LL0A 4U8ZA 4MK0A 4RVLA 3FMHA 3JYAA 4M8TA 3R8UA 4AT5A 4C62A 4EONA 2V5QA 4O21A 3ZBFA 4YO6A 4ENYA 4C4GA 3VF9A 1UKIA 4J99A 2EXEA 3EQBA 3IW7A 1QPCA 3VJNA 2YIWA 5HX6A 4DCEA 4MXYA 3V04A 3HDNA 4W9XA 4FVRA 4F7JA 3WIGA 4DTKA 2E9OA 1Z9XA 2XIRA 2ERZE 3RPSA 3RAKA 2J5FA 3ERKA 4L6QA 4PF4A 2IW6A 3KN6A 4WKQA 3QKLA 3W16A 3DKOA 2C3KA 3FDNA 3BHVA 3PXZA 3FLSA 3ODYX 4R5YA 4ZLYA 5IA4A 3NVKI 3LLTA 2VTTA 3IGOA 3QAME 4FG8A 3NYNA 4YGAA 4BIEA 2UZEA 5LOHA 3LJ1A 3H9FA 4HVSA 3LKMA 4UMPA 3KL8A 2X4ZA 3THBA 3ANRA 4ZY4A 4FV2A 1IASA 1PKGA 1URWA 1W82A 3LIJA 4RGJA 4N0SA 2IG7A 4Y72A 1U54B 5FD2A 3PJCA 4C4HA 3DNEA 4LM5A 5HE1A 2REIA 2PULA 4I5HA 1GNGA 2P55A 3EQGA 5LMBA 4CD0A 3AMAA 3LVPA 5J9LA 2XK6A 3MJ1A 4JNWA 4PP9A 3OCTA 3TNIA 4W8EA 1KOAA 2I0HA 4BCJA 4I0RA 4UEUA 4TW9A 3W2RA 3WF8A 2FVDA 5A4EA 3GC0A 3DXNA 4JBPA 4YBKA 4BKJA 1SNUA 4EH2A 3OFMA 3MIYA 3WYXA 5CVFA 4GFGA 3EN5A 4E20A 2VGOA 4ONAA 3RCDA 4A9TA 1U59A 4IFGA 4F1MA 3PDTA 3QTWA 1R1WA 3MI9A 4ZMFA 2E2BA 3A61A 2BRNA 5EYDA 4F6SA 2PYWA 4G34A 3CJFA 4PTEA 2G9XA 5JT2A 3NAXA 3MGYA 1J1BA 3Q9WA 2XS0A 5E90A 5AWMA 4YHTA 3MH2A 3I79A 4F9BA 2ITNA 4GUBA 4JS8A 1J3HA 4QMNA 2HZIA 4FSZA 4PTGA 2EVAA 3F3TA 5HG5A 4TT7A 2UW5A 2XH5A 3LQ8A 3PUPA 2PVJA 2EB2A 4M68A 4GK3A 1JQHA 2JKOA 1H0VA 4BR3A 2RKUA 3N4UA 2JEDA 3MV5A 2Q0NA 3NZ0A 3W2SA 5L6WL 3OBGA 4WBOA 3P08A 5J8IA 4AGWA 4HYSA 2O0UA 3ZUTA 4E5BA 1DAYA 4EBVA 3KEXA 3FZSA 4IDVA 1T46A 2BCJA 4IDTA 4GT5A 4XS2A 3TJCA 5IQIA 2GS7A 4F65A 3ZFXA 2HAKA 3D2IA 5FBOA 5GNKA 4IJPA 4KIOA 5AAFA 5KBRA 4QMMA 4BRXA 4P90A 5M55A 5CU0A 4RQKA 4FTTA 4FT7A 1KE7A 3CC6A 4W4YA 4KIQA 5DG5A 5F4NA 4PDPA 3V5QA 3VQUA 2QOBA 4BDAA 3M2WA 5I5ZA 5CANA 4U43A 4FTCA 4O2ZA 4LUEA 1XH7A 2P2HA 4BICA 3P5KA 4AOIA 3W8LA 2ZV9A 2V62A 4UXQA 3BLQA 1K9AA 2UZWE 1W98A 2IVUA 5AV1A 5HTIA 4O7WA 3CGFA 1ZOGA 3LJ0A 5GZAA 3U4UA 3DDQA 3I6WA 4KS8A 4NKAA 3ZEWA 4EOKA 3TM0A 1Q24A 3ZO2A 3A4OX 4U5JA 2JKMA 4EHZA 3C4CA 4D28A 5L8LA 4BCGA 4F9YA 2XJ0A 3DU8A 4BCHA 4BGHA 4F9WA 2FGIA 4FNXA 4NIFA 4KKHA 5AUUA 3TV7A 5AP0A 3RGFA 1ZY5A 2JC6A 4EBWA 4I0SA 4IWPA 2XEYA 5DFPA 4D2WA 4HCVA 2HY81 2AC3A 3TKUA 3V6RA 4YU2A 2FSLX 4QT1A 3BELA 2DYLA 2PZPA 3QTZA 4G2FA 3C4FA 3DAKA 4L3LA 3D7ZA 4O0RA 2F57A 2VWYA 3PPKA 4R1YA 2W1GA 4M12A 1UNHA 4Y73A 3VS0A 5LCKA 4AX8A 4PL5A 3FMMA 3QCQA 4KABA 3ORPA 5FXSA 4QMZA 2YM3A 2C5NA 4EOSA 2C5XA 3PP0A 5B2MA 3C13A 4QMTA 3RMFA 5IUHA 1L8TA 4FNZA 4G9RA 3RK9A 4JAIA 4IW0A 4QRCA 4IEBA 3AGMA 2HXQA 4ZTNA 5HU9A 1JKLA 4EH3A 2OKRA 3EQPA 3QWKA 4RSSA 3HMNA 4G3EA 5EOLA 4IH8A 5AEPA 1OPLA 4B4LA 3ZC5A 3CIKA 2RIOA 4E4XA 3OXIA 2JGZA 2VTIA 5TO8A 1SNXA 4RWIA 3W2CA 2Y4PA 4M84A 4YO4A 4KKGA 4O27B 1LEZA 3KC3A 3OOMA 3W1FA 3GOKA 5GJGA 3ZLSA 3POZA 3D5WA 3MB6A 4BDGA 3KGAA 3AGLA 3QWJA 4EK8A 3QUEA 4WRSA 5HIDA 3NUNA 4ZS4A 3QBNA 2XZSA 1NVQA 1GAGA 4GK2A 4EWHA 2ITQA 1G5SA 2WELA 4PV0A 3ET7A 3C7QA 3R7OA 5CF8A 2V7OA 5CENA 4BYJA 2ZVAA 3TEIA 3FLYA 2J51A 3TTJA 4BBEA 3VBXA 5AUZA 4UX9A 4AE9A 4CFFA 5CF6A 2HW7A 4KUJA 3F5GA 3F6XA 1U5QA 3UZRA 3CBLA 4UMUA 3KK9A 4O0UA 3ZZWA 3R9RA 2XIKA 3NGAA 4NW6A 1OB3A 2Z7SA 4UYAA 1QPEA 3RHKA 3ZRLA 5JKGA 1I44A 3AC1A 5JSMA 3BQRA 2ZB0A 3RPVA 3FLNC 4KBCA 4Z16A 3ROCA 3VS2A 2OJGA 1WVWA 5CF5A 3SA0A 1FMKA 3R7EA 1PF8A 4RJ3A 3UODA 2GQGA 3ZO1A 4YTFA 2J0IA 3RM6A 3R1YA 5HLNA 4O0SA 4YBJA 5L8KA 1FPUA 2IN6A 5IU2A 4Z3VA 2H96A 2WQOA 2B9FA 4EORA 5HOAA 4WRGA 3H3CA 2Q0BA 4IAKA 1YW2A 1STCE 2PZRA 2YZAA 5ETIA 3P79A 3OT3A 2KULA 1UKHA 4CNHA 2VWIA 4BDCA 3CPCA 3QZGA 1NA7A 1K2PA 1YI3A 3KU2A 1MP8A 5ACKA 3LXNA 4K0YA 4XX9A 3SRVB 2P3GX 2QCSA 4S33A 5IEXA 5DR2A 4QMYA 2GMXA 4AAAA 1UA2A 3C4EA 1LPUA 3Q9YA 4GK4A 2PK9A 5EHOA 4ZY5A 1T45A 3HRCA 5EDRA 2ITYA 3N9XA 5BPYA 3I5ZA 3LFSA 4IWQA 3PXQA 2CCIA 3L8SA 3R0TA 3SKCA 2YFXA 4LRJA 4EOMA 4H05A 2I1MA 3Q53A 3BZ3A 1YWVA 2WZJA 4A4LA 2YJRA 1R0PA 4AZVA 3LFQA 3KRXA 4ENXA 5KZ0A 2ITXA 2QO2A 3UNKA 4LMNA 4C3FA 4PQNA 4TYHA 3QD0A 3DTWA 5D7AA 3LM5A 3QTSA 4FT9A 2BR1A 1UNLA 4QMVA 5LMKA 3AT2A 3HV6A 3WF5A 4I24A 3G2FA 1LP4A 