2RGWA

Catalytic subunit of m. jannaschii aspartate transcarbamoylase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
303
structure length
299
Chain Sequence
MKHLISMKDIGKEEILEILDEARKMEELLNTKRPLKLLEGKILATVFYEPSTRTRLSFETAMKRLGGEVITMTDLKSSSVAKGESLIDTIRVISGYADIIVLRHPSEGAARLASEYSQVPIINAGQHPTQTLLDLYTIMREIGRIDGIKIAFVGDLKYGRTVHSLVYALSLFENVEMYFVSPKELRLPKDIIEDLKAKNIKFYEKESLDDLDDDIDVLYVTRIQKERFPDPNEYEKVKGSYKIKREYVEGKKFIIMHPLPRVDEIDYDVDDLPQAKYFKQSFYGIPVRMAILKKLIEDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase
publication title Crystal structure of the catalytic trimer of Methanococcus jannaschii aspartate transcarbamoylase.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 105
structure length 299
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2rgwA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2rgwA01
4EP1A 1A1SA 2RGWA 4A8PA 4FYYA 2OTCA 3M4JA 4KGZA 4A8TA 1AKMA 2I6UA 5ILQA 4FYWA 1PG5A 2EF0A 2A0FA 1RACA 1FVOA 4AMUA 4KH1A 1RAEA 4H31A 1SKUA 3L05A 1RADA 3GD5A 4IV5A 4WTOA 4ANFA 2FG7C 2FZGA 3D6NB 1DUVG 1RAGA 3NPMA 4E2FA 4KGXA 3KZNA 2H3EA 4EKNB 2FZKA 2AIRA 4KGVA 1EP9A 1PVVA 1F1BA 4JHXA 3M5CA 1AT1A 3KZOA 2HSEA 4AT1A 1ML4A 9ATCA 2BE9A 3M4NA 1ACMA 4F04A 1D09A 2QG9A 1NBEA 1ORTA 1RAIA 2IPOA 1VLVA 3M5DA 4F2GA 6AT1A 1RAAA 1RAHA 8AT1A 5AT1A 4BJHB 1FB5A 1TU0A 2QGFA 3L06A 2BE7A 1DXHA 4OH7A 4NF2A 3E2PA 5G1PA 1C9YA 5G1OA 8ATCA 1ZA2A 2ATCA 1TUGA 4JQOA 4AM8A 3R7DA 2P2GA 3Q98A 1RAFA 1R0CA 1I5OA 3AT1A 1EZZA 1ZA1A 3R7LA 3TXXA 3CSUA 2FZCA 3GRFA 4FYXA 2W37A 2G7MC 3SDSA 4KWTA 1EKXA 3L04A 2YFKA 1TTHA 3KZMA 3LXMA 4A8HA 1XJWA 1R0BA 3KZKA 3D7SA 2FG6C 4FYVA 2AT1A 3TPFA 3MPUA 1Q95A 3UPDA 3KZCA 3L02A 4JFRA 3R7FA 1JS1X 7AT1A 5G1NA 1OTHA 1RABA 4KH0A
chains in the Genus database with same CATH superfamily
2HEGA 4GM1A 2NTYC 2YVAA 3BK2A 4TGLA 3U3MA 2C77A 4W8OA 2C95A 1NONA 2HIMA 5KQPA 5HKAA 5KSZA 3R3XA 4YRGA 5COAA 1VSQA 2V7EA 5A4JA 3DLBA 3DZHA 2EWMA 1HR0B 3AFHA 1COZA 2Q6KA 3VYRB 1FRZA 2Q49A 2C29D 2F00A 4LZOA 4Q7EA 3WSWA 1GGJA 3M4XA 3K9FC 4PPNA 2FMIA 3OIGA 3ZCSA 3MRVA 2BEUB 3KQSA 4WLVA 4ENQA 2Y67A 2WTUA 3ZVKA 3JVDA 1SOAA 1BKYA 2XZDA 2PJDA 3I2FA 4H4EA 4QBHA 1PR6A 4HKTA 3GFQA 3OQVA 3WMWA 3G2OA 4MUEA 3ORHA 3TLKA 1HFWA 1FJXA 4RZIA 4HNRA 1L5WA 2I6FA 2I6QA 2QD5A 4Z53A 3DDUA 2I3AA 3D1JA 4ZVTA 3KQHA 3ECCA 1XRQA 3CCCA 1J8QA 2AZTA 2J9ZB 3DDNA 4IKOA 4L0DA 3ZE8A 5BN1A 1P39A 1Q7RA 2X14A 4RACA 3HWRA 3QX8A 4JOQA 1CZHA 1KE2A 4E15A 3ETCA 5FV7A 4YCSA 2W6ID 1RJGA 2D13A 3OTOB 2YV3A 1J4AA 1XQYA 1FMTA 2IS1A 3D4BA 1DAKA 1GCUA 1GSOA 4DF3A 2IH5A 4L4YA 4M37A 1LPNA 3DW3X 4FINA 4NH0A 2NU6A 4HGPA 5HEKA 2VDOB 3EVTA 3C5CA 2Q9BA 3N0VA 4ZI7A 4NI5A 2QF7A 1MFPA 2FOIA 1WB6A 4NDZA 2VSYA 1AS2A 3Q9SA 5PGMA 2QMQA 1B73A 3QSGA 2JCGA 1UBHS 3A4YA 1XRMA 2E89A 3E3AA 3CF2A 1U8TA 3F6PA 5LIRA 3ADPA 4QXAA 4ETMA 3LH5A 3ROGA 1U0EA 3EFOB 1DQPA 4J07A 2QSZA 3VZCA 1AMOA 6REQB 3IUQA 1T3HA 2LCQA 1PL0A 4RS4A 4LPKA 4BNDA 1P5ZB 2R5FA 1MOSA 1ORVA 1C9YA 1VHLA 3FDZB 1VMKA 2JFFA 4FYKA 4HCJA 3W79A 1NI3A 4V24A 2XRZA 1DELA 1OLOA 1OFUX 2AJLI 3AVPA 2JLZA 4L0QA 2BFBA 5T3YA 3K09A 4L57A 5HZMA 4RZXA 1LWOA 4RF2A 5LD2B 4BMVA 3ZR4B 2NAPA 2R44A 1QP8A 1MJGA 3CH4B 1IFXA 3L40A 2DQZA 3P0EA 4V0MA 3GLGE 2A58A 1DINA 3M9WA 3MINB 5J40A 3RJMA 1X1QA 1RD4A 1PW7A 3QVGA 3U3KA 1OD6A 3JYOA 3ODGA 2LCIA 1PT6A 1Z15A 4UBOA 1XRNA 2AE2A 2FSUA 1JVNA 2LV8A 5CBPB 4JSYA 2AEEA 2AV6A 5BWBA 3GPIA 3QWBA 2I55A 3OJCA 4ZAFA 3ZDFA 1IXYA 3PNQA 3HRHA 4L9AA 1PHPA 5EP4A 4FGWA 4LW8A 2WHPB 5IBPA 3KLMX 2HJHA 1ZD1A 3OO0A 3V7FA 3KVNA 1N77A 5I9TA 3GCWA 3KO8A 2EP8A 3L4SO 1PU2A 3R7FA 3MMSA 2Y1LA 4N3BA 3PC7A 1ZICA 5JHHB 4LDNA 4S1NA 4CEIB 4W63A 3I8XA 3LVFO 3RUHA 1DG9A 1NQWA 4JJKA 1GU1A 1LS6A 4PLVA 4KU4A 1QF6A 1HL7A 2ZQZA 4W4TA 4OM7A 1B6TA 1CLUA 2RHMA 4NJOA 1SM4A 4ZAGA 4NBUA 1H2AS 4I4LA 1VC2A 3BX1A 4IHKA 4YJHA 4CT0A 5KYKA 521PA 3SQWA 2GPBA 2BR4A 4Q3EA 4PY2A 3WLRA 1K66A 2QRGA 3AQIA 2V54A 3BXXA 3KU1A 3KVRA 1D6JA 1U9JA 3OUZA 2AFVA 5F77A 4E4RA 2QAGC 1NR5A 3WA6A 5FLXA 4EA8A 4P93A 4ZMRA 1ZW1A 3C3JA 4JEUA 4B75A 3RSHA 1D2HA 2G1AA 4TLDA 4PNHA 1JTFA 5ALRA 3VBEA 3Q8MA 2IYPA 1OKKD 3U7EB 4OI4A 4UOQA 3VV3A 4AWXA 1Z5WA 2QZSA 1T9ZA 1YI0A 2BFCB 3N9IA 4QOHA 5A4MS 1FQOA 1QNFA 3OOSA 1GU0A 1R0WA 2FDRA 3NPMA 5SY9A 3ZXYA 3E23A 5KOJA 2J9FA 5COQA 1NFRA 1AD2A 4WNIA 4ZDIA 3RS5A 1A76A 4HNQA 4DCGA 4DLLA 2JI9A 3PRJA 1E3WA 2MR6A 3W4JA 4D9FA 3UJNA 2QS9A 1TDJA 4YJGA 3EZLA 4G41A 1NQOA 4KGDA 2YJ6A 2FN4A 1GSHA 3AETA 3N6XA 3U7IA 4G5FA 4AN4A 5BMVB 5DBFA 1TCVA 3BKWA 3RUDA 1NOJA 4LC0A 1L8XA 3UAOA 1DEAA 1XI2A 2NSLA 4NYMQ 4EA6A 1ATZA 1YJ5A 1UMBB 1YB1A 3ETDA 3ZK8A 1N5OX 1S3IA 1QG0A 1XZCA 4PX5A 2MSKA 1KYIA 3ZXSA 4CV0A 4QFMA 4RK1A 4PYJA 2GMWA 5EIEA 8AT1A 2N42A 4CIAA 1UPTA 4LY9A 5CK5A 4URVR 2O5EA 3WMFA 4NE7A 5A5VA 3COZA 3OU6A 5ICSA 1Y8QB 3ES9A 4F86A 3A27A 3SZMA 1VIVA 4GE0A 4P54A 2GN0A 3KB1A 4BE7B 3UAVA 4RJTA 3KL2A 1W19A 1HG1A 3OIVA 1PZEA 3AR5A 5F12A 1NFQA 4UCXA 7YASA 2XMBA 4ALIA 1MHPA 1U99A 4QDZA 5ETJA 4XJXA 1T8WA 3EUAA 3FTDA 3SI7A 3K1JA 5C7OO 3RUFA 4HAOA 3ZBUA 1BN6A 1T15A 3CZMA 7REQA 4RY2A 2FV8A 5C3UA 4F6LA 5J43A 1OI2A 2ASVA 4GM4A 4OI0A 4C5BA 4Z4IA 