2RH0A

Crystal structure of nudc domain-containing protein 2 (13542905) from mus musculus at 1.95 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
133
structure length
133
Chain Sequence
b'FEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALAVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NudC domain-containing protein 2
publication title Crystal structure of NudC domain-containing protein 2 (13542905) from Mus musculus at 1.95 A resolution
rcsb
source organism Mus musculus
molecule tags Nuclear protein
total genus 18
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2rh0A02
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2rh0A01
3J07A 2KMWA 1OZHA 3N3EA 2CG9X 4YLBA 4ELDA 2RH0A 4M5TA 3GUFA 3W1ZA 2XCMC 4YE0A 4YDZA 2WJ5A 3QORC 5DS2A 1WFIA 4FEIA 3L1FA 2O01N 2O30A 3EUDA 5DS1A 2Y1ZA 1WH0A 2BOLA 4ZJ9A 3VQLA 3L1GA 2MNWA 3L1EA 2Y22A 1EJFA 4YL9A 2CR0A 2Y1YA 5LUMA 2N3JA 2JKIS 4I88A 2K8QA 2WJ7A 3IGFA 2N0KA 4JUSA 1WGVA 3QORA 3QORB 4M5SA 4PBDA 4PCKA 3VQMA 1X5MA 3GLAA 4YLCA 2AXCA 3AABA 3AACA 3QORD 3O6QB 1SHSA 3Q9QA 3GT6A 2KLRA 1RL1A 1GMEA 4JUTA 4MJHA 4RZKA 3Q9PA
chains in the Genus database with same CATH superfamily
2BSTB 2W8CA 3UDWA 2ZXEB 4P59L 4NQSA 1UA3A 2PCFB 3BPLC 4MDIA 5J12C 5D7JB 3CFKA 3FGAD 4EN3A 1WZKA 3E2HC 5EHFA 1N7SB 1AQDB 4NBZB 3WS3A 1GCYA 4Q8BA 2B88A 1ZDQA 1QLEH 4PV9A 5KYUA 1JFHA 4YHLH 3UXFA 3WJJA 3HUSC 4PGDA 2X09A 3SCMB 4OF6A 1WD8A 5F7BA 4A2HA 2KHAA 5C0BB 4R4FH 3T1WA 3I50H 3W57A 1KGIA 1SQBJ 1P9MC 2YAFA 4YHKL 4HS3B 4PJDA 2DQDH 3ARXA 3BX7C 2RQ8A 1XZWA 2Q86A 1J0IA 3LHPH 4X5WA 5EZLB 1EEUA 1UZ6E 3QDGA 4ZW5A 4MA7L 3ZTCC 1EZVG 2JLLA 1PX3A 1ZJBA 2ADJA 3NJKA 1JJUA 2DLGA 5E6IA 1BIHA 5KSAD 4GQ9L 5ABAA 4F7PA 1DFXA 4AENB 1ASOA 1NBZA 3OBAA 3OAKA 2DQMA 4CC4A 3EO9H 4NQUA 4JPWL 2WVUA 5FV2A 3TFKC 3RZCC 3M0AA 3V95A 1OCWH 3CFEB 3RWJA 3OVUB 2GFBA 1LTIC 1F11B 4MB5A 5FYKE 1XIWC 2EXYC 4Y5YA 1UD2A 2ADFH 1ET8A 3L4WA 4FNUA 3A0HH 3Q5YA 1HUCA 3D71A 3BUYB 1K4CA 3IKCA 4JFEA 2I60L 1QSZA 4A6YL 1D7FA 4IRSD 2DQFA 4GAJL 3CXHJ 2P8LA 5JHDA 4MQXD 4YBQD 5AW7B 3N9GH 2LT9A 3UEQA 4L76A 1RUPL 4I89A 3SBPA 4D9QE 4DO6A 5I15H 2BOLA 3P4OB 3VFUB 4WUKL 3TWCH 1FG9C 2RKLA 4LEOB 1QA9A 3NGBC 1NTZE 3GHGA 3QC6X 1PLBA 3BGMB 1AQTA 5DJDB 3D39D 3VXRA 2QELA 4WNSA 5CEZL 5HVGB 1PV3A 2I07A 2DN7A 2Z0UA 3GRWH 1FBMA 4H4NA 4OSUL 3T04D 1JHLL 3PE9A 2LU7A 5I8KH 4BV1A 3V0FA 2QFPA 2YFNA 2BNQD 1H6TA 1IC7H 4JO3H 5TQ2L 2NUTA 1BOGA 2ZAGA 1X4YA 5APTA 1KACB 1XH3A 1OGSA 2FDBP 4QRPB 4EBQL 2OA9A 5CUSH 3EYUH 5AVVB 3V6FA 5T3ZD 2F5BL 2VLKA 4KXCA 4J3OF 4JGJA 4LL1A 2IGFH 1G1JA 3L9EA 2L7QA 2CCLA 4LZKA 2FFDA 1TZHB 5L7XH 3DURA 1H3TA 1KELH 3GHEH 3QIWB 4N9OB 1EDHA 2ESVA 4GG6E 1JEKA 5CM1A 1H5BB 1ZW0A 4U6HB 1JGVH 1K85A 5C0CA 1M2VA 4OVNF 1NIDA 4OQTA 5ICZB 3FO9B 1Z5YD 4E9YA 1VQLP 3RY4A 2FBWC 1NIEA 3T97A 1CD8A 1QSEA 2GTZB 2OL3A 3L3OC 5ICUA 4AK1A 3WAJA 3KYOB 4NQCB 1AHWC 4Y4FA 1BBJA 4KJYA 5TDOB 1A0QL 5M7QA 1BG1A 2NR6A 5F9JB 4IFFA 1Z1WA 3RWGA 1TJIL 2VDLH 3FOLA 