3ALNA 2B7AA 3MIAA 2OJJA 1YHVA 2JAVA 4BC6A 3A7GA 4U80A 4F63A 5JMSA 2BZIB 3PWDA 5FM3A 3AC4A 3ORLA 4GEOA 4IIRA 4BIBA 1PYXA 2HXLA 5IA3A 4FOCA 5DHJA 3I5NA 2JITA 5HKMA 4EOLA 4DT8A 4MKCA 4CYJA 3DAJA 2WIPA 3HL7A 5M06A 3ZS5A 3OBJA 2BDJA 4JBVA 3NYVA 4GU9A 4X6QC 2IZTA 3F9NA 4ANSA 5ANGA 4FKQA 4AACA 2R3LA 1Q97A 2BRBA 3A8XA 3CE3A 3QHRA 4ITIA 4NSTA 4BTMA 3UQCA 3SC1A 5BUEA 3DA6A 3HZTA 2W06A 3KB7A 3VS4A 5LVPA 4ZTMA 1EH4A 3PJ8A 5EI2A 2DWBA 3FZTA 4V01A 2YDKA 1V0BA 4D1XA 2IZUA 2UVXA 4ZIMA 4F1OA 5J79A 4JLCA 4U0IA 4R5SA 1V0PA 3NCZA 4D1SA 2F7XE 4FV8A 2X8DA 4YJTA 1H1SA 2B54A 3OW4A 3HAVA 4CFUA 3U8WA 3NR9A 4ZK5A 4FKLA 2XB7A 5AV2A 2EXCX 3NDMA 4OTWA 1YHWA 3R8PA 3WZDA 1Z57A 3QFVA 5JFXA 3LMIA 3NLBA 4NK9A 5A4TA 5J1VA 3PJ2A 4YJVA 3F5PA 2IW9A 3QRUA 3D7TB 4BFMA 5CI7A 2XKFA 4O84A 2CKEA 3UQFA 4B7TA 4D1ZA 2IZSA 3K3IA 3N51A 1FVVA 1U5RA 4I6HA 4IX6A 4MWIA 1F0QA 4V0GA 3SXSA 3TDVA 2CN5A 5FTQA 4FZ7A 5CEIA 3HMPA 4L9IA 4HYIA 4K1BA 5CQWA 2WD1A 2QOHA 3EWHA 3RWPA 5JZNA 3UP2A 5AM7A 5TKDA 5C27A 1XBCA 3OWPA 3GENA 2PMIA 3UG1A 2J0JA 4J95A 5CF4A 1APME 2I6LA 4K2RA 3O8TA 4K77A 4CMUA 5K9IA 4BCKA 3ULIA 4CYIA 4D9UA 5HLWA 3FKNA 3GU4A 3KXHA 4MXAA 2WQMA 4UBAA 5DH3A 5I3OA 4IVDA 4BKZA 1YHSA 4NZWB 5CAOA 3IO7A 5H3QA 5JGAA 3DKCA 2CJMA 4NWMA 4D2VA 4WO5A 4MCVA 5EM8A 3VS3A 3WYYA 5AX9A 4XLIA 4GG5A 1O6KA 3IK3A 1B6CB 4X2GA 3PRFA 1YXXA 4I6FA 4FSRA 1J7UA 3UDBA 5B2KA 2WU7A 2YCQA 4BDHA 1XBBA 5D11A 4K9YA 4MTAA 3R7IA 3TI1A 3VBYA 5KMIA 2XNNA 4IAIA 4U3YA 3HYHA 4DH8A 4HVIA 3BI6A 3PIZA 1Q61A 3A7HA 3DNDA 3DS6A 3A62A 3QTIA 4QTDA 1PYEA 2V22A 3DBCA 5CSHA 5HNBA 4C35A 2YIQA 2BILB 1PMEA 5HG7A 5M08A 5H9BA 3DB6A 4G9CA 5LWMA 3DKGA 3OUNB 3QKKA 2PWLA 3A7FA 5FBNC 1ND4A 4D0XA 5AV0A 4II5A 3ETAA 3PJ3A 2WMQA 3V5LA 1PMUA 3TNPC 4NH1A 3U54A 2HELA 5HQ0A 1OBDA 4QP9A 4DA5A 3VAPA 1YDSE 3P7BA 1SYKA 2O64A 2J50A 3F3ZA 2VWZA 4EJ7A 1WBWA 5ANDA 2J5EA 5AR4A 5DR6A 3BPRA 3SAYA 2WTKB 4YLKA 5BVEA 3T3VA 1Q41A 2ZB1A 4FOBA 5KHXA 4ITHA 5JH6A 2X7FA 2R3OA 1H07A 4QMLA 3C50A 3CXWA 5DOSA 3C1XA 3NRMA 4FF8A 2OGVA 4E93A 4FKVA 1AD5A 2A4LA 4R7IA 4CFWA 4DG0E 3DV3A 2IPXA 2PMLX 1WBTA 1FQ1B 3QZFA 4LMUA 1ZYSA 4ZZOA 3LOKA 4NT4A 1ZYCA 3HMIA 3ACKA 4BCFA 4HZSA 2WAJA 2FSOX 4TNBA 4XG7A 3K2LA 4M7IA 3OEZA 3FKOA 2VAGA 3LMHA 5IQAA 4ACDA 2BZHB 4IXPA 4FMQA 1U46A 3Q3BA 2XJ1A 3WILA 5EYMA 4LRKA 4C0TA 4FSTA 2A2AA 2QQ7A 4Q2AA 3M11A 3OXTA 5HLPA 2UZOA 1H24A 4RZWA 3SW4A 4IWOA 2CKQA 2CLQA 4BL1A 1F3MC 4XV9A 3VBWA 3RHXA 1DI9A 3PLAE 5CT0A 4BCMA 1VR2A 4TY1A 4ZJVA 3CD8A 3ORTA 4O6LA 2YJSA 2Y6MA 2HY0A 2W1ZA 1ATPE 2Y8OA 3R00A 4IAZA 1OECA 3EQHA 4J53A 1YXSA 4KNBA 4NJ3A 1JLUE 3QQUA 3WF9A 3DQXA 3PA5A 3R7YA 5CSVA 2J4ZA 4BHNA 3R28A 2BROA 4GW8A 3V5JA 5BVOA 4YZDA 4AU8A 3TKHA 5IZFA 2VU3A 2FSTX 4HGSA 5AMNA 2BFXA 3GT8A 3G0EA 5CTPA 5D7VA 2R3GA 3AMBA 2YIRA 3COIA 4QYGA 2EXMA 2GSFA 3G9LX 4IB5A 2W5BA 1YVJA 4BCPA 3NSZA 4E4LA 1MQ4A 2UVYA 4QMOA 4FYNA 4ZY6A 2OF4A 3ZLXA 3KY2A 4IZAA 4L3JA 4Y46A 3FYJX 4G3FA 4YTCA 4Y83A 1VJYA 2QLUA 4DCAA 5CXZA 4FTJA 5KX8A 3KXZA 5EQEA 2XM8A 3P1AA 4HPUE 2WOTA 3CQEA 3OCGA 4KAOA 4AGCA 4FK6A 2ONLC 4RIWB 2W05A 3PG1A 3D9VA 2QHNA 4PTCA 5LJJA 5JEBA 2OWBA 4F7LA 1M7NA 4EH8A 2G2IA 3IPHA 2YN8A 3V8WA 5JFSA 3D2KA 4ZMEA 4HPTE 5HGIA 4O2PA 2R3PA 2XIYA 4PPCA 3GOPA 1YI4A 2YDJA 3R21A 3R9OA 4KD1A 2V0DA 3IGGA 5E92A 3P7AA 4DFLA 4RWKA 2AUHA 4FZAB 2YM5A 4YJSA 3R7VA 4AT4A 5AR3A 4CRSA 5CQUA 1H26A 4GJ3A 2UUEA 3LZBA 3R1SA 3SX9A 4QP1A 4FUYA 3GU8A 4AGUA 3NUPA 4DITA 3UOJA 2FH9A 3CR0A 4AZTA 2R64A 3COHA 4A9UA 1TQMA 3PVBA 3QRKA 2DQ7X 5DN3A 5FP5A 3BE2A 4C2VA 4CTBA 4L52A 4CG8A 3ZFMA 4CRLA 3LCSA 1GJOA 2CKPA 4MNEA 4FIHA 2W17A 3TNQB 5A4LA 5EW9A 4AF3A 4ANQA 4DEBA 2VD5A 4P5ZA 2XNOA 3KXNA 3SV0A 3UMXA 5CU2A 4XV2A 4DFUA 4OTHA 3HMOA 2BDFA 2ZDTA 4C4FA 5LARA 4FIFA 4IHPA 2H8HA 1W84A 3EKNA 4QMSA 5CEKA 4F70A 3FWQA 3UG2A 4RLLA 3W2OA 2W5AA 5CI6A 4YZMA 5F20A 3QC9A 1BMKA 3KULA 4S34A 2IJMA 3SVVA 4A9YA 4E73A 3VW6A 4QOXA 4DHFA 2FO0A 2B4SB 2QR7A 2PVKA 4GS6A 1G3NA 4YZCA 