2GPSA 3B9BA 2VEDA 1NOIA 1QYRA 2GXUA 1CK4A 3FPKA 3HFSA 4D3YA 4TXLA 3SEZA 1I7SB 1MX3A 1XAGA 3HZOA 3I6BA 3R1IA 3ZUGA 2EFHB 2VAXA 3JQ8A 1ZCZA 5KPJA 1W2HA 3D4NA 2FF5A 1B74A 3TK1A 4YH1A 4BP1A 3KL4A 2PL5A 1QP7A 4R83A 4YHBA 2EDAA 3GXOA 2VH2A 3I1YA 4FSDA 5CMLA 4I1UA 4Q4DA 3ZVLA 4YO7A 4R3WA 5J2UA 3D0QA 1UXJA 3K9WA 1THTA 2QKYA 1PCXA 1BG6A 3V4OA 2HRZA 4DOMA 4TMZA 3EZ6A 5FEMA 2JAWA 3N86A 3R7AA 2XZPA 4R1SA 5JFOA 5JXJA 3H8VA 1EZ1A 4GI1A 2P9QA 4LF9B 2PXCA 5FOUA 4G2TA 1V8BA 2QQ0A 1GRNA 4DPMA 1BH2A 3NDBB 1IBRA 3C15C 4W8HA 1TKBA 1DPFA 5EIHA 1SGWA 5FDFA 4X7BA 1S3GA 2G1UA 4WL0A 5LYJB 3PTAA 3PWSA 5REQB 2BBWA 4ABTA 3A6JA 3VR3A 2AXNA 1N2OA 1W46A 2EX0A 4YP9A 1IXKA 1VL0A 4FI3C 5DSTA 1I7QB 4HWGA 3L79A 2FPLA 1C80A 2IXAA 5IBQA 5A3JA 4E3ZA 5JY6A 5L7WA 5LXTB 5MN4A 2EQ5A 2Z3VA 1T5DX 4D0LB 3PLAE 3MEQA 4RHFA 1AXGA 1J25A 4IV5A 4YJ3B 3FBGA 2P2YA 3IXMA 2AFIE 4ALNA 2Y92A 1OX6A 1TVCA 1SHJA 4LJ9A 2D5BA 3WHKA 3MCVA 1DUVG 4UNPA 2POCA 4W9NA 1GA4A 4H1WA 4I5GA 4J0FA 4IIFA 4J2TA 4L02A 1DTEA 4TM8A 1RLOA 2EV9A 2ZKLA 1SOWA 2RGAA 2W22A 3GV0A 1WSDA 4DB4A 3JD1A 1T1IA 2FK7A 3OIDA 5CCEA 5B5SA 5DLQC 3OQOA 2F3SA 1F6WA 3AEQB 1QTRA 3C3EA 3IUSA 4TS9A 4MYHA 1Y89A 2OAGA 4AXXA 4CKBB 4GICA 2C5AA 4AL4A 5JZSA 2HPHA 3RIHA 2PKXA 1E77A 2YR0A 4GI3A 3TLJA 4BO2A 4ZYZA 3E9QA 4EDHA 3AV3A 2XMPA 2AF4C 1W88B 1T9GS 3QXSA 4N82A 5I7SA 5T8KC 2B3TA 1OJLA 3KEMA 3NG1A 3RIMA 3WL7A 5JYBA 3WB1A 1GNRA 2X9NA 1AQLA 1TTPB 1JLHA 2BFCA 1Y3CE 5G0TA 3I37X 2GPYA 4C0BA 4TUYF 2VDWB 3GJ8A 4FQ8A 121PA 5FL7A 1Z4QA 1DC6A 1ZGZA 5F5LA 4RD4A 1DQRA 2JGKA 1X9GA 2XQFA 4M6WB 1CFZA 2R7AA 1EX7A 1O0SA 1I2BA 1NLUA 4L7VA 4OQPA 1BWSA 1KK1A 4MYTA 2IC5A 5LBTA 5KIAA 3AL0C 1JMKC 1U8ZA 4ISBA 4JLBA 3TOZA 3ZWDA 3ET5A 1FRFS 1UR5A 5CX1B 3K20A 2IGTA 1S02A 4J0KA 3WNZA 4AULA 2RHLA 4DSZA 3KWJA 4IH4A 4I9NA 5FBQB 3NHSA 4PCUA 3STUA 5KTKA 3O8RA 2XZLA 2Z9BA 2Q3FA 1UMBA 3NPAA 4E03A 1GG2A 3K2QA 4Y2GA 5A4DA 2ONCA 3K70D 3Q8LA 4U2FA 3P9NA 2HHAA 1Q1NA 4GPTA 3ZDBA 4LGYA 3VPBA 1DV1A 3AEZA 5FLYA 1JBKA 3K9BA 2PLRA 4ENTA 2ZBRA 4I5EA 1TADA 3AHDA 4A23A 1D2EA 3GMSA 5DW3A 4JLNA 1M83A 3U7HB 1H6BA 4NP6A 5EXSA 3QYPA 2YASA 1AHIA 3Q87B 2D1RA 3HI6A 2PNJA 3ZNQA 4EG1A 3A32A 5LJIA 3L9WA 4YT5A 4O4HA 1OHHA 1QYIA 3FMFA 1BXZA 4GQIA 4RD0A 2W71A 1QS0A 2AI2A 2ZUUA 3PXBA 2OBFA 4ND2A 1ZH4A 3WLNA 2PZAA 4GGOA 2YIJA 3P2YA 4ZAWA 2JJ8A 1J1IA 5BNIA 4R0VA 2RCYA 4U7DA 1MZVA 3EFEA 1G2OA 2GPTA 4Y1FA 2ZRHA 1LVUA 3H2HA 1WP9A 3HN7A 4N0EA 1WY5A 1YDMA 2FR8C 5CT8A 3D3WA 5D00A 4KV9A 4X1IA 4XCQA 3U4GA 4WOCA 1MC8A 2XUQA 1CJSA 3DZJA 2G8LA 3PQ5A 3T95A 4A6XA 4DLNA 2NX2A 1XAIA 1DPGA 1BW9A 4ZIRA 1RI5A 4WASA 2O1EA 3CLVA 1WBDA 2COKA 5FEUA 3RYCA 1ABFA 3UJ3X 3HDQA 2PRIA 4WTOA 3EMBA 2QTNA 3DQZA 4EY6A 3FHOA 2MMGA 4LPSA 1JHZA 2HK7A 2NOAA 3GGDA 221PA 4QBFA 2WSSA 1DXQA 4UCFA 4C0JA 3DZGA 1SWVA 3ZBQA 4NNJA 3TRDA 4Z7QB 4J29A 2F90A 4EFDA 1L9KA 2DCMA 2HPAA 3LT1A 1NUAA 1IEWA 3W1WA 1BDJA 2PKWA 3CEPB 4OLFA 4ZCTA 3IRVA 2QTWB 4AECA 2WKSA 3EMDA 1PX0A 4CKEA 3ZDCA 5EEHA 3E7FA 4I2VA 4DQUA 3L0CA 2ZXUA 4GOND 1U7OA 2A1IA 2FMFA 3HB5X 3N2LA 5G3ZA 1IB6A 3T7SA 4CZ2A 5JPCA 5FP0A 4AMBA 2QLBA 4Y2XA 1XLUA 4JQZA 3T7RA 5CH5A 1CUSA 2PRKA 2H2DA 4IHJB 4PYOA 4PCLA 1JDVA 5LXTA 3GPLA 3TQQA 1UDCA 2B8TA 2I4IA 1RHKA 2DF8A 4B6QA 3TSYA 1X7YB 2BJHA 5I45A 4W5HA 3DULA 5IEJA 5DI9A 3DVRX 3THWB 1NNEA 2VT6A 1YF3A 1Y9ZA 2CD9A 4LE2A 2RBEA 3MGKA 3TRKA 3UT0A 3VC7A 1NM5C 2EJBA 3KHTA 2FN7A 4ZJUA 3RJZA 5JAHA 1ZRHA 4AFNA 1T10A 2D06A 2DMRA 1MO2A 2XR1A 3F6YA 4IGKA 3SC4A 4AZVA 4EW1A 1TZCA 2R96A 4EGFA 5KJCA 1X7DA 4WXPA 2OB1A 4RIGA 3MOGA 4IJMA 3LQKA 3CLRD 4HZUB 1RPZA 3IVGA 4BNUA 4JZYA 3AEQA 3U13A 5M34A 3WAGA 2GF9A 2OECA 1KDVA 4P0QB 4PO9A 1EZZA 3NHWA 3Q3EA 3VHRA 1BQ3A 5EZYB 2PS3A 1EX6A 1NUSA 1O6ZA 3EGEA 3LXUX 1MB4A 5JQWA 3FRHA 1W88A 3E7DA 3QOFA 3E05A 3VJLA 5ITVA 1SEVA 4HC4A 4ESOA 4L8LA 4IIGA 5J2TA 4DMLA 4NBVA 2RAPA 4F84A 5CEFA 4CKWA 5GVSA 2OGUA 2E4YA 3I28A 3P9PA 2HA3A 4HDMB 2JIDA 1IDOA 1CUWA 2XB6A 3EIXA 1NN1A 3ETGA 3WGHA 3NWPA 1MJHA 1IZZA 1UH5A 2W2TA 2CFRA 1MB2A 5HS6A 3H4IA 2ODNA 1T0BA 1VFPA 3HU3A 2ZUFA 1LW7A 4D8VA 4LV5B 5L3RA 1ONSA 4RK0A 2QL5A 3TM5A 3ZZNA 1TLLA 5AH0A 2RHBA 1EZ4A 1G0OA 2H2FA 4JDPA 2A9VA 3KEQA 1OGIA 5AKKA 4UXIA 3TXYA 2XUFA 2XSZD 4LKRA 3WOVA 4AUEA 5CX1A 2ATXA 4JKIA 4RC9A 5HRUA 2VF4X 4LMPA 3RWOA 4HH0A 1U81A 1HDYA 4MV3A 2PYZA 2R8OA 1PR3A 4ZCQA 2OTCA 4GC5A 4QUJA 3W9YA 4ND8A 2DEUA 3VMMA 2PQMA 1PFKA 3PQ7A 2DHQA 1FQKA 1GGFA 1MA3A 1A9YA 3BTVA 3SXUA 2SKDA 5LMZA 2XTNA 1N5JA 5EKUA 1CS0B 2CFSA 3IMEA 2HJWA 3PKIA 4K5QA 4I3GA 3ZD8A 2WJZB 3IIJA 1Z12A 4XTCS 5JW6A 3FN4A 4LXQA 1QG4A 2CK3A 2VP5A 5DHFA 2BV3A 3TLAA 2HI0A 3QMMA 1B41A 1NYLA 1MAAA 1UMCB 4B6SA 4DDHA 2HDWA 3CVUA 1N9KA 3AJ9A 1YHZA 3ONEA 1VJRA 2IOYA 1OH8A 4CPDA 3WLEA 2VRCA 2EX1A 1MQ9A 3AY0A 3H84A 5ALLA 4G65A 1QO0D 3GT3A 4KGXA 1HE4A 4RMGA 3TOXA 5A1TA 5IDQA 4N48A 1DFGA 4MWDA 4P7FA 4TMKA 1Q0LA 4ZV7A 1XC7A 1FFAA 2WICA 3F4LA 4B8WA 3BL5A 1F51E 3CWQA 2EZ4A 2G0AA 3PR3A 1Y48E 4A0FA 2ZOSA 3I61A 4LJ7A 1PLJA 5FJIA 3K8QA 5AI6A 4UZEA 1HSOA 1I13A 3A1VA 3A70A 1Z8HA 3BSFA 3ELUA 2QJWA 3L4BC 4P0PB 4FWIB 5AUPB 4F06A 1MB9A 1RQLA 2F8LA 2R8BA 4KQMA 4WZ6A 2BZ1A 3NU1A 3TD2A 4AZ0B 