3ZKXB 4NHUB 4M6OH 1CIUA 1RE4C 4LSSL 1WFOA 4QRSA 4XNZC 4B5ZA 3IWUA 3AGVA 1PPJE 4YK4B 5E1IA 5EU7C 1FL3B 2QQNH 2IDSA 3AZUA 3I3EA 5I71C 4FNPA 1RUKH 1SHWA 3UBGA 4I7ZB 5HHXL 1RY7B 3D07A 4AYCA 2AXGB 3ALWA 1MJJA 2BY3A 3GMPA 3D4YA 2NYYC 5AL0A 4ABWA 4K23H 3MYZA 2M8RA 2X7LB 3U36A 1G9ML 3O11A 3UH8A 4KK9D 2KDYA 2R3SA 1QEWA 2GUYA 2K8MA 2IFMA 3PFUA 2EZ0D 1NH4A 4KK8C 2EVGA 2IADB 3G6JF 2R0LL 1EFQA 1KXQA 2J8UA 1C8QA 2P67A 1HL4A 4IOSA 5AOKA 1CICC 2X4PA 5CEXA 2C3VB 3HUSA 2VAJA 4FFWD 4H1LG 1FIGL 2YSSA 4YDNA 1NGQH 4BD4A 3N0PB 1Y0LA 3OMZA 4NWTH 1P9MA 1ZWIB 4JQIL 3OGOE 1X5ZA 4JYBA 4AVKA 5L4FA 1UKTA 2AW2A 3X1EA 3G9RA 2O30A 1S9WA 4FA6A 5GRJL 2N9BA 4R84A 1F1AA 1HHJA 5K9OB 3NRPA 1IJDB 4GBXB 1QI4A 2WNWA 3DX4A 3OR6B 4M1CD 2O4EA 2O26U 3H54A 3QULA 2FSEB 3CH1B 2QHRL 3GTNA 5KN5A 2BHUA 1VA9A 1KIQB 3II2A 4XN2A 1FZKA 1A6AB 5T3XH 2XWDA 3TJEL 4EE2A 3RZCA 3AE3C 4ASVA 3IFNL 4R90H 1PZ5B 1QBMH 4RGOL 1YNKL 5D1XB 2BOCB 2YRZA 1T04A 3B4NA 5CIPB 5MI0B 3DECA 2DL9A 2E76B 3FZUD 5HI3D 3BWZA 1FGNH 2MTPA 4NKMA 4KK6C 1T1XA 1H88A 1HGZA 1JF5A 4FQLH 1YBKA 5AYUL 1H8SA 2KB7P 2CMRL 4G8AC 2VJ0A 5H2FE 5LCVL 2WN2A 5CBEA 2CO1A 4OI9A 3GW6A 4JJOA 5G4MA 4XP5H 4FLRA 3KR3H 4B0MM 4JZJC 1NA8A 4XNUH 3WFEL 5IHUL 3GUTB 1LTSC 1YQ2A 1OAXH 1HZHL 4GI8A 4AV5A 3MPCA 2X1XR 2F58H 3G6AA 3MUDC 1UT1A 3L1FA 1A7RH 2P8MA 3GBNL 4K9EC 1CI5A 1P1ZB 1KJ2A 2X4OB 3BD5A 3NN8B 1AI1H 3CCMP 3UTSD 3B5NC 2NYKA 4LU5H 3ABMB 4KKRA 4NCC2 3L4FA 1AC6A 4HOXA 1TVDA 3CHOA 3NJXA 3VFSA 3ULVL 4IFMA 3TESA 5IJKC 1GGUA 3HRZB 4NS0A 4JW3A 2AI0H 1UACH 3BCFA 3T77B 1TZAA 1EK3A 2G3MA 4PJGE 5T5NF 1KYDA 2F8OA 1G7LB 3T0EB 4M4PA 4R9HA 3KLLA 4RNRA 2X0WA 2R1WB 2XBTA 4MJIB 3BKYH 3DVNA 4NM4L 5PCYA 3CZKA 3OMNB 4EUPH 5JW5A 3SSUA 3UG3A 2ARJA 1BXUA 3V5HB 2AABH 3CDZB 2NZ9C 3LMJL 5I1AA 4G3YH 1YEFL 2ZG2A 4KUCD 4DGYH 1K73Q 1AP2B 1RH8A 1KIUB 3A6CH 3VO0A 4D7BA 4X83A 4TQEH 3H1KD 1I4FA 1IAKA 2H47C 1U8KA 1AHWA 3QQ3B 3KJ6H 1FS0E 2W0PA 4JLRA 2R4RL 3W0WA 1DZ0A 4NLAA 3AC0A 2YRPA 1HDMA 1JV2A 1A9VA 3CUPA 4NQSB 2VLJA 1RE4A 4MDIB 4LSTH 3CFKB 3K8KA 2WSSH 2DQJH 4EN3B 3CMOH 1FVEA 3MUY1 4IMLA 1JZFA 2HKFL 1D2PA 4JO2H 3WS3B 2E9GA 5F9AC 2EYSA 4PJAA 1PFIA 3VACA 2FHCA 2E59A 3P0YH 2ZVOB 4PV9B 4EIUA 1GL2D 5KYUB 1N73C 4TXVB 4U6VH 4BQCA 1RZFL 2B16A 2YR3A 4GSDL 4PGDB 5F1SA 3Q2YA 4XBEH 4ADIA 4Y16D 4PWEA 2VZTA 1QVGO 2HH0L 2EXSA 4FP8L 3SODB 3AQXA 4KQ4L 2G2RA 2AMGA 4DO4A 3GSOA 3H1HG 4PJDB 5KSVA 1AO7D 5I5MA 2Q86B 4ASWA 2E5TA 1JDAA 4KRNA 4X5WB 3L9YA 2NY5H 3S34L 1OLLA 3QUZA 2F53E 4J5VA 2R2BA 5I6NA 2VW4A 4UTBH 1G9NH 2ADJB 1J9CT 5E6IB 3VB9A 4F7PB 3PWUA 1CBVL 1NBZB 5E2VL 4OIFA 2VN4A 1G2CA 2XV6B 4D9RE 5JIDA 4Q9QH 3ZVVA 1WAPA 4MA8H 3RWJB 2GFBB 2YMKA 1AD9A 3LH9A 3ZHDA 2YGOA 1YY9D 4HKZH 4Y5YB 4HLZG 1AYRA 4OR1A 3C8DA 2W59A 2ZXAA 2GVYA 3HB3C 2DI7A 1EVUA 4TNVK 5LAXA 4BA8A 1K4CB 3IKCB 4JFEB 4KH2A 1BD2A 2RIKA 3VSUA 3K6SA 1NAFA 4AUUA 2A6KA 2BEQD 2DQFB 5CGYD 5D1QD 3WSQL 5GRWA 3NCJH 1MN4A 5K59E 4JRYA 4KX7A 2P8LB 1ETJA 4A7PA 1NKZB 5JHDB 1OAKL 5FYJU 3IU3A 3EOYG 2JELL 1CD0A 