2HIWA 1OIQA 2YM8A 4FSNA 4FSWA 3A7JA 3GU5A 1OM1A 1FBNA 4YHFA 4O7TA 2LAVA 5L2TA 5BNJA 3FEGA 4L68A 3C5UA 3ZSGA 4XG9A 3R02A 4GIHA 4PL4A 3KMWA 2GFCA 5GJDA 3OCBA 4FKOA 2QONA 5LVLA 3KKVA 3QCXA 1OI9A 1XKKA 3EHAA 4ZSJA 4OTFA 1Q8YA 1J1CA 5HZNA 4FTKA 4GKHA 4RFMA 3HRBA 5DGZA 4EI4A 1OZ1A 4RFZA 5ANKA 5T6KA 4ZOGA 4LV8A 4I21A 2OH4A 4S30A 4AP7A 5CEPA 3ID6C 4AE6A 2I40A 5L2WA 5EH0A 3LQ3A 3BHYA 5M4UA 4XMOA 5J9YA 2VWBA 4TYJA 4B6LA 4JBOA 4H58A 5BUIA 4F09A 5CSPA 3ZZEA 2WTVA 2R3QA 3FMEA 1M14A 2IWIA 2J0MB 5C26A 2IO6A 3T3UA 4PMTA 4D4YA 4IM2A 3G6HA 5HBHA 5A6NA 4O7RA 4RIXB 4F08A 4MHAA 4FV6A 3NAYA 1RE8A 4DGGA 4FEQA 2HENA 3MY5A 2G01A 4MBLA 1TQPA 4QYYA 2GU8A 3IW5A 2VWWA 4KRDA 4AZSA 5K4IA 3FI2A 2QOLA 2PL0A 3GNIB 4UWYA 5IQFA 2GDOA 2GFSA 3AT4A 4FTAA 3LW0A 5J5SA 5CX9A 1RQQA 5J7BA 5KMOA 4ASEA 4IX4A 5LWNA 2XK4A 4EL9A 4OAUC 5D9HA 2UW6A 4UYNA 5EDQA 2C1BA 4ANNA 4KIKA 2Z7RA 4D5HA 1R3CA 1XHAA 4Z55A 1VYZA 3K5UA 2AC5A 3DJ7A 3ORNA 2BUJA 4CZUA 3KRWA 4HCUA 3ITZA 4JDKA 3PY3A 4DBXA 4ZAUA 2GQRA 3MVLA 5KCVA 4RC3A 2CLXA 3MWUA 5C9CA 2OXYA 3ZM4A 2JDRA 3EIDA 3VS1A 3TIZA 5LQFA 5AP1A 3UNJA 2WFYA 4EH6A 3DBFA 2BAKA 4EEVA 4N4SA 4BCIA 4YJRA 2RFEA 4HNIA 4Y5HA 2B55A 3R71A 5IA5A 3W10A 2XK9A 5M44A 4RWJA 3UTOA 4PPAA 3FBVA 4U7ZA 3ZLYA 5IDPA 2UW7A 4EK3A 2UW4A 3D94A 4GJ2A 4MF1A 3BGQA 4PUZA 4Q5HA 4ARKA 3FLZA 4ACHA 3FQEA 4A9SA 3LPBA 3DT1A 4YPSA 4AWIA 2GHGA 4FKWA 2XA4A 3S3IA 1UWJA 5I9XA 1Y8GA 4GV1A 5FEDA 1K3AA 4IX3A 3Q96A 4YTIA 1E9HA 3A99A 3PJ1A 3Q52A 1ZMVA 1YOLA 4FV4A 4TYIA 4WNPA 5AV4A 1IAHA 3L9PA 2R3NA 3ZC6A 3NNWA 5DT4A 5DYJA 4DFZE 3HV3A 3W32A 3VULA 4L42A 1W83A 5ICPA 4ZXTA 4DEIA 2RG6A 4JBQA 3RP9A 3UO6A 5JN2A 2R3MA 3HX4A 5HVKA 4LOPA 4RJ7A 4BYIA 4FKSA 3O8PA 2G1TA 3RALA 4E5AX 5EI6A 3P23A 4R78A 3CS9A 3IOKA 2Z02A 4RJ8A 4E6DA 2YA9A 4IX5A 3QXOA 5EHLA 4TYGA 5J5TA 3O50A 4C2WA 4CTCA 4ZTHA 3UGCA 4MBIA 4CKIA 3DLZA 4D4RA 2NNWB 2R5TA 4RIOA 3V6SA 2R3KA 4BBFA 2GS6A 3L9LA 4LGHA 3LFAA 4BY9E 2F4JA 4I22A 4XBRA 3GCUA 1KV1A 2CGXA 3AQVA 3DDPA 1U54A 1Q8WA 3TZ8A 4ASZA 1WZYA 4IVCA 1CMKE 2VO7A 3O8UA 4I5MA 4U6RA 4UY9A 4XV1A 4XG3A 4QTEA 4KKEA 2ITUA 5HX8A 4USEA 2UZVA 4E7WA 4CMTA 3BWJA 4DH3A 3PRIA 2H9VA 3QQHA 4LL5A 2W1DA 3OZ6A 4RX9A 4IE9A 3R9DA 4PDYA 3F82A 4GG7A 1H4LA 1UU7A 2A0CX 2OZAB 4FL3A 5AUTA 4QMXA 4CQGA 3DB8A 4JQ7A 4MYGA 1OPKA 1Q4LA 4W4WA 3TNHA 2WOUA 4ACCA 1VEBA 4TYEA 5C4LA 4CFVA 5BX0A 4W4VA 1L3RE 2BTSA 4D2RA 3BCEA 3BYUA 4J1RA 5EFQA 1GZNA 3BHUA 4B0GA 3D0EA 3ENHA 5DE2A 4K33A 4X3JA 1ZZLA 4P4CA 3BHHA 4JL9A 4QNYA 3KRJA 4EKKA 5LVMA 1G8AA 2JBOA 5KE0A 4IANA 3UIUA 2PE0A 4EJNA 2XNPA 2JIUA 1M2RA 2QHMA 3DGKA 3JPVA 4GIIA 3SOAA 4ERKA 3PVGA 5M51A 2YEXA 3LE6A 4WA9A 3DK7A 4KSQA 3I81A 5GJFA 4FT3A 2OFVA 1ZXEA 2JFLA 3SD0A 4G5PA 5A46A 3PE1A 2W1FA 2RSVA 4RJ4A 4MWHA 4BWXA 1H00A 2IW8A 3UPXA 2JIVA 5E91A 4OUCA 1CSNA 3H10A 4AW1A 1NW1A 3KQ7A 1HCLA 3MVHA 3KVWA 3GXLA 5CSXA 2BVAA 2X8EA 4ID7A 4C57A 5CSWA 3NNUA 2VGPA 2B53A 1OGUA 4ANBA 2HWOA 1XH6A 3NUXA 2P4IA 2BFYA 1WBOA 5KMJA 3IDBA 3PWYA 3SQQA 2IVVA 3E8EA 3U9CA 4DGOA 3KXGA 5E9EA 2CCHA 4JOAA 4FSMA 4OTGA 5B0XA 4FNWA 3O96A 3HUBA 3TXOA 3FZRA 4FTMA 4BIDA 1W8CA 1ZMUA 4FEXA 3DFCB 5JFVA 3R83A 4FZFB 3ZRMA 3FMDA 4NYEA 4AZWA 2QO9A 4LOQA 3SG8A 5EKNA 5EYKA 4UALA 4C3RA 3EZRA 1U4DA 5DIAA 5AA9A 1BLXA 5CALA 3QGWA 4G3GA 4BCNA 2FB8A 4XH6A 4HOKA 4EC8A 3KCKA 3R22A 4CG9A 1CDKA 3ORMA 3RM7A 2RGPA 4NL0A 4KS7A 4M69B 4ZTLA 4MXOA 3TACA 3OP5A 5HTCA 5IQBA 4K8AA 5B7VA 2EUFB 1QMZA 2ETRA 1REJA 3EQIA 3GCQA 3U9NA 3F2AA 2GPHA 3GQLA 4RZVA 5CY3A 3WZEA 4B8MA 2P2IA 4FICA 5E8XA 2VTNA 1WBSA 2O2UA 5JQ8A 4FEVA 3Q60A 1H28A 4PX6A 3P7CA 4GFOA 2BIKB 4TRLA 2KTYA 4ZEGA 4L01A 4AN9A 4O7YA 2YLFA 5IF1A 3JVRA 1NVSA 5AAEA 4DLIA 4E4NA 1E1VA 3UNZA 3ZO3A 3FXWA 3LFEA 3HV4A 3QTQA 4FGBA 4C33A 4E5WA 3KRLA 2FUMA 4IBMA 1MRYA 2WQEA 5G1XA 4P2KA 5A14A 1PMVA 2X6EA 3DZQA 2F7EE 3DLSA 4PL3A 4ALUA 3NW5A 3UOKA 4CSVA 4N6YA 3RJCA 3VS5A 3BU5A 1XJDA 2Z8CA 5AP6A 2WQBA 3U51A 3OY1A 3FZ1A 2C1AA 4I20A 5AV3A 3HMMA 