3F5FA 3O7WA 3UA4A 2H1LA 5H3CA 1V7QA 5KBYA 1GGNA 1A95A 2QROA 3LDUA 3CF4G 4KO4S 2VP4A 2VCYA 5TXGA 1ABEA 3OJXA 1EDBA 2NZWA 4XYMA 4X90A 4YMIA 4J7XA 5CYPA 1DMRA 5IWCA 1RHUA 3UOWA 2Y9MB 4N3NA 1YK1A 1LNSA 4OG2A 4TYWA 1X1DA 1KJQA 1K5HA 2J7KA 2VK1A 4I36A 1JRLA 3O73A 3PFGA 3HTXA 5ED0A 2LDBA 1RWPA 3SNHA 3AJDA 4TL7A 1BROA 2FLWA 4MRAA 5TQ2B 5E9WA 1BEEA 3IP8A 4JS0A 5ALFA 3RTEA 1FTNA 2Q5CA 1YZGA 3HKEA 3SOPA 1ND5A 2C7OA 3WDLA 5TX7A 1RJDA 2I34A 1M6EX 3RS8A 5C1OA 1U94A 3HB1A 4ON9A 4Q9KA 5DM0A 2DERA 1M33A 3AIOA 3B38A 2HREA 1ZGAA 1RJFA 13PKA 5IJ9B 3I6QA 4JP3A 4CKCB 3RK0A 3IKJA 4IV8A 5KNBD 1HDOA 4FFOA 3TCXB 4GOLD 3OOYA 2D2FA 4TS4A 4YQYA 1NXWA 1LBHA 4KX5A 2E1RA 3DE0X 5IT0A 4CQJA 1XJ5A 2X0FA 3W3AA 5ED4A 1G9TA 4N4AA 1TKCA 3NJRA 4O1HA 4PC6A 3UC9A 3NV9A 1UEIA 3NQ41 1KZHA 1QIMA 2IYOA 3A2KA 4A36A 2QM0A 1Y33E 4BO9A 4TMYA 1QV6A 4HGOA 1AGYA 4GR4A 3BN3A 3II6X 4A0RA 5I4KA 2J0QA 5H82A 2UYQA 5EZYA 2QZ4A 3W7AA 1R8YA 3BYZA 4BOYA 4KVFA 5D85A 1ZOLA 4GW3A 5A7FA 4ZOLF 1XQVA 3FCOA 2OWDA 5SV2A 2ACEA 2I6UA 2GD1O 3JPYA 4IH1A 2HWKA 4X6LA 2G9ZA 3HV2A 4KACA 1WCIB 2BRUC 1NQTA 4NYIQ 5J59A 3B8HA 3GJ5A 4HH3C 4TV8A 2PH5A 3TQOA 1YQEA 1N1MA 2GKOA 4YV2A 3AF6A 1Z34A 5T4EA 1E1DA 1T5HX 1RXUA 4PZCA 4FXPA 2QG6A 4G1VA 1UBCA 4I1VA 4WJKB 4BC0A 3C87A 5JECA 1RRGA 1U9CA 4NY1A 1DO8A 2HA6A 1FDVA 1FFCA 4U2BA 2P1ZA 3RSGA 5I9LA 5KNLA 1PWYE 5JSUA 4BY9E 1JP7A 2C5HA 2CEKA 2ID7A 3EF3A 3GDHA 4ZU3A 4B81A 5TPWB 1XMOB 1OGJA 3ZHVA 2E18A 5HF8A 1VSVA 2PAFA 1PJ2A 2MSWA 1ZMBA 4ROSA 2VTBB 1PV4A 5EA2A 3M3DA 1M0EA 1E61A 4FHFA 4Y6RA 5BUCA 1UDRA 1NURA 2A9JA 1I1HA 2F8MA 4AS1A 4ER5A 2EWVA 1ZLXA 2OKGA 3PVSA 3EZ7A 4YI5A 4ZVKA 1P80A 2WKWA 1R8SA 3I4CA 3HXTA 3DMGA 2NTVA 3GEDA 5DLEA 3LHKA 1E2BA 1Z7GA 4FCCA 5BORA 1BX3A 5JH7B 3VR5D 3N0XA 3F67A 4NNOA 2GN9A 3T7TA 2ZI7A 4P1ZA 3ILSA 4CN9A 3PHJA 4UHEA 3VAYA 2YUIA 2QT9A 3STYA 3TUZC 2IHUA 4TVOA 5LQJA 4QU9A 2Q3EA 1YMVA 1Z3IX 1ORTA 4R2LA 5JJIA 4Y9RA 1UMCA 5AW1A 4B80A 1U2EA 3UK0A 5P21A 1OZHA 5AI4A 1OC4A 5GQSA 4B3GA 1UOEA 4RL6A 1W9HA 3E6AA 4RGYA 4XTRA 1EXNA 1IDN1 4GX2A 4FT4A 3EOAI 3AF0A 3ODPA 4MUFA 4RD1A 4O4JA 1R8QA 1V2GA 4EZBA 2OC9A 2DPXA 2APJA 1KI6A 3KB6A 4S05A 4TLEA 4XFKA 4ZVOA 4WCVA 3EMVA 1GZ5A 4CLRA 1OH6A 4C6TB 1MLDA 2B99A 4TL8A 1QIKA 1WZCA 1BYUA 1KQ3A 5ER6A 5JJCA 3O31A 1RAFA 1RXEA 1C7IA 5CU7A 1B14A 3LCCA 1YVPA 4UNSA 3SS7X 1E60A 1QUEA 1GAXA 1F7UA 3H9CA 5C7YA 4YAEA 2BGIA 4OM8A 5IEBA 2JAHA 3H7AA 4NICA 3EXHB 3T41A 1SG9A 1TMYA 2XAUA 1XEFA 3CX3A 2X4LA 4KXVA 1NRJB 1N7GA 2FMKA 2XUZA 2C4KA 3MTQA 4QJ4A 4P53A 5EESA 3VR2A 2C2KA 3EBOA 4ZMSA 4LG1A 2P9EA 4DFDA 1I8TA 4UHFA 3KZKA 3ZWXA 4HNTA 3D7SA 1OB2A 4YR9A 2QE7D 3WWEA 1OIXA 4GGPA 4DG8A 3UT5B 2C0PA 4IIJA 2H7XA 2D74A 3EW9A 1HMPA 1E3TA 1WPXA 1N6OA 4KL8S 2NQ2C 3PR2B 1NF9A 4LHEA 1BXRB 1O6CA 2X0DA 4A6DA 3V7NA 4TQUS 4ZVMA 4WJLA 3D8BA 3T6KA 3C6QA 2OCGA 3ECSA 1FFHA 4FQ5A 2P6PA 1W48A 2EYQA 2C5GA 1EQAA 4DGSA 3QW4B 1IBCA 4M0PA 5IDVA 4B43A 4HGYA 4KGZA 3DMFA 1SKMA 4GXRA 4EMUA 3N28A 2EWWA 3O2SB 5IJ9A 1WG8A 1UBRS 1ADGA 1ZUNB 5F2EA 4MW1A 1ZW6A 1S2NA 5FOXA 2CHGA 1R1DA 2CLHB 2C2GA 3K6JA 4HRXA 1OCEA 5CR9A 1H4SA 2XVYA 1WHSB 1KDPA 4JYAB 3IVXA 4XJTA 4PYLA 3X0DA 2UUPA 1ZM2A 3ELDA 4I1OA 4IJUA 3L4KA 1F2UB 5BQ5A 4QREA 3I9NA 4XLLA 1RPNA 5FCDA 1HFJA 1OBCA 3TSOA 3FHLA 1OXXK 1L7EA 2HBRA 5F33A 4HAVA 1E94E 4OD0A 4DRZA 2PUHA 3HA2A 3B3FA 1RXCA 4GQBA 3AVVA 2VP9A 4O29A 1CVLA 2GVZC 2R1TA 4RK5A 5BR1A 2XUJA 1TYDE 3B60A 4K26A 4KAFA 4F6RA 4ZZ1A 3RRBA 4UUQA 3Q7EA 2WIFA 1DE0A 5LM3A 2QVXX 3UMCA 2PFGA 3RUEA 1Y8RB 4JUIA 3QLEA 2GJAA 2P9FA 3IE2A 1HI9A 3E48A 1NF3A 3L0BA 4TYMA 5EP1A 1YA4A 1CRLA 1V71A 2WQZA 2I7CA 1EUZA 1JT2A 2XLCA 3DOIA 3EISA 2WJVA 1TEVA 2V7GA 3A6HA 3CA8A 1OLXB 3U4IA 4YMVA 3OBIA 2VZ0A 1Z6ZA 1JA0A 5A0VA 1K3FA 2G36A 3L1UA 1J8VA 4ETNA 5CB6A 3TJZA 2DZDA 2JASA 3BWEA 3NWEA 1P9WA 4GLBA 3NTLA 3OQBA 1M2VB 2PSHA 2P2NA 4MCHA 2Q6VA 5EJMA 3ZJ4A 4ID3A 5JNUA 2G6BA 5CG1A 4GPD1 4R40A 1G2IA 4UE2A 1XTKA 4GVPA 1E7RA 2G9UA 3ENKA 1RQRA 4CEJB 2Q4RA 2J5BA 5BXYA 1R0ZA 5IM4A 2VTBA 3UBMA 1QIFA 1M8GA 4AC9A 5E9QA 3H9QA 3HYNA 1FTSA 3QOWA 2OHVA 3T4XA 3E1SA 2P7HA 3ICWA 1ZC4A 1MNQA 2B1QA 2EZUA 4AM8A 4DLZA 3AP3A 4HLQB 1GRRA 4S12A 1I5OA 1E7QA 2JHPA 3L6DA 4Z99A 1Z63A 2EKDA 3PU6A 4LFAB 4G1UC 2AJ8A 4WKNA 3RWMB 5BPHA 4FYXA 4QDJA 3OFSA 1PNOA 4WI1A 2GZMA 4DC9A 1H23A 4YRZA 4ZA2A 3VYUB 5CA0B 4F6CA 1NBMD 5HXAA 2HA7A 4PO3X 5E8JA 3KWFA 2JK1A 1MCZA 3MS7A 2YRXA 4QPCA 1XVAA 3L0ZA 1JYSA 4BNNA 4M8SA 2WA1A 4LVNA 4JEIA 4BV8A 1NJ1A 4GBGA 4PLTA 1WULS 2CF5A 1C50A 1BKSB 1EWTA 1NN5A 1XK7A 3VSEA 3M3PA 3ZU6A 2GZSA 3P9XA 4RIEA 4DDWA 3NX4A 3K1YA 3WB2A 4D41A 3OZSA 2R7NA 4YASA 4C4PA 3TUJC 2OCYC 4W9MC 2O0JA 1QCZA 2VH5R 3L1VA 5AK0A 4ZFNA 2Q0HA 1LJ8A 1M34A 4LQDA 5KYVA 4AMYA 4I55F 4HQ0A 4AY3A 5G3YA 4CGYA 3AOEA 4UM5A 2GNPA 4BO6A 4MVCA 1OOEA 4PS0A 1U1DA 2XYRA 1RYBA 4AYTA 2AL7A 2P3OA 2Z30A 3GJTA 2CNNA 4J16A 4AN1A 5IC4A 3AEKA 3EXHA 4DTIA 4AY2A 1Y1PA 2VUIB 1SVLA 4ZKDA 1RDFA 1DC3A 5J9FA 1KYXA 2AYZA 5IJ0A 3BG5A 1IZ0A 2OFXA 2G83A 2WFZA 4EGJA 1HQKA 1X0VA 4RFVA 2PLWA 4MRSA 4TN1A 4KEAA 4FW9A 3TECE 1TPYA 2ZT5A 3LHFA 3A1FA 4J7AA 1WCYA 1P0CA 5ALQA 1ECJA 2D0IA 1NKSA 2I65A 2XJ9A 3LXRA 5KJEA 