2SODB 3MV8D 1ZRUA 4UTAA 1QA9B 4IRSC 1OGTA 3QUXC 4U6YB 2D3LA 2Z31D 1UGKA 1WRFA 5K1NA 5FKAA 2GSGA 4N0FA 5KYNA 4MQXC 3LZFH 4GKNA 3VXRB 3A4FA 2FYYB 1AC0A 3WS6C 4ONGL 4AXWA 3VG0L 1WYJA 2I07B 1UA7A 2DH3A 4LDEB 3NJIA 3QH9A 3RDJA 3MVSA 1T8ZA 1VADA 3T0DA 5AW9B 2NUTB 1BOGB 2OPCA 3IT8D 4F58L 5J11C 1XH3B 5GZND 1Q0XL 5EF0A 3EYFA 4XWOD 3JT2A 1UZ8A 1JUFA 3CDGA 1AXTH 1AV1A 4BFRA 3MLUL 3T1FA 3V6FB 3IJYB 2DOCA 5ALCH 1GYUA 2VLKB 4N8CH 3QXDA 3MUDA 4JHWH 4U1KA 2AQ1A 3CLWA 2FFDB 5EF1A 1I9IL 2KZWA 3DURB 3CC1A 1I1AA 5JQ6L 5LN8A 1LTJA 3BJLA 2ESVB 5DUPL 4XP9L 3HHMA 1YECL 3ABKB 4XODA 1OAZL 2VZ1A 3BT0A 4WVZA 5F0PB 3SD2A 1CTMA 1CR9L 1M2VB 4N6RA 5C0CB 3VDCA 5IJKA 4MMXC 4PLKD 1UOVA 3KM1A 3FO2A 5ELIA 1HOCA 3T97B 3TN0C 4A2DA 1LO0L 2P5EA 3MCG1 3VI4F 4U1NA 5F72S 4XMPH 4Y4FB 1BBJB 4KJYB 4A7SA 4IKJA 1SQPE 4GMTL 4XO4A 2JMRA 1SJHA 5JO5A 3RWGB 3FOLB 4Z77A 5I6KA 2EEFA 1KUMA 4QRSB 2W8ZA 5EEVA 4U3FD 3M91A 1ILSA 2KP8A 5DUMH 3SWKA 1RZJL 3EYVA 3H1KJ 3GRWA 4JFFD 2VXTL 2YWZA 3OGCA 4QCIA 3N42F 1OSZA 3TV8A 3HEIB 4MD0A 2CLRA 2J73A 3D08A 3L4YA 3O6LH 1P5VB 1KIPA 3BVWA 4GW5A 1UEYA 3BKMH 1DUZA 4N0UA 1KOAA 3GMPB 3EDKA 4F80A 4NHCL 1A6UL 1L9MA 1HXMA 1U95A 1Z5LA 1RV6X 1XF4A 3ZK0A 3U36B 3O11B 2ZKXA 2AXTH 2CUIA 4JE0A 3D12B 4X4ME 2ZCZA 3E2HB 2RHEA 2GTWA 2FGZA 2ID5A 4KI5E 4LFHG 1QEWB 4N0RA 1NM4A 4NUGL 4GO8A 3US1A 1E4WH 2JIXD 2R5DA 1QTYT 1L0NG 2J8UB 3BZ4A 1L6ZA 3FH8A 1SXAA 2X4PB 3HUSB 3DOHA 4XN9A 3WI9A 2YSSB 2JKRM 4KK9C 5GHWH 2IQ9H 1Y0LB 5IVXE 3NTCH 3GZOA 4O9HL 1R5SA 1OCCB 1U8MA 1W72H 4PJCF 1MJ7H 1S9WB 1M57D 1ETB1 1I9JH 1G1KA 2HX7A 1NCDH 2DLTA 4HJ1A 5DWUH 5FS5A 4KTGA 4NN5C 1ZVYA 4FFWC 2B0SL 5IOPA 4NN6C 4AYID 1RVFH 5B1CA 1J8HD 2A4CA 3ZKND 5BOPA 3QULB 3U82B 5EEYA 2G3NA 2OP4H 2VZSA 1FHNA 2A2QT 3QZPA 5LBSL 3UEZA 4Z3TA 5KN5B 1FZKB 1I7UB 1MRDL 3RZCB 2ZWKA 3L7FA 1PJ9A 3MJWA 5JMRA 2QIWA 1MNUH 1OF2A 4XP6L 4HU8A 5LG6A 1GY1A 5EEXA 5BOJA 5E8NA 1T04B 1FYTE 3VFGH 4L75A 5KSAA 1GGIH 4U1SA 5F9WC 2HODB 3B5GA 4LASL 3VQ1C 1GDTA 2C9VA 3JWOC 3SQBA 2FXOA 4NKMB 2GIMA 1T1XB 1D6VH 3TCLA 1CLYH 4N87A 4FCHA 4GXVH 4EI5D 5CBEB 1FDMA 4N2IA 1RF0C 2WO3B 3H53A 1V3KA 1Y18A 4N8VG 3VFOA 1L4AD 4LAQH 4IRSA 3QWNA 3HRNA 1G9NC 2BVPA 3HVDA 1I8LA 1PG7W 4F5CE 2WQYC 1WEJL 3AUVA 1I8MA 3G6AB 1YPZA 2P8MB 3NZSA 3RK3C 4XX1E 2FK9A 3CLEL 2POHA 1RIVH 4HETA 3N1QC 5EULV 2O5YL 5L4IA 4B95C 3QGVA 2ODIA 3D39A 3VFSB 3GS0A 4C55A 1XBDA 3IJEA 1BWMA 3PLYA 1PX8A 3FPXA 4JFSA 2OYMA 1RKRA 1MHCB 4X6FA 5B3SB 5ITFA 4EF3A 1SOKA 2BNQA 5ICYA 4FQ1H 5KAQF 4RNRB 1UM6H 5JOPE 3CFNA 3DVNB 3E80A 1QWUA 5EWIL 4LCCA 1M7DA 3NIGF 2R4SL 2ARJB 4KAQH 1IQWL 3CWBJ 3WTUA 4IRJC 2ZYRA 3LD8B 4JM2D 3EH3B 3H7BA 3D6GA 3IAQA 5C39A 3ZKMC 3CX5D 3L4ZA 1FGVH 1XL6A 4MMXA 3AWGA 2UWJE 3GBMH 2X4NA 4NPYA 5KVGE 1QFWI 3PQYB 3RB5A 1I4FB 1IAKB 3RAJL 1U8KB 1UWGH 1AHWB 5C0DA 4JLRB 4D8PB 3W0WB 1RL1A 1BM3L 3U4EA 1YC7A 2JJSC 3SKJL 4U6TA 5KTEH 1JV2B 5A2AA 3CUPB 3RI5F 2RH0A 1OO2A 2JI3A 4W1TA 4EQ2A 4U3FJ 2BJMH 3Q44A 1FVEB 2JWDA 2GUVA 4IMLB 1VB9A 1OPGL 4MXQD 4XNZB 