2BTRA 4R7HA 2HZNA 1UU9A 4FZDB 4X6RA 1P4OA 3FZPA 5CU6A 4OTIA 2YCSA 5FRIA 5C4KA 3RNIA 2C3LA 4MQ2A 4YZBA 4TNDA 2C4GA 3KFAA 2XKDA 4O0YA 3V8SA 3EQRA 2WMTA 2XNEA 3PFQA 4FC0A 5HTBA 4DFNA 2W99B 2OU7A 2QOFA 4GYIA 1ZYLA 4F99A 5I9YA 4D55A 3PIYA 2ZMCA 4O7NA 2OJ9A 4PMSA 5CVGA 4DEHA 3P4KA 3FI4A 5HCXA 4NCTC 4XBUA 4WNMA 3C0IA 3GC9A 3H30A 3HECA 3HVCA 5LVOA 1PXLA 3C4WA 4B9DA 4I6QA 4ACGA 4ZLOA 3Q6WA 3W8QA 3VUGA 3VUDA 4DFYA 4DFXE 5IISA 4R77A 5I4NA 3SXFA 4QTCA 4YLJA 3A4PA 4OTPA 1OPJA 5AR2A 4KIPA 4BDBA 5HD4A 4EOJA 2QURA 5C03A 2YCRA 3FZOA 4S32A 4AXAA 3ZTXA 1JVPP 4E1ZA 4D0WA 4FTNA 5BYZA 1M17A 4FYOA 3OG7A 4ZSEA 2J0LA 4EH5A 2X9FA 1TKIA 3IQ7A 3QTUA 4EHGA 1YWRA 2BIYA 3ODZX 3QX4A 1XH4A 4FKIA 5BVWA 3RAIA 3SGCA 3NMUF 1RJBA 3UVPA 5IA1A 1AGWA 4IAYA 5IQGA 1ZWSA 3GI3A 5IDNA 3SW7A 3QKMA 2C0IA 5EQPA 4FV9A 4G6OA 5L2SA 5FP6A 3R73A 1XWSA 2BRHA 2XIXA 3A60A 1ZAOA 4RJ6A 2R9SA 4XG8A 4ASXA 4NM0A 3SRVA 3TIYA 4B99A 4ORKA 3B2TA 1V0OA 1YQJA 3MH3A 2XP2A 3C9WA 5ITAA 1KSWA 2UZNA 3CP9A 2W1HA 5DWRA 5HG9A 1WMKA 1CM8A 5FM2A 4L7SA 4U97A 5G6VA 3ORIA 1PRYA 4WSYA 4CXAA 4OGRA 4H1JA 2H6DA 4F7SA 4DEAA 3BV2A 3ZDIA 2PVHA 5FDPA 2OJFE 3IS5A 3ZUVA 4BTFA 4O81A 4R8QA 5TOZA 4ANMA 1P2AA 1YDRE 2JDTA 4HVHA 4NFNA 1GOLA 3OVVA 5E8ZA 2YWPA 2B9JA 3I4BA 2VO3A 3FC1X 3NS9A 5CNOA 5HO6A 3TG1A 4DINA 2BDWA 2VTPA 2X8IA 5F1ZA 3ORKA 3U6HA 4HYUA 1JPAA 3F5UA 2JDVA 4QQCA 1H01A 3BBWA 5K0XA 3AG9A 3CY2A 3C4ZA 3E63A 4OBQA 4ZJJA 5HNIX 4J97A 4X3FB 1MRUA 3ZOSA 1NT2A 1Y57A 4QYFA 5CNNA 2OIBA 4QP2A 4EQMA 3EFJA 5AUWA 4A9RA 3BU3A 4BCQA 4RWLA 5CEQA 3DJ6A 4OR5A 1RW8A 5E7RA 4C3PA 2FA2A 2VTAA 4FV3A 2W7XA 3PE2A 3AOXA 3ROYA 5EM7A 4TTHB 3LXKA 2PMOX 4AN3A 4B8LA 2IZRA 3F66A 3TL8A 3EYGA 2X7GA 3L9NA 1Q62A 2YDIA 4MX9A 2ETKA 4FKJA 4EC9A 4YTHA 2XBJA 5FEEA 3EN7A 5A9UA 4IMYA 5F94A 5HO7A 2XMYA 4CVAA 2I7QA 4PDSA 4BDIA 1PJKA 4BWPA 3B8QA 4NJDA 4JG8A 4FV0A 4UMTA 3LFDA 4C37A 2QC6A 2YABA 2C0OA 4DT9A 2ITWA 4D5KA 3B8RA 4DYMA 2QLQA 3BV3A 5IUGA 3G90X 3TV6A 2Z2WA 3D7TA 3KXMA 4JG6A 3ZBXA 1OKVA 4JIKA 5CT7A 5BUJA 2QO7A 4IB0A 5IMXA 4CKRA 5K5XA 4RIYB 5JK3A 1PW2A 3OS3A 1REKA 5IKWA 3MPTA 2B52A 2E9VA 5L8JA 4XP0A 5CAUA 4D9TA 4CV9A 4FEUA 5GIPE 4YZ9A 4FNYA 3QC4A 4RC2A 3QTRA 4AGDA 2C5OA 4TWCA 3LCOA 5CS6A 4YPDA 5A54A 5BMSA 5HBEA 2C6MA 3PXFA 1W0XC 1H08A 3V3VA 2X6DA 3BU6A 3R30A 4AG8A 3HP2A 2X1NA 1SVHA 3EOCA 3HA6A 3PYYA 4XOZA 2GCDA 5CU4A 5TF9A 4OLIA 4L7FA 4U42A 2BKZA 2BHHA 2W96B 4XYFA 3MFUA 5FTOA 3ENMA 1YXTA 3D14A 3GC7A 4CZYB 2W1IA 5CEMA 3GEQA 4YJQA 4IC7A 3WI6A 5C8NA 3U55A 5CAVA 3QQGA 3PZEA 4PPBA 5TE0A 3R9HA 2VO0A 2CGWA 4U3ZA 2B0QA 2QG7A 4UMRA 4RA5A 4L00A 4LV5A 3PA4A 5GZ9A 4GKIA 3AC3A 5HIBA 2JIIA 3QU0A 3ZYAA 4GCJA 5DT0A 2BZKB 4XNEA 2QNJA 3BLHA 3NX8A 4EYMA 2VTOA 5AP3A 4HVDA 5JGDA 3I6UA 4FL2A 4MF0A 3PY0A 3BYVA 3I0OA 2C6EA 4JT3A 1FMOE 3BGPA 2ERKA 5AIRA 5BMMA 1PY5A 5E8UA 4ANLA 3VRYA 4O0XA 1Y6AA 2WO6A 2VTLA 2PVYA 3VF8A 5JZJA 4G17A 2G2FA 3LXLA 4GT3A 1VYWA 5L2IA 4YURA 4CT1A 3QUDA 4UV0A 2R0UA 3I7CA 4BGGA 1H0WA 5AAGA 5J1WA 3JR1A 5EDPA 4CFMA 3MSSA 3AD5A 4X2KA 4M66A 4EH9A 3BWFA 2OBJA 2VUWA 4KWPA 3QA0A 3UO5A 3IOPA 5AP5A 4L45A 4QP8A 4BZNA 3UOLA 4LG4A 2PVRA 4MBJA 5I9VA 1M2PA 4TPTA 3DQWA 4BI2A 1JKTA 2W1EA 4NM5A 4WG4A 4QTBA 4FZ6A 4DH7A 1OMWA 4HVGA 4C7TA 4YNOA 5AUVA 2G2HA 3B2WA 2BZJA 4R1VA 3FPMA 3DAEA 3DK3A 2VX3A 2YM7A 3GVUA 4L3PA 5I3RA 1VZOA 4FKRA 2ZV8A 5HG8A 4CT2A 1JOWB 4FKTA 2YAAA 3JUHA 1YI6A 1BYGA 5CLPA 2P0CA 4DEDA 1CTPE 4WG3A 5E8SA 3WIKA 4L8MA 3RK5A 2VX1A 3LJ2A 5BVKA 4I94A 4HGTA 1KV2A 5I9ZA 5IA0A 2XYNA 1IG1A 3QCSA 2Z7QA 3FLWA 2WU6A 1UWHA 5CXHA 3TDWA 4JQ8A 3NCGA 3N4TA 4AT3A 5DT3A 5J7HA 4BF2A 3HNGA 5AA8A 1XH5A 3G51A 3FYKX 3FMKA 3QRJA 4ZLZA 5C8KA 5DEWA 3KF7A 4LI5A 4H3QA 4OT6A 2ITOA 4AA4A 3Q4CA 1WVYA 3ZH8A 3HDMA 4XG6A 2VNYA 4XRLA 5K3YA 4J7BA 2PVFA 4FG9A 4L46A 3R7GA 4U79A 3ZXTA 2DUVA 2WQNA 3O17A 4HGEA 4F9CA 5BVNA 3ZSHA 5IQHA 1IAJA 1GIHA 1KE9A 2WMSA 3MY0A 1BI8A 3A2CA 1Y8YA 4F0GA 5LVNA 3KA0A 4TZRA 2HW6A 3L9MA 3OMVA 4EHEA 