4J1QA 4IVQA 1Z0FA 1KVSA 3FG9A 5L4SA 4YRQA 4RZ3A 4DDKA 4IIDA 3UM9A 1XZQA 1QJ4A 1Z74A 1AK1A 2H2HA 3SD7A 1FK8A 1PZHA 4MYSA 1QH1A 5BMVF 3DYBA 1RAGA 3R3UA 4X1OA 5JZVA 3FY4A 5E4TA 1TVKA 4NBKA 4HVCA 1BU8A 2BC9A 1GYQA 4BQIA 1YI1A 3SHWA 3A1WA 1XVLA 1QC5B 4L9SA 4W6ZA 3Q2OA 3DCNA 1XHFA 3WISA 1L1EA 1Q2XA 1CY1A 2EQBA 1ZI8A 3CX6A 3HCEA 2VBIA 2P1RA 4H35A 1R12A 3GN1A 2FN3A 2GQ0A 1UKAA 5EPEA 3C3BA 1D7OA 5GADl 1ZUNA 4QQFA 3TEJA 3J7TA 1N9GA 5EIBD 2CNBA 3HNPA 5FBHA 4IZOA 3VMFA 2PY6A 4FC7A 1GPYA 1M3SA 3LRPA 1E9BA 5E2BA 5CA1A 2ZYGA 1I1NA 2E0IA 1L5MA 4AJIA 3TO5A 3WAJA 2WF6A 4RJJA 3VGJA 2PGNA 4WBNF 1WNFA 1KGSA 5LDHA 4RTRA 2PKQO 4QXMA 2CW5A 2N9UA 3H5NA 3IIKA 4K1LA 3IBGA 5TEWA 3PQ3A 1ULZA 1I2AA 3DB1A 1KSJA 4AG6A 4BU0A 2B21A 5EUBA 3S6JA 2ZWIA 3PWZA 3BICA 5AW8A 4F3RA 3ETEA 3LY9A 3PPIA 4NENB 4EFNA 1SU4A 1HKUA 3QG1A 1S8AA 3R0VA 4BQSA 4Z8XA 1FQWA 2V97A 3ZTTA 4HDCA 1J8FA 5DRTA 1OLXA 1U3TA 2IW1A 3FVTA 1P2UA 5B3JA 1AB6A 1EUDB 4ARZA 4B0PA 3S81A 3PE4A 5TARA 1SRRA 4C29A 1SU7A 5HG0A 2WTMA 2H07A 2X0NA 2PNFA 3B7PA 3MFYA 4FBLA 4U5QA 2ZSDA 1Q0HA 1OE0A 3T7AA 1IEXA 1DTWB 1PDVA 2VQSA 2ZBVA 3L49A 1OLSA 2JL1A 2VNKA 5CLIA 3VUEA 2IH2A 1XJWA 2R1VB 2O48X 5KWIA 2G08A 4Q3NA 4OJQA 1K88A 2FZVA 3K9LA 3PHCA 2CCKA 3QOYA 5CW1A 5IUKC 2BBSA 3U9TA 4CKZA 5KHLB 5EJ6A 1NXXA 4BFLA 1EE1A 1VLZA 4HX2A 3DAFA 1II0A 4L5BA 2WILA 4XA8A 5LYJF 5F7ZA 3GU3A 4EJSB 3N05A 1B0UA 3D5TA 4QO8A 5JDIC 1OXMA 4WX2B 3QF4B 2BSXA 4MVJI 5LP6A 1CP2A 1Y7TA 2IPAB 3HR4A 1EG7A 4P4TA 3SFZA 3WJ1A 3ZTWA 3MHPA 1OBHA 3I73A 1IULA 3FM9A 4JWTA 1JG3A 4MV0A 5ERYA 3IR7A 4GP7A 1VRVA 5H9VA 3V6MA 4ZREA 3Q1LA 3AHGA 4UBMA 4DMUB 4INAA 3FNEA 2JEZA 3CLTC 4I1YA 4YJ3F 3EVAA 5DEIA 3PF8A 1J90A 5AJXA 6YASA 2AX3A 4MWTA 4B9EA 4RY9A 3EDOA 1H6AA 5ALEA 1SZPA 1YZNA 2I4NA 3KUCA 4JI3B 1HLFA 3PQ6A 2B4RO 3EVNA 3REQB 1GNSA 4UPEA 3FF4A 2AK2A 3A6FA 4FZRA 2WNIA 4XD7A 1A4IA 1T5SA 1GPAA 3TWOA 2NZXA 3ISVA 3X44A 1W4RA 2XRYA 1ZMTA 4C7MA 2V7XA 1N6RA 2X4GA 4DCVA 4E2ZA 3BAZA 2LXNA 3D6HA 4I0WB 1K6MA 1X77A 4H2DA 5AKHA 4Y98A 3QXJA 5DNEA 4MUIA 1I3OA 1TYEB 2JKVA 3EQ6A 3OZRA 3CUVA 2V98A 4OXQA 1G17A 1Q0ZA 3E8SA 1FFGA 4BIIA 3F71A 2NU7B 1PZNA 4D9KA 1XDUA 4ZVQA 2QQGA 3EC1A 5IW8A 3PSHA 2PGOA 4OMCA 4KXLA 1X7GA 1NW5A 3BREA 1S89A 3P9SA 3WWYA 4KXFB 3WLFA 4HD8A 1D09A 3ZGXA 1SC9A 2JAOA 2QQEA 5LZ7A 3T5CA 1RYNA 3QUCA 1PG0A 3KOZA 2LIVA 3A4TA 2HA2A 2ISSD 1C3LA 4YRCA 4Y0AA 4P33A 2O8EA 3GN2A 4J91A 1VG9B 4MS3B 1FVHA 2PXHA 4OIFA 3K71B 4C2UA 3IMKA 4NE9A 1KVTA 1TE2A 2G71A 2O20A 2OCDA 4HH4A 1QIGA 2IZ6A 1JSRA 2ZQYA 4QGBA 1A5BB 1FXWF 1SOVA 2UVPA 3JD0A 1ZD5A 4DPKA 1KI1A 4BKOA 3AP1A 1P31A 4RSMA 4QWWA 1JBEA 5CGZA 2GZ2A 1M2JA 4LBYA 4M1ZA 4QQKA 2V7TA 4AU1A 1WAMA 4EQZA 1J1UA 5JIBA 4PG8A 4RKQA 2ORVA 3WV4A 3L7YA 4GWGA 4RD6A 2VP3A 5IKPA 3OAAD 3JSXA 4IDDA 3A1TA 4PG4A 3VVCA 4CR8A 2HR1A 3CN7A 1U1CA 1I3NA 3O92A 4NYJR 3OTQA 4NBRA 3D4PA 4AI6A 1OU0A 4ZJPA 4DV0B 2JGFA 4OHRA 3SZ3A 2O3TA 1H2XA 5EQJB 1RLJA 5H02A 1FDRA 4XJSA 4AY4A 2POQX 1J5PA 3TINA 2GO7A 2FRDA 1ZD2P 1NUPA 4ZCRA 1QLWA 4BZWA 4OBWA 4U2DA 2P3QA 4GECA 4AO8A 1SBHA 1V11B 3WYAA 3WIEA 4RLHA 2CMFA 2YWBA 3IBYA 1QKKA 1J2YA 1K3TA 1L7OA 2FMTA 1Z2EA 2XODA 3UYKA 4FZ3A 4KQWA 3RFUA 1W0JA 2CD7A 1GQSA 4C0QC 3MCUA 4UTOA 1GFWA 5BYJA 4I2NA 4NENA 3K7EA 3TW4A 4OHKA 2JIBA 2H54A 4LQ4A 5MF6A 1RE0A 2ZIFA 2PUJA 4NMLA 4PVCA 4CEHB 1GGMA 1JYEA 1NG9A 1C1XA 3PRYA 1GLVA 2W8BA 3NRCA 4QUEA 4EY8A 4DUZB 1FTWA 1BQEA 1X7WB 2AG6A 1EX1A 4JP2A 2VA8A 2ZSBA 1IM2A 2PKYX 4MARA 2JCBA 1LDNA 3CNEA 3I6MA 4LZWA 2NYAA 2IFTA 3QBVA 2XDYA 5AHWA 1U0HC 2QX8A 4JWKA 3R9XB 4BVJA 2W6PA 1PR2A 3OU7A 4K9RA 4Y1EA 1OV6A 4PGMA 1H66A 3IMCA 4HWRA 1E5XA 4M0FA 4UHKA 3OJ0A 3JQBC 5D3KA 3UGKA 4HL6A 5DI3B 2PT6A 3ZQ4A 3COJA 3RLFA 4HXEB 3WGIA 1RADA 4Z4FA 4JMLA 3ZW7A 1URPA 4EJSA 4QUHA 1DO0A 1PG2A 1UM9B 2IOQA 1KO4A 4LJSA 4ZN6A 1BDIA 1M5RA 3WY9A 3FZGA 3DVAB 4CL0A 3TKYA 3QE9Y 2RGGA 4IHJF 2XUHA 3ANSA 2B78A 3ESCA 1H8ED 5FAKA 2Z09A 3DL2A 2PU5A 1EVKA 1TUBB 4M7WA 4N7BA 1K5GA 3IQEA 3ZCTA 2LZ0A 5IVDA 2D3WA 1QXSA 2XCQA 4GZMA 2WVJA 4RH1A 1H05A 3H2GA 3GEEA 4O3FA 4TTQA 4C6SA 1QIHA 1UMDB 4P81A 4EA7A 3OZWA 2DTEA 5JVDF 3A2LA 3PJEA 2NNLD 2I6XA 3NBFA 2QW8A 5EQFA 2FSVC 5FUXA 3UMFA 3FCXA 4OP3A 1I0LA 1QVZA 3SZLA 4IX1A 3AV0B 5AYVA 4U7PB 4KPGA 3O4VA 3ZOZA 4DMKA 2D5IA 3OZUA 4WA8A 3WP0A 1W75A 3VXKA 1TGYA 2BTQA 2Q2WA 3AJ8A 4A2WA 1HNWB 1O54A 3BTUA 4H15A 4FEAA 3A4IA 3SC2B 2PZJA 2H1SA 1KETA 2G63A 1HBJA 2GN2A 4BAZA 2GFIA 5KUTA 5L3SA 4W5QA 3UPTA 3NS7A 4CF3A 3OQPA 4JT4A 5K3OA 2QJFA 1BS1A 1YC2A 4IMIB 5AXBA 3VPDA 1JE0A 1GTZA 4YMUA 2HYIC 4NEHB 4PGHA 4KE7A 4NKRA 1Q0RA 3NETA 1RYEA 4O2AB 3AT1A 1CIJA 2FUEA 4MW2A 4Y30A 4X92A 1IPFA 4ZEOA 3PRKE 2IEGA 5A5EA 1KERA 1NLFA 1R66A 1VPDA 2HIHA 2OMKA 1FRVA 2W37A 3INYA 4OB8A 3RRFA 3GUCA 3T9EA 4C01A 2WU0A 5CAEB 3ESRA 2BMAA 3I76A 4BO5A 2PBRA 2B20A 1CYDA 2HK9A 3WGOA 2VT7A 3OZCA 2H2WA 4A8HA 3LUBA 1SHUX 3CO5A 4HYTA 5KWEA 2LP4Y 3WWCA 4XEUA 5KYWA 5A02A 4JI6B 1TF7A 1I7DA 3U1VA 2FG6C 4C14A 1X1CA 3JX9A 4HI0E 4C0SA 1H94A 3SYRA 2DG2A 1RWVA 1KR2A 1VBNA 3UJBA 4GU5A 2HPVA 4E88A 4EY3A 2ILVA 3AKEA 4DCPA 2AOTA 3SZRA 4R1PA 3EXEB 3VV2A 3ZU3A 4RTOA 3PNLA 3GAZA 4LVCA 4MVWA 3WA7A 3D2CA 