2R83A 3RHWK 3WBDA 2CRZA 2NY3D 4HWZA 1KFMA 2YIUB 2EYSB 4R6UA 4PJAB 1HYSC 4ZQKA 2DQHH 2NZIA 1HI6B 2VO5A 2Q9IA 3ELQA 5I71B 1MW1A 4Z7VF 3BQUC 3T08A 1YNLH 3BH8A 1YYMH 2I9TB 4FE9A 1F5WA 4IGBC 2YPVH 3DX8A 1QATA 2H7WA 3IDNA 2JFCA 5HHVL 2G2RB 4JY5L 4K3HA 1U3YA 3BUPA 3C5ZC 3DJSA 3GSOB 3S36H 4J3SA 5FOBA 2CJTA 1E4HA 4XC1L 3FTGA 4UV7L 5KSVB 3QJOA 4MVBD 2WTOA 2JWYA 3FT2A 3THML 3QUZB 2R2BB 4AIZA 1TT6A 4OFYD 3KXFE 4XPAH 4EUPA 1C16A 2ENJA 1LJMA 2K0RA 2LLNA 1T3FA 4OCYL 3PWUB 5EIVA 1G2CB 5F88A 2NY6B 1BFTA 3ZTJG 4AYEC 1VQ5P 2QMJA 5AD0A 1AD9B 1XF1A 5G5DA 2W0LA 1EMTL 5LAXB 4TUJA 5T1MA 1FAIH 2F1BA 4LC1A 3AE9C 3K6SB 2FJFA 1RJYA 1TJHL 1VFAA 2A6KB 4P3CL 3AADB 4OGAC 5D5MF 3NVQA 4E41E 3FCGA 4JRYB 2IPUG 1OV8A 4N28A 3TT3H 2QGCA 3I02A 1YY9C 2J72A 3I6SA 3L9RA 4HX1A 3GIVB 3IF1A 3MSPA 3F58L 1OGTB 4UQ2B 1CGVA 2G75A 4HIJA 1KENH 2JR8A 5FKAB 2GSGB 2DV6A 3QEGL 2HRLA 2EP6A 1BFVH 1WHPA 4HEPG 1YEWA 2AK4A 4N0FB 3BAXA 4OB5L 4RMRA 3S2CA 2EINB 4AXWB 3MLTA 3DARA 4ZUWA 1DR9A 4TUUA 4PI0A 1SEQH 1S8DA 2MSPA 1U8OA 3PNRB 4UOZA 1W8OA 1YEEL 3FFCD 5KANG 2Z31C 1VADB 4TVPH 3U2JA 1U3HD 2QGEA 3M9BA 2JCCE 3EYFB 1UZ8B 1JUFB 1BPLB 1ET5A 1JK8A 1M1SA 3ARSA 3CDGB 4K3JH 4L5FH 3SEPA 3T1FB 4GINA 3QXDB 3NCXA 2NY0D 2OMYA 1NIBA 2WY3B 3LS4H 2LKMA 3HG2A 3MXVL 3PAUA 4U1KB 4ZODA 4Z5RA 2ED7A 5L4MA 1YYLL 3RWFB 1I1AB 4HKJB 1LTJB 1PX4A 3FB5A 1S7TA 2M0BA 1YJDH 4DP0X 2XUWA 1QHQA 1AGCA 4U0QB 2R0ZL 4N6RB 3WD5L 1NCJA 1H0TA 5CBNA 3X14A 3FO2B 3PHOA 1ORSA 1HOCB 2X44D 1TTFA 4IL6E 5CFAA 4BK8A 2P5EB 4PYGA 1INEH 2QTVA 4U1NB 3MRIA 5CP3A 1T7ZA 5G2NA 3UTSA 5KSBE 4FNTA 3B56A 1BEXA 1SJHB 2J8HA 5JO5B 5APWA 4HPYH 4XPBH 4Z77B 1TNNA 5TE4L 1FG2B 3DGCR 2Z65C 5DGRA 4IRJA 4C4BA 5AW0B 1QYGL 1T0OA 3MUJA 4FULA 1JZ5A 4AJVA 3N41F 2K4AA 3B9EA 3VSVA 4D0CA 4OM1L 1BF5A 3GMNA 1THAA 2AF2A 2OTWA 3EYVB 1NMAH 3L72E 2YUZA 3OGCB 3DI2B 1OSZB 3QRLA 1IILE 4MD0B 2CLRB 2YZ8A 2E42A 1UUNA 2GT9A 4JFYA 3HA0A 1KIPB 4GW5B 4GRWH 3VI3F 1UWXH 1DUZB 1TQSA 3PWPE 4N0UB 4JO1H 2KS1A 5BCAA 4RGND 2BIQA 4EDWL 1U95B 3H42H 1HXMB 1XF4B 3KJ4B 4YSEA 3M1CA 1SOQA 5GTHH 4OZGF 4WV1C 2GTWB 4Y1SA 1A7PL 1GVIA 2AV1A 4XPGL 5LBSA 1Q94A 4DT0A 1JVKA 4X5XA 1X8YA 4G83A 3SGEH 4TSAH 3BZ4B 5IW1A 4HIPA 2NY4C 2BS9A 5HHOD 2AJVH 4HH8A 1F58L 2CRMA 4DH2A 2KK7A 3S1KA 3HN3A 2R9HD 2C9PA 3EJRA 1S1CX 2WPVB 1CN4A 3G6DL 2GW5A 5I8OL 4YDVA 1U8MB 3C5ZA 1KCKA 1KY7A 3HMXH 4QXUH 2WVSA 2ZXCA 4Z7OB 3W82A 1PTZA 1OFCX 2EUWA 3BN3B 1BYPA 2DMCA 1GTNA 5IOPB 1OARH 4Y16A 1JPTH 1EZVE 1CWVA 3EJZC 5CCJA 4I0PD 2P1JA 5D70L 5LGHL 4KOBA 4JFTA 4PV1C 4WK4B 1HQRA 3UBFA 1AO7A 5CJBA 1Q9WA 2B5IB 2HRPH 4ZXBD 4PI2A 3IBEA 3IF4A 1CGTA 2CHZA 3L7FB 1DJXA 3QAQA 4HUMB 1OF2B 2M2DA 3HLKA 4JDTL 2H9GA 2YEZA 1YZZA 3MV7A 1I1FB 2XPGB 3SPCA 3MDJA 5E6RB 5E8NB 3ZKNC 1UVQA 1ZY9A 5JW4N 5KSAB 4U1SB 2IDQA 3TYGH 3QXTA 2WZ5A 1TUPA 1EBPA 4HGKC 5DK3A 4N2KA 4WI0A 1S46A 1R34A 3FB8A 4OJEH 3SQBB 2CRYA 3TCLB 3WLWC 3ZJAA 3DSFL 4A2GA 1CB4A 3KHUA 2PR4H 3QZNA 2EEAA 3Q3GA 4M02A 4B9GA 4P5MA 4B7LA 2LVCA 2XXCB 4PH8A 4OKVA 3JC22 