3DXQA 2C6DA 3C4XA 4I5PA 3LM0A 3MB7A 4M15A 5LCJA 4FKPA 3JY9A 1PHKA 2O65A 3KF4A 3I60A 4DAWA 3C5IA 4P7EA 4IWDA 3MFSA 1DAWA 4UN0C 5EM6A 1DI8A 4OW8A 4LGGA 2J2IB 4TKSA 3VUMA 2VTMA 1SMHA 1GY3A 1ZRZA 2CPKE 1A06A 1AQ1A 3TV4A 2BRGA 2OJIA 2XCHA 4O1PA 4X2JA 4X3FC 5AADA 3CPBA 3RVGA 5BQ0A 5DRBA 3LAUA 4APPA 4M0ZA 2OZOA 4OTDA 5FQDC 3VRZA 4IAFA 4HNFA 4PMPA 3IDPA 4PY1A 4F1TA 3S1HA 4I0TA 4RVKA 4F6UA 3K54A 3NNXA 3EN4A 3FUPA 3IW8A 1S9JA 1NY3A 2PUPA 1JSUA 3S2PA 4O0VA 4F6WA 1OIUA 3RPYA 3CSVA 4AA5A 1QPDA 5H2UA 2GHLA 3FMNA 2NRUA 5J87A 3PPZA 4J71A 4O0TA 4EUUA 4RIWA 4XOYA 3E62A 3GU7A 4GU6A 2W9ZB 2XEZA 4FT5A 5ACBC 1PXPA 2ITZA 2C0TA 1MQBA 1KE8A 4FI1A 4MD7E 3FV8A 5M4CA 5FTGA 4XHKB 4F64A 2ZOQA 4FTUA 5C01A 5E8TA 3DBDA 3F88A 4X7QA 3POOA 4Z9LA 2W4OA 3FY2A 2WPAA 3VBVA 5KMNA 4FUXA 5HO8A 4FTIA 1BI7A 2PE2A 3UYTA 4OTRA 4J8NA 5IEVA 4GVAA 5ETCA 2PE1A 2WMRA 2VTJA 1H1QA 3GB2A 4YC6A 4IACA 3KMMA 4CLIA 3KK8A 2UW3A 2ZMDA 3NYOA 4IM0A 4FTQA 4NM7A 4PMMA 4F0IA 2PUUA 3R1QA 4MXXA 4NU1A 5CASA 1Y91A 2OXDA 3MS9A 5CAPA 4JI9A 3W2PA 4NTSA 4I6BA 2CHLA 1MRVA 3W18A 2CSNA 4C34A 3F7WA 3HLLA 1QCFA 4GT4A 4O38A 2WNTA 1BUHA 3GFEA 1BL6A 5C8MA 2UV2A 4J98A 2C6IA 3S95A 3QXPA 3JXWA 5HE2A 4KBAA 4IADA 3TCPA 4ALVA 3MTLA 4USFA 3AD4A 2XK3A 3FHIA 4MEDA 2WKMA 1PMNA 3ORXA 5AP7A 5IQEA 4BGQA 3GBZA 4NM3A 4N6ZA 2UW8A 4G31A 2ITPA 4EZ3A 4O7LA 2VWVA 2W9FB 1WFCA 3K3JA 3F3VA 3DZOA 2WTJA 3ZMMA 3GP0A 1BL7A 4IC8A 3CEKA 2VO6A 4WIHA 1YKRA 3ORZA 4PNIA 2OK1A 3VBTA 3ZLWA 2PSQA 1YWNA 5EQYA 4C59A 3UVRA 2I0YA 3ZCLA 3P0MA 3LQ5A 4JR3A 4WUNA 5EG3A 2HZ0A 2GNJA 3OUKA 2VX0A 3JVSA 1XH9A 2CGVA 2HOGA 3PPJA 4NTTA 2X0GA 4QPSA 3H9OA 1IEPA 4JIAA 2VZ6A 1TVOA 4BDKA 3RWQA 1OKYA 2YCFA 5E4HA 3PG3A 4HZRA 3FE3A 3H4JA 3QLGA 5M09A 3MTFA 3C0HA 4TL0A 4FE2A 4H3BA 3QGYA 4RIXA 4DBNA 2PUNA 4F7NA 2OG8A 4H3PA 5H8EA 3VS7A 3F61A 3UYSA 3VUTA 1HCKA 4O0WA 2YIXA 4CEGA 3DPKA 3VJOA 4FV5A 4QP3A 5I0BA 3OCSA 3BE9A 4EUTA
chains in the Genus database with same CATH superfamily
1O6YA 4YP8A 3EMGA 3H0YA 4DEEA 3QQJA 3S4QA 3RZBA 4O82A 4IAAA 3FMLA 3L1SA 4IZ7A 3EJ1A 3Q5ZA 1M52A 3MYGA 4JDJA 1H1WA 2YLEA 3GFWA 5CYIA 3SDJA 3ZHPC 3Q4TA 3FSKA 4XG2A 4XLVA 4FTLA 2J7TA 2Y4IB 3QLFA 5AP4A 1Y6BA 4EK5A 4ZTQA 4E6AA 2QKRA 4IZ5A 3OXZA 5M4FA 2WTWA 4QQ5A 1FOTA 2Z7LA 4NFMA 3UE4A 3UC4A 5M07A 1ZYJA 4EK4A 3BLAA 3EH9A 1IA9A 3OROA 4QP6A 2E9PA 2PZIA 4IVBA 4TN6A 5KNJA 2XAMA 5CVHA 3WE8A 3ZFYA 2O3PA 1W2CA 2UZBA 3TWJA 4I5CA 1OVEA 3MVJA 4FA2A 4GL9A 4JX3A 4NW5A 2X4FA 3TJDA 1ST4A 5AFVA 3K5VA 1NVRA 4O4EA 4FODA 3DBEA 5IPJA 5AUYA 2XKEA 2RFSA 2YM6A 4KB8A 2C3JA 3DOGA 2C68A 3R1NA 2CGUA 3R8VA 3HAMA 2WTDA 4KINA 3PTGA 4U45A 2GNGA 5DBXA 4QYEA 3RINA 4FTOA 3WF7A 2XJ2A 2C6LA 2OIQA 3G0FA 3E64A 4ZSLA 2XNMA 3NIEA 4EYJA 1P14A 2R4BA 4LOOA 3RZFA 2PU8A 5DMZA 2VTSA 4S31A 5T68A 3G9NA 5KUPA 2R3IA 4N70A 5DA3A 5J9ZA 4NCTA 3BEAA 4FTRA 4ZSGA 5FWKK 5M4IA 4CMOA 2G15A 3QZHA 3ZDUA 4Q5EA 2PVLA 5B2LA 3EYHA 4AXFA 1PXJA 1PXKA 4DHZA 1PXIA 1UV5A 2WB8A 3Q32A 3QHWA 3VW8A 3DXPA 3COKA 4UB7A 2PY3A 4M14A 2UW9A 3EZVA 4YLLA 4CQEA 3FQHA 3LFBA 2C47A 2B9HA 4KBKA 1G8SA 4XJ0A 3Q04A 1JAMA 2R2PA 4BZOA 5EHYA 4CKJA 1P5EA 5AJQA 5L4QA 4DTAA 2WEIA 2W0JA 4LQMA 2R7IA 4Y85A 4DF3A 4FSUA 4IB3A 3LHJA 5KKRB 5D41A 5D12A 1FVTA 2XNBA 1R39A 3MPAA 5EK7A 3RBWA 4ACMA 1ZY4A 2C30A 4QO9A 3D83A 2SRCA 3E3PA 4RT7A 2VN9A 1FVRA 3COMA 5E8YA 1LEWA 2O63A 3CKWA 4BB4A 1WVXA 5M56A 4IB1A 4AFEA 5IMEA 3NUAA 2BALA 2GS2A 4ALWA 4V05A 2NPQA 5FLFA 3BRBA 3D5VA 2QOQA 4WUAA 3TUDA 3NW7A 4YC3A 4I92A 3FC2A 4AW5A 4A7CA 2X2KA 2XKCA 4NIFB 4RX5A 3ATTA 2ZAZA 3AMYA 4FEWA 2ESMA 3MPMA 4HW7A 2J6MA 4O7SA 2OZAA 3MESA 4JDIA 4FGRA 4DG2E 2XRUA 3QRTA 3ELJA 3TTIA 4UWBA 4CFXA 3RPRA 4HGLA 4C58A 4C4EA 3PXRA 2RFDA 2QI8A 2E9UA 2XF0A 4J52A 5FDXA 2JAMA 3V5PA 4UZDA 4X2FA 1OL2A 1ZYDA 4D2PA 3GCVA 1IA8A 4GRBA 5IQCA 4BN1A 2YISA 3FMJA 4LYNA 5CZIA 2ZFYA 3DTCA 3MVMA 2YERA 5AIKA 2GHMA 4WNKA 1H1RA 4E6CA 4GSBA 3AC2A 3QX2A 2UZDA 3V5TA 2CKOA 4ZSAA 2QOOA 3OWLA 5ANIA 3KREA 