4OJYA 4MDHA 4YROA 4EFMA 4WCDA 1AA9A 4CQLB 1A2KC 1Z62A 3WO0A 3TOCA 1A1SA 1H8HA 3ZDXB 1HDRA 2QR5A 2C7VA 2CZQA 3OKAA 4NJMA 4BB9A 1Y3BE 4UFOA 5H68A 5DTQA 3UH1A 3NKLA 4Q1VA 3ONNA 1FFWA 1E3MA 1WF3A 3GK3A 3OF5A 3C4VA 4NCJA 3S2EA 3RFTA 2Z1DA 3LCMA 4MUKA 5BN3B 3DQPA 5K05A 2PH7A 3OQNA 3I2JA 3JZAA 3FWHA 5DF1A 1TXGA 1SK9A 2ONYA 1SQ5A 4HAXA 4PWZA 3B2EA 3KOYA 5FTLA 1SWWA 3CX7A 2IOFK 2OYSA 2IW3A 1O3YA 3DF7A 4LYDA 1WR8A 5FJJA 2QPAA 4NATA 4G0NA 5CURA 2GFHA 2REQB 3KJHA 3VPFA 4ANFA 4E1AA 5JQGF 1XLTC 1WCXA 3LDFA 4WFQA 3DXFA 2O7SA 3FOCA 2KLHA 3IO5A 5K3SA 4KTVE 1PFYA 1ZJYA 5JZOA 1Z5PA 4D0SA 2VOJA 5JNTA 1PVDA 1V5WA 2AN9A 2F9FA 4MEJA 4I3FA 3ZDYB 3EG5A 1VIMA 4CLOA 5L4NA 4B73A 2I3DA 3CINA 4FDMA 3FVQA 2PSDA 4YRKA 3HFRA 1T9DA 2PJUA 1D2AA 2BN4A 4GRDA 4MEBA 3DB2A 4TZ6A 3K4HA 1JLLB 1UJBA 4P84A 4QNMA 4A03A 1GCIA 2D8MA 5TQ0B 3QTTA 4Y1RA 4N7MA 3VPXA 4G4SP 3R9XA 2QORA 1WXQA 4U63A 4IOLA 4JBIA 2H63A 4H1TA 4RDIA 2G5CA 5D1NA 4FFMA 1U63A 4XWKA 2PZEA 5FUQA 5B37A 4MQEA 1ZIDA 1RAIA 3T0GA 1HTBA 1S9HA 3Q6IA 2ZE5A 5C18A 2O1SA 3NRBA 3RUIA 4GD3Q 3DVAA 1DKNA 4YIHA 4DV1B 2XE4A 4RSRA 3D1VA 2EX4A 2DKOA 4PW0A 1KTVA 2BE7A 5A06A 1SU6A 1UBOS 2EL9A 3O38A 2BDEA 1T34A 3LX4A 1TUBA 4DA4A 1KKLA 2XNHA 1ZA2A 2HH9A 2CL6X 1NVUQ 3STWA 4UTPA 4EECA 3C3AA 3HBJA 1XF1A 1R0XA 1N1GA 3NGXA 5FTKA 3EWIA 3QNWA 1QCCA 1KI9A 2FW7A 1UMDA 3GT0A 3IOBA 2AG0A 3ICVA 2VYND 3DLIA 3KVOA 3PNOA 4QUGA 4D02A 3U09A 3AY6A 4LXHA 1LBTA 3WHIA 2I3GA 3UAZA 3USZA 4BMXA 1GNLA 4D1YA 3LFUA 4DEVA 1RMQA 2W6CX 3BERA 3HVIA 4G5XA 3ZWAA 4Z1MD 4CIBA 2LPMA 2OEPA 4RXUA 3UXMA 1A9RA 1WUIS 4W5NA 2WYHA 1U2SA 1J33A 2X5XA 4Y9SA 1RSZA 2L17A 3FMOB 4C3UA 4GLJA 3QNUA 1CZKA 4HDOB 3QWFA 1SD2A 2ID4A 1Q3KA 4M8LA 2JKYA 4GAEA 3RHZA 4FB4A 2ENWA 2PO5A 3DTNA 2ATEA 4U39A 3A11A 4IVNA 3I0MA 3RAPR 4AXBA 5FH9A 1TJ3A 1M7GA 5DDIP 3CVYA 1P8JA 2CWDA 4IJVA 3DR3A 4RPJA 4XPIB 1W30A 2YMQA 2QUZA 2Z56A 3IUNA 1X7XA 1C8KA 1I3CA 2BJVA 2HRBA 2R4UA 3KHKA 4KODA 1XDBA 4IVPA 4CTJA 1OXVA 1NVKA 4QECA 3U7GA 4K9NA 4C20A 2P6NA 4DWWA 2DTDA 3G85A 3IDOA 4KXXA 5GM2A 4HWOA 1MIOB 4CI9A 3ZV6A 4NFYA 2PQ2A 1EJBA 3UQYS 2DBQA 3G8AA 3JYHA 1YUNA 4FHDA 4RE6A 3TLCA 3MLBA 3AR7A 9GPBA 2O3JA 2QSYA 4TN5A 3EXIB 4LXYA 3VPHA 3FPJA 3O4GA 2P7IA 1Q74A 2ZSJA 3BCRA 4K6CA 1RZRA 5DRYA 1II9A 4WY5A 3MWEB 1Z0KA 2I4MA 4LS3A 4X7PA 5JH7F 5JSZB 2P4UA 3KQPA 3FD8A 2HRQA 5B7GA 4HDSB 4ZT7A 1AHNA 1KS2A 1R88A 4Z86A 1KH2A 4BAGA 3OIYA 4LSMA 3I5AA 2R7MA 1YS1X 4KYUA 3RU2A 4OHPA 4OX9B 5CLLA 1KYTA 1RYFA 1YE3A 1M66A 4TT3A 1BOOA 3ADBA 4QYXA 1ZJWA 1XYGA 5FQNA 5AVUA 4ROTA 2EG9A 1SBYA 3DZFA 2HSEA 2JLUA 2PX3A 2BE9A 3U56A 4IV0A 1SUPA 4BVBA 5KKCA 1E8DA 3VU8A 4MB0A 2XKKA 2WWGA 2JH9A 1KWGA 1CUEA 5IN5A 1P8AA 2I0FA 1E1NA 2IX9A 5FULA 5EE3A 1DXYA 5KOJB 5LKAA 1TTTA 2PO7A 4FTWA 5LA6A 2REQA 4MV6A 4M0CA 2Z4TA 1E6CA 2DQSA 3K1AB 5ELXA 4JH0A 4BN0A 3N8DA 4WOJA 1XWWA 4MQ5A 2DH6A 3FH0A 4QDOA 1QHHB 4HG2A 1EG2A 4P35A 4X6XA 1Z38A 3CHYA 2XOKA 1TGVA 3JQRA 3OE4A 4ZTUB 2JFZA 4GL4A 4WGFA 1S5PA 3GJ4A 1ZNYA 2ZRFA 5CPBA 5EOVA 4YT2A 1JQDA 4FQ7A 2EOAA 3NHZA 1VOTA 2QV7A 3LKDA 3RH0A 1W7AA 4GMKA 4AZ3B 2PSEA 2DX7A 3OC0A 2OILA 1OT3A 3MJFA 1CQZA 3SE0A 3OPVA 3MB8A 3EA5A 4A27A 3PC3A 1JLLA 3GZ4A 3QEMA 5TQ0A 4OJKA 1KMHA 1Q50A 2L82A 2Z58A 4OMDA 3U48A 2WSYB 2QN8A 3HGQA 4UUNA 3V1KA 3NRJA 4KE9A 3TXXA 2WFMA 3LPLA 2OO5C 2VWQA 1JIIA 2HADA 3KAKA 5AK5A 1HQDA 3H1EA 5DYWA 1YR8A 2YFKA 2J4FA 2DR3A 2FZLA 3TSAA 3WRWA 4YAIA 2CDNA 1RZUA 1GHTA 2CB9A 5IAEA 4ZJZA 5LKRA 5HUHA 4X64B 4BLOA 1ZL2A 4J76A 5K0GA 2R00C 5F51A 2PJZA 4BVAA 1QFZA 2Y6UA 4G09A 5KDOA 2G4VA 3RIGA 1RI2A 1ZKMA 3C8ZA 4BVGA 3IHLA 5K8VA 4ND7A 1O95D 4R2WA 5EE5B 4H1UA 2AGVA 4QATA 1NI4A 3ZEIA 2A92A 2V3CC 1ZM3A 3DL7A 4J0EA 1Y6FA 3SN6A 2JFWA 2OCIA 4JJZA 4B6PA 1G0NA 3C5HA 2C03A 2BY4A 3B1XA 4FLEA 4Q02A 5F4BA 3IALA 3H86A 2Z2ZA 2ZJFA 2O8NA 3DH0A 3KLOA 4QDTA 4YQEA 5C5EA 2G0NA 2H92A 4LRUA 5LQAA 1I0ZA 2WOJA 3ESBA 3KSDO 1UZAA 1CVRA 1CRWG 3R5XA 4DE5A 3KFXA 3NAQA 2JGLA 3KUXA 4TTPA 2GSWA 4U2CA 2BFDB 1MIHA 2KSQA 3VHXA 4IW3B 3RVDA 2Z1NA 1VB3A 4PSCA 4C21A 4DM7A 1F3OA 2CHQA 3R5JA 2PMFA 2D7DA 4Y9UA 3NHLA 5F9HA 4LDPA 2AMFA 1V7ZA 4RD3A 5K9ZA 3KZXA 4ZDJA 1CJKC 3CUSA 1KZYC 4IKPA 3HVRA 1PK9A 4JLWA 1XZNA 4EI7A 2QRMA 5AUNB 1DCMA 1GVNB 3NHBA 3Q1KA 1X80B 5AW0A 1U1IA 4NV0A 5FA8A 3DF9A 3WNVA 4D0NA 1Q92A 1QQTA 2J8ZA 2HB6A 1YS6A 2Z1MA 2OZLB 2PMDA 4QYIA 4DNFA 1NC1A 3I9V1 3F9CA 2ZUDA 1KMMA 2FPOA 3OPQA 4MLZA 3HPQA 1C0LA 5BWLA 1VG0B 1XPJA 5KYNA 3W5DA 2YZ2A 2OFOA 4RA6A 4XPIA 1NUHA 3TEMA 2XYVA 4K3VA 2BMWA 2AWOA 3V97A 3ZJTA 4FIDA 1UODA 3WL5A 2V03A 3FTQA 1DAMA 1JPJA 1U0JA 4AJ1A 2EBWA 3MXOA 4YCMA 1IZ8A 3PEUA 3HS3A 4K9DA 5C51B 5CDYA 1U98A 1OXTA 2D54A 3J81A 4CDNA 4BKRA 2WSIA 5EJ4A 3CVWA 3IIMA 4MAFA 3T7IA 1WUYA 4K03A 1ODIA 3QU4A 3P71T 4DJDC 4L8WB 2YH2A 4B3XA 5BR7A 4V0SA 1ZIPA 1S2MA 3KE9A 3B6IA 1Z0JA 4M8KA 5FBRB 2FEWB 3L07A 1TO1E 1GPJA 4D3XA 4F3TA 2ZW9A 4RIFA 3T1VA 1L5YA 2ZUSA 2D4AA 2NYUA 3KDAA 2BVNA 4O2LA 2WF5A 3G5UA 3MWEA 1ZK0A 3EZ2A 1RLUA 2EVWX 3LPDA 1U0NA 1WDMA 1J0CA 1RFGE 3FA2A 3D43A 2WW8A 2HQOA 4J75A 4JQYA 1G8HA 1KSFX 1ZYUA 2E9SA 1NNUA 3NXKA 4G0YA 3WADA 4MP3A 2ORIA 2BT4A 3M83A 1BGWA 1ORRA 1U28C 3PQEA 