1FO0L 3K74B 3QZOA 4G7SB 1Y18B 3VFOB 5E5UB 4AE0A 5LGKA 1F2XK 1XTLA 4EZJA 4IRSB 2IFNA 1ZMYA 2D3VA 5D1QA 2BVPB 2YJLA 4OD1L 5CINH 5KKZC 2EDQA 3X1FA 2J5LC 4MAUL 4PHZA 4EI5C 2CJ3A 5GZOC 1I8MB 4V1DA 1VZIA 1YPZB 3BUBA 3MV8A 1PY4A 2V9UA 4GRLD 3VD9A 5SV4A 5B7EA 3LEVH 3RILA 4YOKA 2Z31A 2F7IA 1A7QL 1RIUL 2JVUA 1NPUA 3AY2A 3S8FB 2DJMA 4B3VA 5J11B 3D39B 1MAMH 3IJEB 1UXSA 1ID2A 3D3VE 3C2AH 1IVLA 2FUTA 4QXGH 2HFGH 3Q5RA 4X6FB 4TPRH 4RQQA 3NIDE 5ITFB 2BNQB 1ZMEC 1NCNA 5ICYB 1QWHA 3BAIA 2F7QA 1MHHA 2ZF9A 2ZKHH 5GZNA 3FTVA 4CNIB 4LCCB 1J87A 1M7DB 4MZRA 3NRFA 3AWFA 3ULUF 4NPDA 5FLUA 4A7TA 1ZPLA 5T1DH 1IFGA 3HD7C 1J7VR 3H7BB 3ARGD 4KPHL 4TNFA 2WIMA 4Q14A 2KKQA 4MMXB 1L5GA 3IGFA 4FQCH 4FLHA 4AIXA 2X4NB 4NPYB 4L1LA 2P24A 2R0WH 1KXVC 5C0DB 2UXFA 1FNLA 4Y0GA 1ZANH 5DFVC 3U4EB 4AYGA 4XH2A 4JB9L 4HCIA 3NPSC 4PJEA 2CBTA 1Z9OA 3UO8B 2EYTA 5EZOH 5GGQH 3VMNA 3QA3A 1BYOA 3LNFA 3BPCA 1U57A 4D9LL 3L3DA 1CK0H 5EUOA 3L73G 1FU1A 1IAIH 2DI8A 4HWZB 3DJ9A 3AQZA 2WITA 3CIQA 4ZQKB 4P49A 4GLRH 4RA0C 2J6WA 1A7OL 3V5KA 1CMOA 4PCKA 1WDAA 3QZWA 3BH8B 1YJDC 5J3HD 2GK2A 1NAKH 3DX8B 3IDNB 3VXTA 4YX2L 1TU3F 4JFFA 4NCC1 4V11A 4F1SA 4WV1A 5FOBB 4GIOA 3FTGB 4AOFA 5B66H 3FT2B 4GP8B 5D7IA 1XGTB 3LN4A 1R75A 2VE6A 4BQBA 3S2AA 1YAZA 3DHUA 4AIZB 5I0VA 1C16B 1BAFH 4YSDA 4CVWA 1HXYA 1T3FB 4P2YA 3IAGC 1WBYB 3D52A 1KV3A 1SUHA 2QMKA 2GPZA 3GMOA 4TVUA 4UV4H 5H8DA 3T0BA 5L9DL 1WJ3A 2JIXA 5F88B 3KDMA 2D73A 2HWZL 5DZNA 4AG4H 3ATDA 2BCCE 4AE1A 4N6JA 5AD0B 1UWYA 3DRQA 3VMAA 1NKRA 3K5SA 4IK7A 4PGZA 5G5DB 4NN5B 3S4SA 1PY0A 1T6BX 5DK0A 5T1MB 5GRYA 1PPJD 3VX1A 3IFPA 2BOBB 1RJYB 1L3WA 1VFAB 2FJFB 4Q52A 2Y3AA 5F3HA 5CD5D 3AY4A 1I85C 3WMQA 3DYOA 2CR6A 2OTPA 4YL4A 3I02B 3BLPX 5D93C 1H3UA 2BW5A 3WEAA 2OV0A 1E9OA 3L9RB 4HX1B 3D7PA 5KAIH 2IJ0C 3OZ9L 3IF1B 3IS1X 3V52H 1J8HA 2A9AA 2P5WD 2H32A 5GGVY 4X5PA 4DUWA 4HIJB 2XVKA 3GIZH 4UAOC 5F9WB 1GGCH 3ZZLA 3WGUB 1QBLH 4PGBA 3H1IG 3MLTB 3J27A 4FFZL 4ZUWB 1GZHA 1S8DB 1U8OB 1IC4H 2Y1VA 4K9JA 2PCYA 3AE8C 4PYHA 2OTUA 2GA1A 1ZTMA 5FC9A 2NCMA 5FGRA 4X4KA 5T5FH 3VA6A 4LLUA 2DWSA 1JK8B 2EIMB 2VDKH 1EXGA 1X22A 1TQVA 4EI5A 2IH1A 3ZQWA 2B77A 2OMYB 5E9NA 1U3HC 2EDOA 4Z5RB 1L4AA 12E8L 4R4ND 1AG0A 3OMAB 4QDGA 5E2UH 4OLZH 32C2A 4Y8AA 5JIHA 3IDUA 3FB5B 3B5HA 1S7TB 5G4OA 1NFKA 2BMKA 1AGCB 25C8H 4R26H 4ANKA 5IQMA 1H0TB 4ANVA 4YE0A 1QW9A 3X14B 3PHOB 1ORSB 4F57H 3PYCA 2CNYA 5HYJE 4JM4L 4APQC 1KDJA 5DO2C 5DS8A 5F93C 3UTSB 5DJCA 4FF9A 2ZCHH 1LL1A 5IJCC 3QXVA 2RD0A 4TNVF 2G2NA 3H3PH 3BRGC 4IRJB 2W27A 2RMNA 1IC5L 2HTLC 1SGKA 4D0CB 2FO4A 4XNXH 4F91B 2HZHA 5KLVE 1UM5L 2VDRH 3PDGA 5E2WL 2G5RA 2KLVA 4AL8C 4D3CL 1TMQA 2GT9B 4JFYB 3JXAA 4HG4K 4JM2A 4OGQC 1KTJA 1AZBA 1EAQA 2DIJA 2KS1B 2UVFA 4GPVA 3C5XA 3Q1MA 4YLQT 5E5MA 2K78A 1U3ZA 3QUML 2AV1B 2EIKB 2VDQH 1QBBA 1Q94B 4GFTB 2FY8A 1HE7A 3L1OH 3GHBH 3V5DA 4XAWL 1JGIA 1OVRA 4OI7A 5IW1B 1UT9A 3WV0A 1RUAL 3FYEB 4ZOAA 2QSVA 2LU4A 3U83A 1NGPH 3STLA 3AB0C 1O9WA 3EOTL 4YDVB 1OE1A 3T3MF 3C5ZB 4QWWD 2DYRB 3OJ2C 3BP7A 