3UOHA 1IR3A 5ETAA 5GINE 1KOBA 2GNIA 4GUEA 3WBLA 3DBQA 3R04A 4N57A 2OFUA 4RVMA 2C5VA 5KMMA 1OITA 4O96A 3F2RA 3U4WA 3W2QA 4DGMA 4I4FA 5AUXA 4LDTA 4NUSA 4I23A 2JLDA 3BQCA 3Q6UA 4G6NA 3BX5A 1OL1A 4QMQA 4O4DA 2UZUE 5A6OA 2PPQA 4YJPA 1F5QA 1XR1A 4M13A 4FG7A 3LCKA 5I9UA 3TN8A 3WZUA 4YUQA 2XRWA 3OTUA 3G5DA 1PXOA 3JS2A 3E92A 5A4CA 3PXKA 1JBPE 1I09A 1JNKA 2JKKA 3F5XA 4APCA 3RKBA 2A19B 2OLCA 3EQDA 3SHEA 1QPJA 3GC8A 4WNOA 4EH4A 3HA8A 2RG5A 3V8TA 4FX3A 1OBGA 3HV7A 5EYCA 1H1PA 3BIZA 1W7HA 3IKAA 3L8VA 4IM3A 4PNKA 3EL7A 3KXXA 3PIXA 4QMUA 4AW2A 3CQWA 5JQ5A 5HHWA 5JRQA 2X39A 1WBPA 2C5YA 2WMUA 1A9UA 3P9JA 3QD2B 3QA8A 3UC3A 3ZSIA 3MA6A 2YZLA 4FL1A 5HU3A 3QZIA 2IEWA 5EI8A 1Q5KA 4A4XA 2HCKA 5C1QB 2VTQA 3GGFA 5HI2A 2WHBA 3D5UA 2VWUA 3LCDA 4C02A 1GIIA 1IRKA 4M69A 5FG8A 4FR4A 3UIMA 1X8BA 2VWXA 3WE4A 2OXXA 4CV8A 4H39A 4FIGA 4D4SA 1TQIA 2WMWA 4TWPA 4RQVA 1ZLTA 4OT5A 2IVTA 3MH1A 4U40A 5DVRA 3VIDA 4XEYA 3TZ9A 1PKDA 3PVUA 3ZONA 4F4PA 3DKFA 4O83A 3ULZA 1SZMA 4MH7A 3FKLA 4AZEA 2IVSA 3PP1A 1Z5MA 3FXXA 1OL7A 3Q2MA 1DM2A 2JBPA 3U6IA 1J91A 2Y4IC 4EHVA 4DE4A 1DS5A 2WTIA 4FVPA 3ACJA 2W4JA 4W9WA 1OKZA 4EQCA 2R3RA 4EZ5A 3OHTA 3S0OA 4HJOA 1Q3DA 1PXMA 2ZM4A 3G33A 2JD5A 1WBNA 4OBPA 2GTNA 2ZV7A 4XCUA 3T8OA 3FI8A 4DFBA 2PHKA 3TNWA 3WZJA 4Q9SA 3IECA 3PY1A 3Q4ZA 5HBJA 2ZYBA 5IUIA 4NKSA 2C69A 3VBQA 4AXCA 1CKJA 2YHVA 3KN5A 4BDFA 4D2SA 1ZOEA 3EQCA 5M57A 1H25A 2X9EA 1OL6A 3M1SA 4MD8E 2YAKA 4X0MA 4EKLA 4IFCA 4TYHB 1FGIA 4USDA 5DEYA 3E8NA 4RRVA 4U41A 5E1SA 5F9EA 1H8FA 3OOGA 4HYHA 5H8BA 3BYMA 3L8XA 5EOBA 2R3FA 4FKGA 4IQ6A 2OIDA 2Y7JA 3I1AA 4QMWA 4WOVA 4EQUA 5EW8A 2X81A 4E6QA 3DY7A 2J90A 5E8WA 2WMVA 2QD9A 3PXYA 1H27A 1SVEA 1WCCA 3Q4UA 3QYZA 4M67A 3LCTA 2YIYA 5TR6A 3UIBA 3I0QA 3BL7A 3LFNA 4U9AA 2GQSA 3ANQA 2JDSA 5HORA 3CTQA 5T3QA 5LXMA 4JVGA 3G15A 2JFMA 3VUIA 1Q99A 3FAAA 3BEGA 3ZEPA 3E87A 4AOTA 5L2QA 3TZMA 3CCNA 3KVXA 3O7LD 4D4VA 4MD9E 3GUBA 3DK6A 4DC2A 4HCTA 3PZHA 4BDDA 4BTKA 2GNHA 1NXKA 4I41A 2XK7A 3MA3A 3FL5A 3TKIA 4YSMA 2NRYA 4EH7A 4I93A 5HCZA 4V04A 3IG7A 3IONA 4BI0A 5IH6A 2J9MA 4O1OA 2R3HA 3II5A 3FY0A 3BL9A 5HNGA 4XG4A 2XCKA 3WARA 5KMKA 2CNUA 5DI1A 4C61A 5KKRC 5HEZA 3UIXA 5IH5A 4FIIA 4TWNA 4D58A 4C38A 3EB0A 2OH0E 1YXVA 2HWPA 3LXPA 3PSBA 3E8DA 2O8YA 3Q5IA 1FGKA 5EW3A 4P5QA 4QMPA 3VWAA 3TZ7A 4FIEA 1CKIA 4O4BB 3PVWA 3WOWA 3NW6A 3KCFA 3TT0A 5EM5A 3QCYA 4QQJA 5IA2A 3F3WA 3R63A 2BMCA 4I3ZA 2QVSE 3E8CA 4FVQA 3UPZA 2OF2A 5BYLA 3GQIA 4WSQA 4ASDA 1Q8UA 3VC4A 1YXUA 5J95A 5D10A 1JKKA 1YOJA 3OY3A 4GYGA 4QNAA 5CWZA 4ZZNA 3QUPA 3MW1A 5FUTA 2CMWA 4RA4A 4AOJA 2P33A 4V0GB 3UZPA 2CNQA 3O51A 2UZTA 5IEYA 3Q9ZA 3NUYA 3VUKA 3P86A 3QD4A 4QP7A 4AUAA 1JKSA 1RDQE 3DJ5A 3PLSA 3RK7A 5CAQA 1KE6A 4GH2A 4CCUA 2QOKA 3UO4A 3H9RA 4O22A 3AKKA 3QTXA 4L43A 3DCVA 4I1ZA 5F95A 1OKWA 2F7ZE 3F2NA 5LMAA 1R0EA 3EN6A 3R2BA 2XK8A 4IJ9A 1Q8TA 2I0VA 4XV3A 4BHZA 1S9IA 2ONLA 4K18A 4AA0A 3MN3A 5E8VA 4QTAA 4BCOA 4D2TA 4O91A 4YMJA 3NWWA 2BHEA 4ZS0A 3NVMB 4MAOA 2UZLA 3L8PA 4JAJA 3QRIA 4W4XA 1ZOHA 4WBBB 1YDTE 4K11A 4RLKA 4UWCA 4RMZA 3Q9XA 1YRPA 2BAQA 2ZJWA 1GZKA 3EFKA 3F69A 4ERWA 4X3FA 3NNVA 4GFMA 3CKXA 4CZTA 4BVUA 3ZM9A 4QPAA 3AD6A 3GCPA 2CN8A 3OW3A 2XYUA 3C0GA 4IZYA 4H36A 2QODA 4C4JA 4FSYA 3U6JA 5DNRA 3QL8A 1KUTA 2ITVA 4AW0A 3HP5A 3E88A 1PXNA 3ZU7A 3VVHA 5IG1A 3AC5A 3SOCA 1KE5A 1J7IA 2VNWA 4YJUA 4BZDA 5CZHA 2ZM3A 3W55A 2C6TA 3N4VA 1W2DA 2F2CB 4TXCA 2AYPA 2Y9QA 2VV9A 4QYHA 4DGNA 3HGKA 4M0YA 3R8LA 4L53A 2BAJA 3RI1A 3PUFC 4FKUA 1KWPA 2EWAA 3Q2JA 4AFJA 2WMAA 4A07A 2RF9A 3PSCA 2C3IB 4YJOA 4AXEA 3HV5A 4CCBA 1QL6A 2H34A 3W0RA 4ZJIA 4MXCA 3EKKA 4R6VA 1O9UA 4F0FA 2OW3A 5JRSA 2XNGA 1ERKA 2ITTA 4FIJA 3FSFA 5IH4A 5CU3A 4FV1A 3KMUA 2VTHA 1LR4A 2RFNA 2OO8X 3OC1A 3QQFA 2ZM1A 3D15A 4R3PA 1HOWA 2VTRA 4G1WA 4RIYA 4LGDA 2ZV2A 4KSPA 1SM2A 3PSDA 2V7AA 2CDZA 3TUBA 3FLQA 3F7ZA 4CFNA 4UZHA 3VHEA 1MUOA 4E8AA 4DH5A 4BJJB 4QQTA 3CQUA 2Z60A 2R3JA 4OBOA 3EN9A 4XP2A 4S2ZA 2OI4X 5HE0A 3R01A 