1PJQA 1WPGA 4MWZA 4YEDA 1CZUA 3UGTA 5CA0F 4JGGA 1DXOA 5TJHA 2R7LA 4F2HA 4RY8A 2NUAA 1AHHA 1JQLB 9LDTA 3T7EA 4DQXA 4GOJA 1SKAA 1J8DA 1M1YB 2IHBA 3F97A 4JVOA 2PWZA 3O2JA 2I66A 4X71A 4KCGA 3IVRA 4LXUA 2JLVA 3HPRA 2YV5A 3GZNB 2B98A 3HJRA 3MGBA 2JGAA 2OCBA 4OVKA 3B3JA 3LX5A 3N5CA 5I7RA 1U2QA 1XQ9A 2CFCA 1J06A 1Y6JA 1PUJA 1AKTA 1EKXA 1G7RA 1EFKA 2ECOA 2YZNA 1YSCA 1PGNA 3G8DA 4I5FA 5CH8A 1RI1A 2V3VA 3WJ2A 1OFHA 1J49A 1NRIA 3T5MA 4D8YA 3OTWA 2AN4A 3U26A 1YZFA 3RC7A 2J3QA 2JW5A 3LGXA 4H6WA 4K6OA 2O7RA 2WFLB 2F1IA 3IT2A 4RD2A 3AR2A 1NQVA 3HUEA 3HWX1 1VL8A 4B83A 3VC1A 4AZ3A 3MPUA 5HS4A 5BMOA 3QI2A 1X6VA 4TLBA 1DAGA 4C7XA 3DNPA 1RQ2A 2RHHA 3CLHA 3KPJA 3T1QA 5DNUA 1P45A 3R3HA 1MV5A 3W2IA 4D4LA 3L7NA 3RR2A 4O4IA 1IN8A 4M89A 4DA0A 3FSJX 2IEZA 2ADMA 2BEWB 2I22A 3ENVA 5DGXA 5KYYB 4R9RA 1G66A 2XZOA 3O3MB 4HX9A 4E22A 2YHAA 5B6JA 1XTUA 4O59O 2VF7A 4LK3A 2KM1A 5IH7A 4YP7A 2BHRA 3ITNA 4F5YA 4QRDA 4MPTA 2EBHX 3W5VA 5LZ4A 1FS6A 2HNKA 2P68A 1N2ZA 1ATIA 2G8NA 4BNJA 3VNQA 3PXGA 5HIAA 1REQB 4AN0A 2XA2A 5IVHA 1ZH0A 3GBVA 4NBNA 4OL9A 2O07A 1SOMA 5JEEA 2JH3A 2QMHA 3B1KA 1XAHA 3GBSA 1TO6A 2QN6A 4YYEA 4DA8A 2PGAA 4RV4A 4RKYA 3VOBA 3ZLJA 2YJ3A 1TYAE 4HPXB 4UBJA 2B8EA 4P7GA 2X2FA 2P9JA 3I9MA 3SBDA 3C3WA 5BSFA 4R84A 2WM8A 3NTXA 3DHNA 2C99A 3DV9A 3IO3A 4QGHA 3EEQA 1UBNA 3LECA 4U7FA 5DJ5A 2YV1A 1LZKA 5DTIA 4BO4A 2DUWA 2ZWMA 4H7FA 4G0ZA 3W7VA 5TT0A 3L0IB 1K63A 1DI0A 1NPDA 4PIMA 4RS3A 1TU4A 4UU1A 5JAMA 4BMPB 1M8FA 1M6HA 1HE3A 2ZBPA 3REOA 2IYSA 1VPTA 3S44A 3W5IA 4R8RA 2YTZA 3ABQB 3NJ8A 1KBZA 3S2FA 4JP5A 5C8YB 2NO5A 4XEHA 2QLMA 2BEVB 2AFHA 2PEYA 2Y6VA 3H3JA 5CPFA 4YMHA 1E1RD 2R751 3BSYA 3GYBA 3I34X 3DFKA 3LNCA 3LUAA 4G0XA 5FR2A 2IYVA 4PSVA 1I5RA 5CGQB 2FCRA 1Y34E 3CG4A 2BUAA 4MULA 4P4SB 5GOZA 4OSPA 4CMJA 1S2IA 4GT1A 3WK5A 3I3OA 2TRSB 3DONA 2OZLA 2R8EA 4K1XA 2O8CB 2VDPB 2IUUA 1KPGA 3DMHA 3RVBA 1PK8A 4D0GA 2JIMA 4AP5A 4Z4HA 4WCFA 4R1QA 4CLDA 1V2HE 4E4TA 2NNWB 4AO7A 3J7AC 4E09A 4I1RA 2W6ZA 1SBNE 3PPWA 1K2VN 1PQWA 2H4HA 3I9KA 4ZO4A 1MOQA 4X8LA 3JR3A 5HWSA 1Z6YA 2IHKA 3V8MA 3NEAA 2HTFA 3LQ1A 3QIAA 2ZYWX 4IKEA 1FMJA 1V8OA 1Z82A 4L5YA 1QPGA 1F6BA 1EVLA 2OMEA 3FE2A 4GH5A 2A5GA 4M1KA 4ZO9A 3O8LA 4ZZ0A 4J6EA 3LCJA 1J9EA 3AB3A 5KHOC 3EF0A 3GJYA 3QELA 3M2PA 1QIEA 2V4ZA 3IPLA 3OURA 4AJOA 1ITZA 4C1NA 5MGNA 4TVKA 2H0AA 5KTOA 2I2AA 4MUBA 3O26A 5BV8A 4AF7A 3B6ZA 4ENPA 5IS2A 1VBKA 3UFXB 2P2CA 4F9FA 1QONA 1ZAYA 1GCAA 1UJNA 4KN6A 5DK6A 4LZJA 3L7LA 4TLCA 4MO2A 2DGDA 1W5SA 3RTCA 4AX4A 4BASA 2J0UB 2B34A 2EGUA 2Q8PA 2ZE8A 2PZBA 3ENZA 2RMKA 3H17A 3OOWA 5IJZA 1ZAKA 1O96B 2HSDA 4KPFC 1CQJB 4FSHA 4ALMA 3ICQB 3VAAA 1L5VA 2NV0A 4YAGA 1XMSA 3GUHA 1RABA 4G2NA 3U80A 4CHTA 1ZNQO 3E5RA 1WUJS 4AUKA 1MAUA 1OTYA 1PR0A 3PGXA 4YPFA 2IGBA 3GO4A 4ZXFA 5JO9A 2V5AA 2WK1A 3BWDD 1P61B 1R16A 1CFJA 3FOBA 1HGXA 3GZTB 1KEUA 4HAWA 2Q7OE 3WR5A 4ZPXA 1O5OA 4QYMA 1W73A 5L4LA 3CLSD 4H7HA 1EUYA 5JLAA 3IOCA 3IE1A 1IMOA 3NTOA 1DBVO 1VLQA 2VTKA 4KN8A 3NH9A 1R64A 1VJGA 2GM3A 1E9VA 2NYVA 2BBOA 2YY5A 2ZSAA 4FYWA 2CLFB 4H27A 3HUUA 1V4VA 2GAOA 1XTVA 2WPDA 4FX2A 4XWAA 5H3LA 5A71A 3EWSA 4DIOA 2G1PA 3LYLA 1ADCA 1K97A 2R2GA 2I9PA 2NZ2A 3ELYA 3QKWA 2NU9A 4UAGA 5DX0A 2JGDB 5FYDA 4EOGA 2W90A 4Y7CA 3AIMA 4JKOA 3QJGA 4G3XA 1R6DA 3PUIA 3M5WA 1UXGA 4TSFD 1XTRA 1DG1G 2FFBA 3AJEA 2FPPB 2CMHA 3CTPA 2I87A 3MXTA 1JUDA 4ILEA 2BDUA 5IASA 3CB4A 3F78A 5HVNA 4JK3A 4PLFA 2PCLA 3LYAA 1HV8A 1ZGCA 2NXNA 2XTZA 3ZIAD 4C4AA 1DX4A 4YC7A 1QIIA 1L5KA 4YMLA 2XNSA 3PUKA 2CF6A 2IVFA 3L82B 2GJ8A 5M3BA 4YY3B 1YQUA 1XZPA 2YYYA 5EIFA 3RF7A 2YRWA 1QGED 1ZCAA 1NVVR 3AVOA 4H3SA 2QYOA 3GLIE 1PF7E 5DGCA 2ZRCA 2WUEA 1AH2A 4CBVA 1UDBA 2QG9A 3Q3HA 1U7UA 4FFDA 1ZD3A 4LOAA 3THOA 1XMXA 3RC9A 4Q66C 4B3HA 1WABA 4NZYA 4AKIA 4HXFB 3KQKA 2ZYIA 1TC2A 1F2TB 1GRCA 3NYIA 1DHTA 2ZRAA 4RLSA 2P1DA 3T5GA 1C7EA 5LPNA 3L8YA 5L3QB 3SWWA 2G1JA 3VVLA 2XCLA 3PC4A 4S2UA 5EKTA 3HZRA 5KHAA 4C9BA 4EG8A 4HQNA 3OCUA 3EPRA 3K9CA 2O3QA 1SURA 3AF3A 3K3PA 4ARCA 4LXTA 2CNDA 3CLTD 2XMDA 3RABA 5ADUS 1QK3A 2GBIA 5TC4A 2G67A 5JISA 2NVBA 3ABIA 4UE3S 4DJEC 2YCBA 3RTAA 4M22A 1X42A 1F0KA 1SD5A 3I52A 4OH1A 4G1MB 2A9OA 4QEZA 1GUAA 5A9TA 4J94A 5FOTA 3TE7A 3HJCA 1FBNA 3EVDA 3FKSA 1Z73A 4GNKA 4DQVA 1M8JA 3GLKA 3QWHA 1YRYE 3WFZA 1LI4A 4YXWD 3QFRA 4NCAA 4KWHA 4BKPA 1EE9A 1NMQA 4XARA 3KZMA 5DIFA 5LR6A 2F3RA 1WDLA 2QTRA 6Q21A 4NPCA 3O3CA 4EUNA 1M6VA 1RTKA 3ACBA 1E32A 3R77A 4JA0A 1K9SA 3L6CA 3JRNA 4V39A 5HJ2A 5BW8A 1L5SA 3ICPA 3A31A 3DYIA 4W9NC 3B9PA 1VKOA 1AKEA 1P33A 1TQ8A 1XCBA 4G5SA 3RUPA 2DQYA 4MI9A 5AW4A 1Y5LA 1JFSA 1JEQB 1Z4IA 2GCOA 3OSZA 4IGEA 4MUAA 4OBEA 3WSTA 2OK8A 1Q0PA 4TOIA 2B36A 4IEFB 4X62B 5AW5A 3FVVA 1JS1X 1XXHE 3L93A 5CM2Z 1BVYF 4DSUA 5B36A 3GY0A 4X3PA 5LWHA 2UUBB 2WYUA 2IUEA 4C0KA 4V2UA 4TKUB 3L8HA 2WOOA 4BCDA 2JI4A 5D5QA 3K8YA 3CJTA 3PXAA 3I8SA 3PXUA 1QRDA 2W4QA 5H4GA 1TCCA 5K0FA 4BBJA 2GCEA 2WT9A 5BSMA 1JNYA 4N03A 3MAGA 2B4QA 3BMQA 1IJBA 1UP7A 1PFQA 3MWDB 1FTYA 2WJ3A 3OZGA 4KPUB 3NLLA 4PEVA 2IK8A 4RQUA 5IWAB 4FHEA 3C1AA 3VZQA 1SCNE 5EIOA 1W2WB 4BV3A 2EW2A 2YS7A 2ZPUA 5DZSA 1LA2A 5C1BA 1DS6A 3D8HA 1Q7EA 4R8KA 1CQIA 2ZI9A 1Q0UA 2ISQA 1Y37A 