3WAKA 3DX2A 3VAEA 3BFQG 3BUIA 4WLCA 5AAMA 1GXEA 1PDKA 4FZEH 4IJ3B 3X3GL 4Y16B 3DMMD 4YLCA 1UFGA 1DBKL 1DD4A 1SDYA 3EG9A 1J5OL 1EDYA 1ACXA 1E40A 5I17A 4M48H 1I8UA 3SDXF 5BZXA 3RPKA 1HQRB 5IFAH 3ABVC 2PUQT 4YBLB 1AO7B 4LCYA 1I31A 1OM3H 4DFHA 1PIGA 5EU4A 2GC7C 3SGKC 3WJLA 2EH8H 2ZUVA 3WU1A 2H9GB 2YEZB 3MV7B 4I0PC 4OFYA 5APQA 1GSMA 4JCWA 1VDFA 1UVQB 2CLVA 3HI6L 4WHTA 2JB5L 2Z93A 5T33H 3D70A 1NUDA 1LNUA 4HWEL 4U4IA 3FB8B 2LU3A 5CGTA 2YA0A 1OK8A 1I85A 5ACMA 3Q3GB 3EBGA 4HBCL 4P5MB 1Q72L 4OKVB 1R5LA 4PJIA 4N68A 4B27A 3NCYS 3D2UD 4ZNEE 4M1GH 2G3AA 3MODH 3TV3L 4PD4J 5D1QB 4DKFL 1KBKA 2NNXA 4AQ1A 5JIPA 2MPAH 4TTDD 4Y4KD 2F53D 5F8QC 4V1DB 2YD2A 3QK0A 4L1TA 4XCFH 2G60L 2DM3A 3RG1C 1U33A 4ISVA 3MV8B 4PJXA 5DO8A 1W2EA 2WYHA 1BF8A 1KGUA 2MOQA 4F7CA 4NT6A 1D5IH 2P42B 2Z31B 3VWKD 5ESAA 2OM5A 3NH7H 1GS7A 2FGWH 1JGLL 4I3RH 2P28B 3OKEA 1G5GA 5B39A 1FVCA 3R1GL 1U8HA 1UXSB 2DWXA 1ND0B 3F2LA 2BNUA 2WLIA 5IBTH 4RQQB 5EORH 3VD3A 1B6DA 4ODXA 4LPYA 1U3HA 2NPLX 3NCFB 5ABDE 1MHHB 5AL8A 4X7SH 1TYJA 3MJ6A 1BAWA 4NI6A 2Z35A 1N5AA 3QDJE 4FGMA 4YIQA 3GC3A 4MNGA 1X6LA 4MAYD 1NL0L 4K15A 4PJDF 1B4JH 4KTEL 4H8HA 3EJQA 3AACA 1DVFD 2P24B 4IDJH 5E4OA 1XGQA 3L4XA 1WTLA 1XCQA 3I3BA 5DMJB 2YN3A 4DJGA 3GSXB 4L8BA 4XH2B 1ADQH 5B1JC 5IBLD 3ARGC 4PJEB 2VXSL 1UD4A 4X99A 1ZVHA 3BCCG 5EO1A 3PHSA 2EYTB 4S1RL 3S35X 3QA3B 2P9RA 3BMWA 3LJ3A 1A4KA 3BPCB 3L3DB 5EUOB 3FJTA 4H25B 4JPWH 4FTVE 2OZ4H 4JN1L 3CCSP 3CVIL 4ZPTB 3TIDA 3V5KB 1JMMA 1NLDL 1BQSA 3GBLA 2W38A 2E47A 3QZWB 1F18A 3VGAC 5SV3A 4X4YA 3BYYA 2FR4B 1N10A 2I60H 3AU1A 4A6YH 4HJGH 4EIGB 3VXTB 2AEIT 3L36A 5D55A 4JFFB 3QHZL 1ZV8A 1AXIB 1TTGA 4GAJH 4WV1B 1K3ZA 3KPSE 2MIZA 5I0WA 2VZ3A 5D7IB 3LN4B 4WUKH 2AXFA 5I82A 2VE6B 4Q74A 2NRGA 4ONOA 1JWSA 4KGLA 3S0PA 2BFGA 5HGDA 4J4PD 3CZJA 4WSJA 4DPRA 3GMOB 4JPKH 5EBMA 4FTDA 2VC2L 1SQPD 2JIXB 1XL4A 3KDMB 1QVOA 2Q1EA 5CEZH 2CSPA 1T03L 5AZ2L 3VNYA 4OSUH 5JHBA 1JHLH 3VP9A 5HHOA 3S4SB 1B88A 3DKHA 5TQ2H 1B0IA 1DDTA 3UTZA 5DK0B 6PAZA 1R5IA 3IFPB 1D7DA 3ECBA 4EBQH 3MHZA 5F3HB 3RWHA 5C92A 1N6QL 3BDXA 2DEYX 4MMZC 4WTZG 1Z2KA 1M57B 1R4XA 4UZGA 1PFOA 1ZLUH 3SGKA 1E9OB 4I0PA 3P73A 1AOHA 1J8HB 1XT5A 3AXIA 1E79H 2H32B 4M3LA 2HKHL 3IN0A 5CD5C 3CXHH 2WP3T 5BS0D 3RPBA 5I1GH 1N59A 3KEHA 4PGBB 1ZV9A 3ZE0E 1UH3A 4ZXBA 4HF5L 3GMLA 4IOIA 1FNHA 5AAPA 1N64L 2WKOF 2IALA 2CO2A 1P7BA 2HVJA 1EXUA 1G1YA 1KCVH 3QR2A 1IGTA 1A0QH 2OTUB 1QZ1A 3D0LB 3TPUA 1WD9A 5LBGA 2NY7L 1TJIH 2RB8A 4LLUB 2B4CL 3RKPA 2J5LB 4EI5B 3WGVB 2D9CA 4MNQD 3WJMA 4XO3A 2IH1B 2EVJA 2YWYA 2XA3A 4MZIA 4HAKA 1H6FA 5GS0D 2WP3O 2FX7L 4YPGA 2WUCH 4ZFOL 1L4AB 5D7SL 4JFHD 1QSVA 32C2B 3NPZB 4CU8A 5DVNA 2BS71 5HHXH 2BMKB 2V33A 1CDGA 1MWAA 2BVTA 1XMEB 5FFOA 3S3PA 4JMXA 1VQ6P 1G0DA 5A6MA 2PPAA 4WWKC 5IMLA 2RAMA 2H0FA 1E4XI 1XSKA 1FZBA 2H1XA 1G9MH 1FYTD 4R4NC 3ZN6A 5DS8B 2QADD 1S72P 3H7LA 2DYPD 2J8UF 3VB8A 1P84E 3BEWA 5AB1A 2R0LH 3QQNA 3ATFA 5L4JA 5JORA 5D9SA 5EMYA 3PAVA 4M7KH 1R19A 1FIGH 2VOTA 2ZUSA 3BWAA 3MNDA 5BO1L 