5L6PA 3F3UA 4G6LA 4RC4A 2C6KA 3S00A 3OTVA 3IW6A 5AX3A 3UJGA 4I4EA 2XUUA 5BVFA 5M53A 3CTHA 3KRRA 2UW0A 4E4MA 1OUKA 3QD3A 3OD6X 3QALE 3ZRKA 4C36A 4RX8A 3MFRA 2NO3A 3BBTB 2O5KA 3RAHA 5HD7A 5KZIA 4U44A 4J8MA 1P4FA 3WF6A 3UMWA 1ST0A 3CTJA 5A4QA 3C51A 3HEGA 4Y8DA 1WAKA 2CNVA 3BYOA 4FBXA 2J0KA 4TWOA 1ZMWA 1UVRA 4AN2A 3GCSA 1UU8A 3E3BX 5K0KA 3RTPA 3V5WA 4EK6A 3OT8A 4K6ZA 4O4CA 4J96A 1JSVA 3O7LB 3HRFA 5TT7A 5LMKC 4RJ5A 1ZARA 3BHTA 3AT3A 3WZKA 2X7OA 3OWJA 5K5NA 4YHJA 3UP7A 3UBDA 4OAVB 1SVGA 5HICA 1YOMA 3HUCA 1E1XA 2JDOA 5HVYA 5H8GA 4BWKA 1XBAA 4UMQA 3ATSA 1FINA 3BKBA 3RAWA 3SLSA 1OUYA 3UQGA 5L6OA 4Z7HA 5JGBA 4WHZA 3EL8A 5ANJA 4JXFA 3RPOA 1JWHA 2WTCA 3OF0A 1BKXA 3M42A 3E93A 4KRCA 1R78A 4RG0A 5HCYA 4A06A 4AS0A 2B1PA 3LMGA 3A8WA 3UZTA 4ZP5A 3FHRA 4LUDA 3CJGA 3BLRA 1UU3A 3W33A 4DLJA 2Q83A 1BX6A 4U81A 5DLSA 3LFFA 4O7ZA 3U87A 3FPQA 1GZ8A 4JR7A 3ZO4A 4C4IA 4DTBA 2PUIA 3E7OA 1B39A 5KHWA 1JSTA 2QOCA 2EB3A 4FK3A 4MNFA 2QU6A 4XUFA 3R8ZA 3P78A 3CD3A 2HK5A 3NIZA 2HZ4A 4R7BA 3VN9A 3MJ2A 4PP7A 5BYYA 1M7QA 3O0GA 5K4JA 3VS6A 2NP8A 5CEOA 4MXZA 1J7LA 1B38A 5KBQA 5FEQA 2QOIA 3MY1A 3FXZA 3REPA 3SG9A 4RVTA 2A27A 4G5JA 3ZXZA 1CKPA 2WGJA 2BRMA 3PA3A 3QQLA 2R7BA 5FGKA 4BDJA 4KA3A 4EWQA 4YJNA 3IW4A 2JKQA 1A48A 2E9NA 3VNTA 4AQCA 4WT6A 2OICA 3ALOA 4L44A 4XP3A 4BTJA 1M2QA 4WG5A 2A1AB 4FSQA 4M97A 3ZUUA 4MNEB 4X2NA 2BPMA 4Z7GA 4RBLA 2FSMX 4EOQA 4AXDA 2F2UA 4G3CA 3A7IA 3BYSA 4QP4A 5AM6A 3V51A 3IDCA 4ZTSA 2QU5A 3R8MA 4MQ1A 2WMBA 3MH0A 3EQFA 4YNEA 4YR8A 3HKOA 3CY3A 3KULB 4YC8A 4EOPA 2DS1A 2WMXA 3GU6A 2ETMA 4PDOA 5BVDA 1OGYA 4Y5QA 4E3CA 4ZTRA 4JRVA 3NUSA 3O71A 3H0ZA 1Q8ZA 5ANEA 3V01A 3RCJA 2X2MA 3T9IA 2EU9A 4EOIA 4G3DA 5AR5A 4EZ7A 2XALA 2YITA 2RL5A 3LLAA 3SXRA 2OSCA 1ZZ2A 1UNGA 4DG3E 5E1EA 4ITJA 3NFFB 4BDEA 3LFCA 3NYXA 2ACXA 2X0QA 3VO3A 1XO2B 3AC8A 4JRNA 2WIHA 4A4OA 4F9AA 4JG7A 3QQKA 5A3XA 3D5XA 4BBMA 3VUHA 3TUCA 3FL4A 1GIJA 2NYAA 4LRMA 4DH1A 1OL5A 4ZZMA 2FYSA 5FXQA 3O2MA 4X21A 2AEGA 4XRJA 1V1KA 3E7VA 3OEFX 4PWNA 5GZ8A 2QKWB 4O86A 4DN5A 2PZ5A 2QR8A 2YM4A 4OTQA 1O6LA 2LGCA 1OIRA 2XVDA 4DEGA 3OWKA 3R7UA 5JFWA 5HESA 3MBLA 2GNLA 5KO1A 2ZDUA 3MDYA 5EKOA 5HIEA 2C6OA 3UDZA 5HVJA 4M3QA 1GZOA 4R3RA 4Q9ZA 5FXRA 4W8DA 4R3CA 3VQHA 2W1CA 3FQSA 3CGOA 3NUUA 4IVAA 3JY0A 4RFYA 2XAOA 2XIZA 5AR7A 4QD6A 3EFWA 3DFAA 3FI3A 2AQXA 2PVNA 4G16A 3UVQA 2QG5A 4JQEA 4BKYA 3MFTA 5HE3A 4RX7A 4CLJA 1XMMA 2F9GA 2W4KA 2WXVA 4AZFA 3BGZA 3NPCA 4RPVA 3TYKA 1W2FA 2V55A 4QPMA 3FJQE 4Y95A 3O23A 4KIKB 4FT0A 3R6XA 3W0NA 5ANOA 4DHIB 2PZYA 2GTMA 3R2YA 2Y6OA 5D1JA 4UXLA 1URCA 1XQZA 1LUFA 5AR8A 3QF9A 5GHVA 3VHKA 4ANOA 1XH8A 4YZNA 3T9TA 4BI1A 4C8BA 5KMLA 4H1MA 5I9WA 2R0IA 4O7VA 4NEUA 3CLYA 3EFLA 3R9NA 2WEVA 2I0EA 2B9IA 4GMYA 4LFIA 4L67A 3W0QA 4O6EA 5AP2A 4MVFA 2F49A 4FV7A 5DRDA 4DGLC 3NEWA 4GVJA 3RNYA 4JJRA 2Y0AA 3D4QA 2PMNX 4YSJA 3QYWA 2PVMA 2BKKA 2PTKA 2YWVA 4EOOA 3AXWA 2VRXA 3I7BA 4JX7A 5L3AA 1WBVA 2XBAA 5DR9A 2WTKC 5ETFA 4F78A 1OIYA 3E5AA 4PRJA 2GNFA 4WD5A 5IQDA 2YACA 2X2LA 5DPVA 4CGAA 3G6GA 1Q3WA 4JDHA 2HYYA 2XM9A 2UVZA 2W5HA 4LL0A 4U8ZA 4MK0A 4RVLA 3FMHA 3JYAA 4M8TA 3R8UA 4AT5A 4C62A 4EONA 2V5QA 4O21A 3ZBFA 4YO6A 4ENYA 3NFGB 4C4GA 3VF9A 1UKIA 4J99A 2EXEA 3EQBA 3IW7A 1QPCA 3VJNA 2YIWA 5HX6A 4DCEA 4MXYA 3V04A 3HDNA 4W9XA 4FVRA 4F7JA 3WIGA 4DTKA 2E9OA 1Z9XA 2XIRA 3AKLA 2ERZE 3RPSA 3RAKA 2J5FA 3ERKA 4L6QA 4PF4A 2IW6A 3KN6A 4WKQA 3QKLA 3W16A 3DKOA 2C3KA 3FDNA 3BHVA 3PXZA 3FLSA 3ODYX 4R5YA 4ZLYA 5IA4A 3NVKI 3LLTA 2VTTA 3IGOA 3QAME 4FG8A 3NYNA 4YGAA 4BIEA 2UZEA 5LOHA 3LJ1A 3H9FA 4HVSA 3LKMA 4UMPA 3KL8A 2X4ZA 3THBA 3ANRA 4ZY4A 4FV2A 1IASA 1PKGA 1URWA 1W82A 3LIJA 4RGJA 4N0SA 2IG7A 4Y72A 1U54B 5FD2A 3PJCA 4C4HA 3DNEA 4LM5A 5HE1A 2REIA 2PULA 4I5HA 1GNGA 2P55A 3EQGA 5LMBA 4CD0A 3AMAA 3LVPA 5J9LA 2XANA 2XK6A 3MJ1A 4JNWA 4PP9A 3OCTA 3TNIA 4W8EA 1KOAA 2I0HA 4BCJA 4I0RA 4UEUA 4TW9A 3W2RA 3WF8A 2FVDA 5A4EA 3GC0A 3DXNA 4JBPA 4YBKA 4BKJA 1SNUA 4EH2A 3OFMA 3MIYA 