3MTBA 1DKOA 1ESMA 1SKQA 4MPRA 4MUXA 4P9NA 2WE7A 4LFCB 4TZ0A 2C88A 5JASA 3LI2A 1M72A 1V8FA 3V2GA 1KDOA 1VCIA 3U0BA 4KYVA 2IY8A 5JAZA 2WAYA 3LQFA 3IKVA 4CODB 3IILA 4PNEA 3K92A 5J1SB 4RHXA 5CDHA 3GGOA 5DM1A 1YB7A 5I3CA 5FBVB 1JEJA 2D2XA 2TSYB 3EEFA 3R6DA 1NPTO 3RODA 2WDZA 2JAPA 4NSNA 1TT7A 4TTSA 2OCPA 5EJ7A 4Q18A 2C0CA 4G67A 3A9VA 1AC5A 4MITA 4QQRA 3E61A 3STTA 4EPRA 2CL0X 1FFDA 4FR2A 4PX2A 1T6BY 2FRXA 1RYZA 4JZKA 3DTVD 1EA7A 4F04A 2KMLA 3KDSE 3STXA 3IEXA 3C5WP 3HKDB 2WFAA 1SBIA 3SIPA 3GJXC 1IYZA 3NFYA 5CVDA 2XJ4A 2JGDA 2Q2QA 4KC0A 2NVUB 5JMTA 3P5BA 5T3UA 1BMFA 5B1HA 2ARKA 2DXIA 5FTMA 4FKBA 3HB9A 3HMQA 4EVSA 1NVDA 3ZWYA 3R20A 1N0HA 4O2AF 5EUQB 3FYTA 1VSTA 4WLUA 4K88A 4YFVA 3WQQA 1VE1A 4V0ME 3GCZA 2C82A 2CJWB 3EZ9A 3KSBC 5EL0A 4DLUA 4R2HA 4CIVA 2QHXA 1E1CA 3RHFA 1Z4MA 3Q3GE 4Y2YA 3H2BA 3ID6C 3IV6A 4IM7A 4RMNA 1IY8A 2XYHA 5LCXA 1GLNA 2C4VA 4WBNB 3OJEA 4DLPA 2ZAOA 2WWXA 1AGNA 2OGTA 3M6MD 1E99A 1UBJS 1ZN8A 3PGKA 1VE5A 4ZYTA 5JJ5A 4ZP1A 1SXPA 1ZSVA 1O94A 2FH5B 1YS4A 4HWTA 5CXXA 4DDUA 2PH3A 3TGLA 1T5BA 1H5UA 2GYWA 5LZ8A 5HE9A 3K8OE 3GROA 4P7KA 3UW1A 3KSMA 4EI9A 1QRTA 1JG2A 3D8SA 5CB4A 4U02A 4JIGA 1SZCA 1DKLA 1R0BA 3I01A 4U2GA 1J7KA 2I2FA 5EWMB 3RF6A 1FP7A 5L3QA 1FVFA 1OIWA 4C7OB 4Q9LA 4XYLA 1Q83A 4CL8A 4WJZA 3SBEA 2FWJA 4MRNA 4ZRDA 1HG0A 2ETVA 5JYCA 2NV2B 4M54A 3VH4A 2WRZA 1EMDA 5JE8A 3TSZA 2P2ZA 1P1IA 1EFRD 1CUJA 1MG0A 1Y98A 2ID8A 3MB5A 3L6UA 1K7SN 2FPMA 3T7JA 4I9GA 3TDMA 3IR6A 3QBJA 4QSHA 5C31A 1DL5A 4UPVA 2F3PA 5LJLA 3B5EA 4BLUA 2GM5A 1XPUA 1P1HA 3P4UA 5HMMA 1GR0A 2H08A 2H4FA 1V43A 4E30A 5KDDA 4R8LA 1FTQA 1Y7LA 1OLUA 1DFHA 4HTFB 1YUBA 1XDDA 4I5DA 3T1NA 5TIIA 3VR4H 3KT8A 1O0BA 2WWHA 2Q4OA 4ATNA 5SZJA 2IZ1A 2NW6A 2DSNA 4K6KA 4R31A 3UT6A 1R6AA 3IPYA 5A03A 3RNLA 5HK9A 1IG0A 1QFYA 3L0OA 1ZBQA 4HN9A 4UU8A 1NXVA 2REBA 3P2JA 4DDVA 1K7XB 5KWJA 2C9CA 2AZ4A 1FNBA 4QARA 5PNTA 4UOZA 1P6UA 2IXGA 2MWMA 4I1IA 2VYVA 3A14A 3PQ4A 3WBFA 1GPLA 2YOFA 4PGGA 2CHEA 3NBQA 4WZBB 5CD1A 1T6YA 4MWSA 4PHHA 4JUFA 1JFTA 4QD3A 2LGJA 2C5SA 2EJUA 4HGNA 1W5EA 2QZJA 4X24A 4CNBA 1ISIA 5HBGA 1SUSA 1NIJA 4OGKA 5TMBA 3FPLA 3QU2A 5ADWA 1W5AA 1QHEA 1VSUA 2FPSA 2GUWA 3T5DA 3WRVA 3ZGZA 1YRWA 3RSFA 4FJ1A 4B6JA 3UHJA 2BHLA 4X1KB 3IHKA 3PICA 5IAJA 2P69A 5DK4A 1U3UA 1W96A 4CM9D 4JXXA 4YB8A 1SZDA 4L0MA 2DQ4A 1UZLA 3OM1A 4BFTA 4OA5A 1VI6A 4QXRA 4D4JA 1EFTA 1C0KA 3CMCO 2YL2A 5AVQA 1DARA 3E03A 4OFWA 1RKUA 2HXGA 2QE6A 4N76A 1U8YA 4FYJA 3B70A 3BGDA 3FTPA 1A7AA 4UHBA 3UJ9A 1I4OA 5CUQA 5BV7A 1W76A 4JLUA 1QYDA 3KTOA 2CXHA 4MGHA 3O8CA 2QTTA 2JLYA 1IQUA 3PX2A 4CT4B 1VHJA 3W5JA 4B4WA 4NDAA 5BSGA 3PFFA 2B25A 2NPOA 3I9V6 1GGHA 2FE1A 2AOWA 2KQUA 2SCUB 4KMMA 4WDRA 5JS2A 1NVGA 3Q9UA 2O5VA 3URKA 1KOGA 3PDCA 1OGYA 3VU9A 3DEIA 4QBIA 4J7UA 5F3RA 3ROPA 2ADOA 3DM9B 5ALGA 1K98A 1YB2A 4IICA 1NWCA 3DZBA 2HHJA 5C4GB 5A62A 3FPEA 4C7BA 3MTGA 4JC8A 2GTPA 2RSLA 4IAOA 4WFKA 3ZZMA 2FSSA 2V7VA 2FETA 5H3HA 5LWQA 4ZPJA 3H11B 4RVCA 4MDFA 4KQ1A 3S0JA 5TVGA 2G5TA 1HZJA 4BVLA 3U1BA 3T9DA 5K5EA 1TYZA 1GQ2A 3BIJA 3UBTA 4I4CA 1HLPA 5D8DA 1NWHA 2C96A 2WV9A 1MDBA 5WRFA 3DBIA 2XCRB 3QVLA 4MMYB 3H5VA 5CDTA 5D7NA 4FNMA 2ZATA 4HPJB 4PTLA 4WBNA 1AJEA 4R51A 1GUZA 3ZI0A 2CWWA 3A0UA 4WAUA 3TX6A 1RWBA 1OA1A 1WXWA 2WWRA 1ZM9A 2XDWA 1R9JA 2NAFA 3K4QA 4V03A 2M6LA 1CY4A 3R74A 16PKA 1G55A 2XUKA 4CYMA 5JALA 2CZGA 2J5QA 2G3YA 4RKWA 3U7RA 3VU0A 3ZBPA 4BN4A 2AZXA 1TUIA 4S3MA 1JV2B 5JEDA 2FN9A 2I2DA 5H0IA 4DSNA 2VAPA 2K2QB 4DPLA 1EXDA 3ZJUA 5MFZA 1YRAA 5E6UB 2GOYA 4XWOA 4K6HA 2XV1A 1JXOA 1V3TA 4IUDS 2YWFA 4LQLA 5D84A 2GEUA 3RYHB 1XDZA 1KZ1A 1M1NB 2PTHA 1CY0A 1LW6E 4CG2A 5B3LA 2VATA 4UD2A 4EB6B 4MNTA 2Q0SA 2FMHA 2ZU0C 3T3PB 4JJ7A 3FGOA 3VYSB 2GVNA 3FB1A 4N5HX 3ABRB 2XPCA 1L5RA 2H0QA 4GC9A 5CHEA 3W5CA 1DDOA 1M2OA 3CS3A 3G0IA 3IIIA 3NNSA 3UN1A 2G07A 3RWBA 1RFLA 1T2AA 2ZJZA 4BLSA 5L9AA 2OLEA 2Z9CA 4YUXA 2JD1A 3KQYA 2AIRA 4RVDA 4G1CA 1D5CA 1E79A 1OVMA 2H1RA 1PYDA 3N1UA 3IB3A 3WRXC 1EM8A 4E3WA 4CT5A 4WY2A 2V96A 4E46A 2HZBA 1IC6A 4MAMA 4JBYA 4R8SA 1P4SA 1KAQA 3SVLA 1MNAA 4FD2A 1UKYA 1GG9A 5H83A 3PL5A 4R5MA 4DJAA 1IBKB 3A6GA 3LNTA 4NK4A 2JIQA 5TB5A 4E5SA 1KXJA 5DN9A 4EX6A 2ZJ1A 3CU5A 4WT7A 3DVSX 4H6PA 3RBAA 3E9ZA 4KOAA 2EEZA 1XSEA 3NBAA 1YA8A 1IQPA 1XEWX 2IYLD 1R27A 3UGJA 3URMA 1FB5A 5D2CA 4OHBA 4WEOA 2CYCA 4ES6A 1HA3A 2VBFA 2YWHA 3JWGA 4OH7A 2ODQA 3HL4A 1E59A 3L8MA 3UJHA 1PL6A 1YVRA 3WBKA 3ZU2A 1RHRA 1RBZA 2AC7A 3DVQX 1TUGA 2MYPA 4TTVA 3PLNA 4PHGA 1UFVA 3FFTA 1JHDA 4X3CA 1E1YA 4X1KA 3TYXA 4XVCA 1KTIA 4RELA 1V48A 3DNFA 3K1ZA 1SVSA 4HDRB 4WUTA 3OOJA 1Z08A 5I51A 3P0IA 1G20B 3SQNA 2G82A 1YAHA 4H0FA 3GFTA 2ZRKA 1B2RA 1C7JA 1QYWA 1WMSA 1YDHA 4RESA 3ROEA 1WZIA 3RYFB 4BRZA 5JSYA 5CYGA 2AC4A 3AW8A 3LO8A 4PPYA 1FSPA 1WOYA 2ZROA 1V47A 2PZKA 5DX1A 4DSOA 4QUBA 5A0FA 2A0XA 4DLTA 1PFWA 1ZMOA 2OAQ1 4E21A 4I4TA 2NSHA 2AMYA 4UU0A 5LQCA 1KWKA 2O8BB 2D5LA 1Y6ZA 3DFFA 1SA0B 3EQ7A 3PYMA 5KNBH 4QDKA 5KI6A 2NO6A 4NX2A 2O3UA 2J08A 5FO0A 5F7OA 4MA5A 3C6YA 3WIBA 3VNVA 2K2WA 2G40A 1ZD8A 2LBPA 3ZWQA 2B61A 3MNFA 5HFNA 1TD9A 3DR5A 4OHOA 1JJVA 5JZ9A 4RGBA 1D03A 3BL8A 3STVA 1UBFA 4FNAA 1F12A 2GO1A 3KC2A 3LYHA 4QFCA 