5A2FA 4U1IA 2FO4B 3NCCB 4JQIH 5HXMA 4FNSA 3GLMA 3HCVA 2CHNA 1CXFA 2Z7UA 4HWNA 1J2JB 2NQDA 5GRJH 3F85A 3WFBL 3WU2E 4ZMXA 3TTYA 3L74G 4DQOH 4JM2B 3MUHL 3NPSB 2AMUA 3ARGA 4FQJL 3MLRL 5IUSA 2APTA 3BZDA 4GIFA 2VITA 2OK0H 1KCUH 5E5MB 5E6ZA 1C08A 1QPXA 3HFML 3F00A 4LLQB 2QHRH 3SBQA 7CGTA 3OSKA 5HYEA 3K4ZA 3TJEH 3V5DB 4HUWA 1JZIA 3IFNH 4RGOH 5JDSA 3FTSA 5DD5L 1O9VA 2KMWA 5E79H 3KGUA 4ZUSB 1UXLA 1I8KA 1DTUA 2KUTA 3M7OA 3MRBA 1SQXE 4FFYA 2RCSL 3GXIA 4UQIM 7PCYA 5JOPD 2NY3B 1V3MA 3STLB 5A2BA 2O6CA 1V7MH 3CG8A 5AYUH 4PJFE 3TSIA 3BP7B 2GHZA 3I6LE 2WB7A 2G3XA 5LCVH 3TPKA 2ZP8A 4DWHA 4K94C 4P2QE 5I1HH 3BRVB 1VPCA 4DK6A 1PDKB 3WFEH 4RIRA 1M1XA 4FQPA 1BVKB 3EG9B 4ACTA 3B9KC 5I17B 2ICEA 4GMSL 1HZHH 1KB5H 3L35A 3HZKA 4QWWC 4GG6A 5GJSL 3DO3A 4LCYB 2FX9L 4LSPL 2EKSA 1ZXQA 5EU4B 4FKHA 3S36X 2IBZI 5MEPA 3GBNH 1LE5A 3DMMC 2D7PA 2D2CC 5C0RL 2Q6WA 4RLDA 2J1YA 2CLVB 4WHTB 3U6XS 2HMIC 2WW8A 2Z93B 1V10A 4MSWA 1LNUB 4KKLC 4RFOL 4WENB 3ULVH 1SQVD 4U05A 2Z8RA 1HL5A 5K9JH 4MMZA 4OZFA 5MEQA 1Z0MA 2K9UA 2HLFD 3IJ9A 4LLYA 3ZRFC 43CAA 3L4VA 2Y3NA 1UCBL 4O2FA 3UERA 3W5NA 4PJIB 1N8ZA 3EFDL 3LEYL 2KYIA 3P9MA 3SQOL 5C0AE 5AVUB 2XI9A 4NM4H 2MHAA 3CFJA 2XPYA 2XZCL 4PREA 4WO4C 2F08A 4X6BA 4I0CC 4AQ1B 4UAOB 4IKIA 4NGHH 3SO3C 4OIAA 5E24E 3L2MA 1ZJAA 1WSST 2I24N 1YEFH 5LWYH 4F15B 3KXFD 1TVBA 4ISVB 4KTDH 4MBRA 4PJXB 4Y19E 4D6TE 1JGDA 5DD3L 5C09E 3RVXC 4YXWH 3S48A 3ZMNA 2N7BA 5DJYB 1NZRA 3N43B 4F7CB 4NT6B 1IAOA 4HSAC 2OR9H 2R4RH 4DAGH 4Z76A 5ESAB 2X2IA 4ZBJA 3BFOA 5BVZA 2X42A 5CU5A 2EEDA 3RFRA 1QR1B 4TTDC 1JZ2A 3VH8A 3LH8A 3OKEB 4GAAA 1FVCB 4BWTA 1U8HB 5B39B 5B4MD 1EBAA 2QPFA 3GMMA 3RKDC 2BNUB 2WK2A 4M7ZC 2HKFH 1AMYA 1W2KT 4GO6B 5DQJA 5E4IA 1U3HB 4Z7IA 5A6LA 3ORJA 1MY7A 4I1NB 3W9EA 2FLMA 3FUIA 4E41D 4BZ2H 3BGAA 2XN0A 4ZMLA 4GSDH 4PY8J 2Y7OA 2B15A 1WWWX 1MFAL 2Z35B 1N5AB 4FP8H 4YIQB 5E1HB 3POHA 5F0LB 4MNGB 4KQ4H 4PTUA 4WNQA 4Z0XA 2QQLL 3K81A 1PVHA 2YRLA 5BRPA 4BZYA 4UYPA 5SWZE 1XGQB 1OVVA 3RQ3A 1LDPH 2OYLA 4L8BB 4OLUH 3S34H 5HYSG 3P0VH 3IE9A 1QTSA 4X99B 3KZIH 3Q6FA 3NIFB 4N8PA 1CPUA 1ZHNA 5EO1B 4A63A 3UACA 1EJOL 3D87B 1DVFC 1A4KB 3EO0A 4JQVC 2CM6A 1ITCA 1CBVH 5E2VH 1YUKB 2ZPKH 5D4QA 3VQLA 3ZXAC 4DEUA 1D2OA 5A40E 5DJUB 3MA9L 3TIDB 1RJLA 3SO5A 4EIBA 3FXEA 3KNBB 1X5JA 4HHGA 1ZK9A 3AABA 4QGYA 3PXJA 2NXYC 3AU1B 3NP4A 5GS0L 1OTSC 5IVZA 2PP9A 1JFQH 3R8QA 4NJ9L 3WSQH 1YA5A 2YEQA 2KBGA 2FJSA 4KZ0A 4PRNA 1U3NA 2N1KA 3O3BA 2PTUA 3QJSB 3T3PB 4DEWA 2LR4A 2VLMD 4NZJA 1OW0C 4GOFA 3AS3A 3ARBD 2JELH 2AXFB 2CGRL 3IDJA 1WZ1L 2FYUK 2EDXA 1BZ8A 1JWSB 3CX5K 1MH5B 5HGDB 7PAZA 4LOUC 3JWNE 1XCTA 3EJYC 5E6YA 5EBMB 4EQ3A 2I69A 2CNZA 3TIEA 3AB0B 2WCSA 1FH5L 1A5FH 2DJSA 3CFMA 5FYKU 3VG0H 1QVOB 2X1WL 1MKMA 3VUAA 1RI8A 5CKAA 2LTQC 3S9OA 5I1DA 5HHOB 4PJGA 2DM7A 5FW7A 2QRXA 1JN6A 3LNIA 4EJ1C 3UTZB 2WBXA 5AUMA 3X3FH 3LXUX 1G6RA 3G08A 1ZLLA 1R5IB 4K0OA 3ECBB 4F58H 3VMZA 1Q0XH 5I6XC 3B9KA 4QTFA 3L72D 3SZ6A 1KULA 2CZNA 3RWHB 2AKRA 1OMIA 2RR3A 3MLUH 1OSEA 2WSFJ 1LEGB 3FUFA 