3WYXA 5CVFA 4GFGA 3EN5A 4E20A 2VGOA 4ONAA 3RCDA 4A9TA 1U59A 4IFGA 4F1MA 3PDTA 3QTWA 1R1WA 3MI9A 4ZMFA 2E2BA 3A61A 2BRNA 5EYDA 4F6SA 2PYWA 4G34A 3CJFA 4PTEA 2G9XA 5JT2A 3NAXA 3MGYA 1J1BA 3Q9WA 2XS0A 5E90A 5AWMA 4YHTA 3MH2A 3I79A 4F9BA 2ITNA 4GUBA 4JS8A 1J3HA 4I6LA 4QMNA 2HZIA 4FSZA 4PTGA 2EVAA 3F3TA 5HG5A 4TT7A 2UW5A 2XH5A 3LQ8A 3PUPA 2PVJA 2EB2A 4M68A 4GK3A 1JQHA 4AAYA 2JKOA 1H0VA 4BR3A 2RKUA 3N4UA 2JEDA 3MV5A 2Q0NA 3NZ0A 3W2SA 5L6WL 3OBGA 4WBOA 3P08A 5J8IA 4AGWA 4HYSA 2O0UA 3ZUTA 4E5BA 1DAYA 4EBVA 3KEXA 3FZSA 4IDVA 1T46A 2BCJA 4IDTA 4GT5A 4XS2A 3TJCA 5IQIA 2GS7A 4F65A 3ZFXA 2HAKA 3D2IA 5FBOA 5GNKA 4IJPA 4KIOA 5AAFA 5KBRA 4QMMA 4BRXA 4P90A 5M55A 5CU0A 4RQKA 4FTTA 4FT7A 1KE7A 3CC6A 4W4YA 4KIQA 5DG5A 5F4NA 4PDPA 3V5QA 3VQUA 2QOBA 4BDAA 3M2WA 5I5ZA 5CANA 4U43A 4FTCA 4O2ZA 4LUEA 1XH7A 2P2HA 4BICA 3P5KA 4AOIA 3W8LA 2ZV9A 2V62A 4UXQA 3BLQA 1K9AA 2UZWE 1W98A 2IVUA 5AV1A 5HTIA 4O7WA 3CGFA 1ZOGA 3LJ0A 5GZAA 3U4UA 3DDQA 3I6WA 4KS8A 4NKAA 3ZEWA 4EOKA 3TM0A 1Q24A 3ZO2A 3A4OX 4U5JA 2JKMA 4EHZA 3C4CA 4D28A 5L8LA 4BCGA 4F9YA 2XJ0A 3DU8A 4BCHA 4BGHA 4F9WA 2FGIA 4FNXA 4NIFA 4KKHA 5AUUA 3TV7A 5AP0A 3RGFA 1ZY5A 2JC6A 4EBWA 4I0SA 4IWPA 2XEYA 5DFPA 4D2WA 4HCVA 2HY81 2AC3A 3TKUA 3V6RA 4YU2A 2FSLX 4QT1A 3BELA 2DYLA 2PZPA 3QTZA 4G2FA 3C4FA 3DAKA 4L3LA 3D7ZA 4O0RA 2F57A 2VWYA 3PPKA 4R1YA 2W1GA 4M12A 1UNHA 4Y73A 3VS0A 5LCKA 4AX8A 4PL5A 3FMMA 3QCQA 4KABA 3ORPA 5FXSA 4QMZA 2YM3A 2C5NA 4EOSA 2C5XA 3PP0A 5B2MA 3C13A 4QMTA 3RMFA 5IUHA 1L8TA 4FNZA 4G9RA 3RK9A 4JAIA 4IW0A 4QRCA 4IEBA 3AGMA 2HXQA 4ZTNA 5HU9A 1JKLA 4EH3A 2OKRA 3EQPA 3QWKA 4RSSA 3HMNA 4G3EA 5EOLA 4IH8A 5AEPA 1OPLA 4B4LA 3ZC5A 3CIKA 2RIOA 4E4XA 3OXIA 3W0SA 2JGZA 2VTIA 5TO8A 1SNXA 4RWIA 3W2CA 2Y4PA 4M84A 4YO4A 4KKGA 4O27B 1LEZA 3KC3A 3OOMA 3W1FA 3GOKA 5GJGA 3ZLSA 3POZA 3D5WA 3MB6A 4BDGA 3KGAA 3AGLA 3QWJA 4EK8A 3QUEA 4WRSA 5HIDA 3NUNA 4ZS4A 3QBNA 2XZSA 1NVQA 1GAGA 4GK2A 4EWHA 2ITQA 1G5SA 2WELA 4PV0A 3ET7A 3C7QA 3R7OA 5CF8A 2V7OA 5CENA 4BYJA 2ZVAA 3TEIA 3FLYA 2J51A 3TTJA 4BBEA 3VBXA 5AUZA 4UX9A 4AE9A 4CFFA 3UDSA 5CF6A 2HW7A 4KUJA 3F5GA 3F6XA 1U5QA 3UZRA 3CBLA 4UMUA 1VLRA 3KK9A 4O0UA 3ZZWA 4QDEA 3R9RA 2XIKA 3NGAA 4NW6A 1OB3A 2Z7SA 4UYAA 3P5JC 1QPEA 3RHKA 3ZRLA 5JKGA 1I44A 3AC1A 5JSMA 3BQRA 2ZB0A 3RPVA 3FLNC 4KBCA 4Z16A 3ROCA 3VS2A 2OJGA 1WVWA 5CF5A 3SA0A 1FMKA 3R7EA 1PF8A 4RJ3A 3UODA 2GQGA 3ZO1A 4YTFA 2J0IA 3RM6A 3R1YA 5HLNA 4O0SA 4YBJA 5L8KA 1FPUA 2IN6A 5IU2A 4Z3VA 2H96A 2WQOA 2B9FA 4EORA 5HOAA 4WRGA 3H3CA 2Q0BA 4IAKA 1YW2A 1STCE 2PZRA 2YZAA 5ETIA 3P79A 3OT3A 2KULA 1UKHA 4CNHA 2VWIA 4BDCA 3CPCA 3QZGA 1NA7A 1K2PA 1YI3A 3KU2A 1MP8A 5ACKA 3LXNA 4K0YA 4XX9A 3SRVB 4DDGA 2P3GX 2QCSA 4S33A 5IEXA 5DR2A 4DDIA 4QMYA 2GMXA 4AAAA 1UA2A 3C4EA 1LPUA 3Q9YA 4GK4A 2PK9A 5EHOA 4ZY5A 1T45A 3HRCA 5EDRA 2ITYA 3N9XA 5BPYA 3I5ZA 3LFSA 4IWQA 3PXQA 2CCIA 3L8SA 3R0TA 3SKCA 2YFXA 4LRJA 4EOMA 4H05A 2I1MA 3Q53A 3BZ3A 1YWVA 2WZJA 4A4LA 2YJRA 1R0PA 4AZVA 3LFQA 3KRXA 4ENXA 5KZ0A 2ITXA 2QO2A 3UNKA 4LMNA 4C3FA 4PQNA 4TYHA 3QD0A 3DTWA 5D7AA 3LM5A 3QTSA 4FT9A 2BR1A 1UNLA 4QMVA 5LMKA 3AT2A 3HV6A 3WF5A 4I24A 3G2FA 1LP4A 3ALNA 2B7AA 3MIAA 2OJJA 1YHVA 2JAVA 4BC6A 3A7GA 4U80A 4F63A 5JMSA 2BZIB 3PWDA 5FM3A 3AC4A 3ORLA 4GEOA 4IIRA 4BIBA 1PYXA 2HXLA 5IA3A 4FOCA 5DHJA 3I5NA 2JITA 5HKMA 4EOLA 4DT8A 4MKCA 4CYJA 3DAJA 2WIPA 3HL7A 5M06A 3ZS5A 3OBJA 2BDJA 4JBVA 3NYVA 4GU9A 4X6QC 2IZTA 3F9NA 4ANSA 5ANGA 4FKQA 4AACA 2R3LA 1Q97A 2BRBA 3A8XA 3CE3A 3QHRA 4ITIA 4NSTA 4BTMA 3UQCA 3SC1A 5BUEA 3DA6A 3HZTA 2W06A 3KB7A 3VS4A 5LVPA 4ZTMA 1EH4A 3PJ8A 5EI2A 2DWBA 3FZTA 4V01A 2YDKA 1V0BA 4D1XA 2IZUA 2UVXA 4ZIMA 4F1OA 5J79A 4JLCA 4U0IA 4R5SA 1V0PA 3NCZA 4D1SA 2F7XE 4FV8A 2X8DA 4YJTA 1H1SA 2B54A 3OW4A 3HAVA 4CFUA 3U8WA 3NR9A 4ZK5A 4FKLA 2XB7A 5AV2A 2EXCX 3NDMA 4OTWA 1YHWA 3R8PA 3WZDA 1Z57A 3QFVA 5JFXA 3LMIA 3NLBA 4NK9A 5A4TA 5J1VA 3PJ2A 4YJVA 3F5PA 2IW9A 3QRUA 3D7TB 4BFMA 5CI7A 2XKFA 4O84A 2CKEA