3FR7A 3PDJA 4MLPA 5KTPA 1CJTC 2CYAA 3HNRA 4TMFA 4FYYA 1BA3A 1KBQA 2WHRA 3E9MA 1WIWA 2JCYA 3AOGA 3GRCA 3CKLA 3OM9A 3P5SA 5FA5A 5SZHB 3FBTA 3H11A 5EUMA 2RJOA 4GRIA 2B7CA 4GXNA 2A14A 5E38A 4NFHA 1H4QA 4DREA 5F1YA 1JDJA 1MJ5A 1DEKA 1CIPA 4MP8A 5BYBA 2XCUA 3HUFA 3ANMA 5HF9A 3ZG6A 4HB4A 3O8QA 4DL9A 1RLMA 1NGSA 5MGBA 1PEKE 3ASZA 4M7RA 4JI5B 3G1TA 4UFPA 1IOZA 3I6YA 4OAPA 5K6TA 2DCUA 2PQ6A 1CQXA 3UV3A 1FLNA 3MJHA 3LPAA 1FP2A 1P6QA 2M32A 4EGSA 4WOBA 1NBHA 1NUQA 3DBVO 4F4JA 1TRKA 2H0RA 1I33A 1RYDA 1Z18A 2F4VB 1YOVA 1VP9A 3PC6A 4NNPA 1W8DA 2C2ZA 1NAHA 4RJLA 4D4IA 5CEEA 3RG8A 2C04A 4K6FA 4ZDKA 3CPJB 3S2YA 1KEEA 2XXAA 1Y1QA 2W6QA 3LLSA 4GIBA 1U2PA 3NCTA 1Y4SA 3OJWA 3V8NA 1G2PA 3NOXA 4CUJA 5DW0A 3QYJA 3ZWKA 5DCYA 3IJEB 3P27A 4G9EA 1ZK4A 3VR6H 3FOZA 2UZAA 4BLTA 5IJXA 1AQ6A 4M1YA 4D96A 5HKKD 3CLUD 5EN4A 2ATIA 2EKZA 1Z35A 1MFZA 2JIZD 3DAGA 4C22A 3QLUA 2V58A 3LTEA 4C5CA 3I5YA 4UREA 3EBPA 2BGWA 4CRWB 3GDOA 3K9NA 4EB6A 4L5AA 1YIAA 2A1UB 3AF2A 1RAHA 3BCUA 3IBTA 1QR6A 2HY7A 2J85A 2QTZA 3BHIA 3QEJA 1Q6ZA 3MERA 1TZBA 1ESCA 1W1UA 3TQRA 1E2JA 2Q41A 1V1MA 3GVIA 2Q0QA 3LWBA 5KOIA 4OGFA 1P7ZA 4BVKA 4CQMB 3HZZA 4RGVA 2C8KA 3O4HA 2WF7A 2GCGA 1VIYA 2YVUA 1TM1E 1UK6A 3OZEA 1JW9B 4PV7A 1V16A 1V95A 2HDNB 3C0KA 3AEUA 3S7ZA 5IARA 3WGYA 1M2HA 3WNBA 2OT3B 4A82A 1PJCA 3UOAB 3O9VA 2CXOA 1A82A 2ZUEA 4N0MA 5DNYB 3QPDA 3U37A 2V6GA 2XRFA 4R2IA 1I4TD 1PWXA 2EGHA 1C4XA 2VAVA 1PUXA 3I62A 2AB0A 1P2VA 3ETNA 3WJ7A 1TK9A 1T8TA 1K5DA 1AZTA 2YN4A 4ZALA 1O97C 1D0VA 1KY3A 3GT7A 3H2JA 1NNI1 2OE2A 1JDBB 2B2NA 4QHYA 5K0EA 4NYJQ 4IJQA 3LCVB 1EP3B 1XT6A 1Z2NX 5GWXA 3IA2A 3N2YA 2PX6A 4LOIA 1KIMA 3TAHA 3TTTA 2ZS8A 4BFYA 4UBIA 3I5MA 3G2HA 3ORSA 4KZKA 4U00A 1U8CB 1Z4OA 4IMJB 3NMUF 3KBOA 2JBAB 2PD3A 1TVEA 3G0CA 3L4JA 4N6OA 3R75A 6GPBA 3HUTA 2YQ5A 3S1AA 2OCKA 4B3SB 1AKNA 3BMCA 4NCBA 4DQ0A 3JAWB 5DPMA 1XJQA 4QLOA 2NZVG 3L7IA 3HBMA 3PE6A 4M4SA 1E4EB 2C4HA 1CEQA 3IHWA 3LCUA 1JKJB 2P6RA 1N1EA 5IDXA 2XOXA 1SXJB 3K5HA 1E6UA 5K8CA 2P6OA 5GOTA 2BKLA 5HJ5A 2JG3A 1UAGA 4FMPA 1JLRA 2JGRA 1LBSA 2XUOA 3S2UA 1I6MA 1Z6GA 3E58A 1BYIA 2UUOA 4G5QA 2PX0A 4DLXA 1NVWQ 2H18A 2GZDA 1G5HA 1IE3A 1ZJ6A 1ZY2A 2PWYA 3DHYA 1T3GA 4QTZA 3LUCA 2IEYA 3NC0C 3ZBTA 3TG8A 3AI3A 1X86B 3SIRA 2VUHB 4B9AA 3BF7A 1EBUA 2I7XA 4XGKA 2H4XA 1DWQA 5DP2A 2ZREA 1RPTA 3GGCA 1KH3A 1SA0A 5TV2A 3E84A 3VU1A 1NMZA 2X0EA 5KMGA 3ZU5A 2G77B 1E0AA 2K6GA 1EFAA 4KQEA 5C8YF 1FBTA 1JQBA 2R8XA 4FR0A 3RU9A 5BWNA 2PV0A 1OVGA 1NVFA 4EI8A 3EAFA 1EFCA 4FHGA 1NR7A 2FZGA 3G02A 2N1MA 1XYYA 2L69A 4PC7A 4LI3X 1DRVA 2Q5HA 2Q5IA 4LJYA 4A8JB 1NSFA 1JB1A 4JHLA 4FT2A 4OA8A 4QYTA 1A77A 1WW3A 2F2TA 2HJ9A 2ZBGA 3GCXA 3OCVA 1GV1A 1OKKA 1N5RA 1K1EA 3PHHA 2UKDA 4IO1A 4LYJA 1PJRA 3MJRA 4E5DA 5IKEA 1U0TA 4MKRA 1CRPA 1VMEA 2QX4A 4RHTA 2DFTA 1GPNA 3QKRA 1GQRA 2W2OA 1SCUA 3H1AA 4PYQA 2C8JA 3OUTA 3QITA 4UCWA 4Y9DA 1NBEA 5T67A 1ZIYA 2GD0A 2ZR0A 2W2LD 3BL6A 2R2AA 1R0LA 2AG5A 3DBLA 3GFSA 4NDNE 4POAA 4WQMA 2CXXA 2ZS7A 3ABOB 4R0NA 1US8B 2JPDA 1E7MA 2PVCA 2G80A 3QVVA 2GRAA 3AOEC 5E4JA 4C3OB 4C87A 2C58A 2HN9A 5JCZA 4F2DA 4F0JA 2QU8A 3G2KA 1GQQA 3M1YA 3C2QA 4LJLA 3T7DA 1ODTC 3CZQA 4J16C 4ZTZB 3MAAC 1JECA 2IYUA 3IP7A 3EXHC 4JCCA 1AKQA 4K0KB 1RKVA 1Z6TA 2XYPA 4QPNA 2C1EA 4PQYA 1RM4A 4YCJA 5FWXA 4MV1A 1GADO 2RJNA 2VKTA 2WT8A 2GD6A 2R9VA 3OX2A 4LAFA 4NBWA 4ZK6A 1EHCA 4JI7B 2VC2B 1IVYA 3HABA 3ISJA 2ZAIA 3TZEA 1GA6A 1A8UA 3ZEAA 4PAGA 1P4GA 1USKA 4L2IB 1MTZA 1TJPB 3EDMA 1S4MA 3ELBA 1YQ9A 3QX9A 2XKAA 4MVJH 2WM3A 4XX0B 3VKUA 2EF1A 3DE6X 5CM9C 1HDXA 2BD0A 3UNXA 1KEWA 3FYUB 3PUZA 5MN5A 3GA7A 4QOFA 3IE0A 5HK8A 3ETJA 1PZFA 3OSUA 1QQ7A 4DIDA 4V1CA 3VKHA 4TROA 5K0NA 4DR1B 2OD7A 1TZ2A 2R85A 4JB3A 4K87A 4OAOA 3UXYA 4CMIA 3FLEA 3B20A 3EASA 4TS1A 2AT1A 4N47A 5A2GA 1XNJA 2MSDB 2VUUA 4JVSB 1WB9A 4YRAA 4FGSA 4CU2A 1AN9A 3CC8A 3EPKA 5G1NA 4ZOAA 3RIYA 4C76A 1P7CA 1G5TA 3IJ5A 4YUZA 1ZNWA 1YL5A 3HFGA 4MPPA 4UXJA 3HLYA 3VR5H 3W2TA 4JB0A 3AZPA 1NW4A 3AFMA 2BONA 1CJCA 2VSQA 1YR3A 4W82A 4YR7A 1N2HA 1NU8A 4XWTA 4RTLA 2JIPA 5DM4A 3H5AA 3UB3A 2QVCA 4AG5A 1G2QA 3NAGA 3VKGA 4JLVA 4BE4A 1KRXA 3ACCA 4XI9A 2X7HA 2YW2A 1TCAA 3T0FA 2IX3A 2Z6UA 1B42A 2Q3DA 3HCFA 4DLRA 1QGOA 1N5DA 2O2EA 2QPTA 5B7QA 5K0ZA 3CVXA 2YJ5A 4LBZA 4YRMA 1STOA 4DLKA 2RHDA 5M04A 5J3JA 3QKSB 4Q47A 5HA5A 1LI5A 4BKUA 1E4EA 4PAWA 1YZHA 1UIMA 1HF3A 1QV7A 2HNAA 5FF9A 5B3JC 2VHUA 5AKYA 1XZHA 1K89A 4MUGA 3TD6A 1UQRA 1P4HA 3QEKA 2P90A 1JHRA 3ISTA 2OWEA 2IBTA 3GLQA 5F98A 1BX1A 3KJQA 4OJMX 3V6LA 4H0NA 2R6FA 3C39A 3DQQA 4C3VA 5JU6A 2XB4A 5L95A 1T2NA 2ZB3A 4ZT5A 1GR1A 5F7XA 1KAMA 4AP6A 3L0DA 4W5JA 3AVYA 3IFSA 1WMEA 4R2MA 4COOA 1WLYA 2BSQA 3LJKA 4LF5B 4ZICA 1KKUA 1Z2OX 4U4AA 3RVMA 1DT3A 2PK3A 4WKGA 1SRQA 5A4KA 5K0SA 2YN0A 2Z3WA 5EXPA 5H80A 4AKTA 2QN9A 1IL0A 3F6EX 3Q4GA 1HNXB 4PF1A 1V5EA 5AM5A 2N47A 3ZD9A 4KX3A 3GGPA 3BHNA 1SN7A 3DOJA 4M9ZA 4P2GA 1K7YA 4WZAE 5DOZA 5LP6C 1PL7A 3VFDA 2CBZA 4O2BA 3MLAA 1JSLA 4ESVA 3TM4A 1NT2A 1MPXA 4JL8A 2OVFA 3IEUA 3NANA 2VJAA 4DADA 3KOXA 1J2EA 3A6ZA 3KSAC 1KK3A 1RHJA 1MT3A 2CCJA 4OIMA 3TZLA 5BV1A 1EAMA 3K8ZA 4ZODA 2M6RA 3K2IA 1I0IA 2XWQA 3EW7A 5EFZA 3TQFA 5A5GA 5CLJA 1P72A <