3MBEC 1DX7A 4QTIH 4F1ZA 3HMWH 4AUYA 2W92A 3OHXA 2Z6FA 3DMMA 1E7UA 3GZQA 1Q81Q 3RPIA 4ELME 1I9IH 3P73B 4I0PB 2A38A 4M5ZL 1WIPA 3K5BA 1LQSR 4FN0A 4I13B 3SKUD 4BXVA 1UD5A 4PB9L 5JQ6H 5IQOA 4UT9L 5DUPH 1YECH 1ZAGA 3IMUA 2LABA 3FULA 4C83A 1N59B 1MSPA 3Q0HA 1SQVJ 4Y1AE 2JJTC 4ZXBB 3V4VH 4IOIB 3GRGA 5GJTL 3LZRA 3L70G 1SN0A 1JZ7A 2HCZX 4B50A 2IALB 3NQKA 3UGEA 4KI5C 5BUAA 3Q2WA 5ANME 2HVJB 1EXUB 4K35A 1IGTB 2X0VA 2IYOA 3TPUB 1X4ZA 4OFQA 4IFDK 1YI2P 4W9IC 1BZEA 3N6YA 5H37H 2BP5M 2IBGA 1WVZA 5JXAL 3RBZA 3WJMB 1BQHA 3ZBMA 1K6QL 1WAAE 2ZX5A 5KG9A 1EZVD 2XDHA 1KN4H 1EXHA 3TXAA 2X6UA 4YPGB 1RZJH 1PZAA 2YAHA 2WSEJ 1MCBA 2YQ3A 2A5UA 2FH6A 4I1RA 1A3LH 2ZJSL 3OC5A 1MWAB 3GI9H 1TEFA 4IW4C 4Y4KA 5DT1L 2F53A 3CHQA 3H0TA 5IMLB 1HHHB 1F3DH 2Y9RT 3ULVC 5C9JA 1MFDH 5ANHA 3IRZA 3U7WH 4JDVA 4JFWA 4HC1L 3V6BR 5DJ2A 3VWKA 1JP5A 4N2OA 3BEWB 2AJYH 1C5CH 3I74A 2QFRA 1E3FA 3L37A 3LXCA 4LNVA 5JORB 2FCBA 1IO4A 2XWXA 3JT0A 2CGYA 2YQBA 2DJUA 3PREA 2AS5M 1CLOL 3SJVE 3BWAB 4L18A 4S0SD 5A2JH 4GY4A 4O9HH 1T4WA 4DIXA 5KS9E 2F54E 3HCVB 4N1CA 2JKJA 2M8XA 1HHIB 3F12A 1VLXA 3UYPA 1D5RA 1TQBC 1MV8A 1PMYA 2BXYA 3GM8A 3ARGB 2H45A 4HXAH 3VDBA 2BFVL 3TJHD 3FN3A 2C9QA 1KILE 4MAYA 2FXPA 2VITB 4EI6A 5CGMA 3T2QA 1C08B 3EYQC 3ZOAA 1DVFA 3N2JA 3F7LA 4JQVA 4OLEA 3HZVA 3L73E 2CKNA 2P49B 4WDIA 4MXVE 4YGVA 4HUWB 1FZGA 3CC4P 1Z9LA 5JDSB 3D3VD 4JG0L 3LW5H 3ECWA 1I8KB 3OQ3B 4ODUA 1GZPB 4YDLC 3Q5PA 3S5ZA 3VGAB 3MRBB 3H9YA 2ROXA 3QUKA 4ZS7H 3SIKA 4LASH 3B8SA 3IDGA 1DQDL 4MJ4A 1TJGH 5IOKA 3OJAB 3KVQA 4N2FA 5CMAA 4UYQA 2JI2A 1RE3C 2Z64C 3V0JA 4RIRB 1M1XB 3FRUA 4HUCA 4AQ8C 3FN9A 3P4NA 1MIMH 2ICEB 4RVBA 3HZKB 2X4TA 3CK0L 2VDPL 4ZTOH 4GG6B 1WEJH 3QNZB 4QKTA 4Z9KB 1YPZF 4DGIL 3RLSA 3ZR6A 2QGDA 5MEPB 5TK2A 4B96A 4DJMA 1NUNB 4YSTA 4I2XE 4HCRA 1GHFH 5D7JC 5BW7C 4DUVA 4J4PA 5B7FA 2Q6WB 4ZJ9A 1OALA 2O5YH 4MSWB 3ESNA 5AOIA 5C6TH 3L72J 1BDDA 2J2ZA 3ZRSA 3GI8H 2K3RA 4LE8A 2CO4A 3FBKA 3H9ZA 4MMZB 4OZFB 5MEQB 4LLYB 43CAB 2Z8SA 2XIDA 4O2FB 3QPKA 4GO9A 4N2BA 4QRUA 2QJPC 1N8ZB 2IPPA 4YFLF 2YO3A 3P9MB 4IU2A 2WIIA 5LG1A 2MHAB 5EWIH 3HG5A 4PREB 2R4SH 4LIQE 4X6BB 2MNUA 3HE7D 4OLXL 2Z7YA 3AAZA 2CALA 1W8EA 4UTCA 2BHFA 5E6UB 4F8QA 4XBGA 1JY2O 3H1IE 1L0YA 2QBWA 3DHPA 1LD9A 1TVBB 2B89A 4HPHA 1QASA 2WM0A 1JGDB 4MCYA 3GXUB 4LPUA 2DIAA 4X4MA 3RAJH 2OI9C 4NXSA 1G7HA 1P53A 1IAOB 2Y23A 4Z76B 1BM3H 4OUOA 1SMDA 2AEWA 2MCG1 3VH8B 3D2TA 4BFKA 3U46A 3K71A 3GMMB 4ZFFA 1YN7A 1WHOA 1FJPA 4P5KA 2X4UA 4PRPE 3KPMA 1JCKA 1PFCA 5DQJB 2L04A 5IVXA 1U2CA 1IBFA 2ZXBA 3W9EB 1HVVA 5C70A 1CGSL 5JHLL 4LRIC 5KBKA 2NXZC 1ZVNA 1FORL 5FYLL 3GF8A 3OM3B 1IBGL 5F2FA 5HHVH 4GKGA 3V55A 4RDQG 1E4KC 4PTUB 4WNQB 4Z0XB 4I6MC 4KKPA 4X6CB 1G1OA 1IB5A 4XC1H 4EUPG 4PLNC 4UV7H 2MKVA 1X5HA 1DLHA 1XGRB 3CCJP 3CFBA 1FF5A 5F7AA 4YMPA 3THMH 1NCCL 2J6EL 2I25N 2ZQKA 5ADPL 5IFHL 1VF5D 2B1HH 3Q6FB 1ZHNB 3EO0B 4OCYH 1FYTA 1DJZA 4TQHA 3AROA 1A3RL 1J1EC 3HG1D 2J20A 2IBZG 2DYPA 3GGWA 5C7XL 3DPBA 4GSUA 1ES0B 2VR7A 2L4OA 4CMHC 1RJLB 3CX5I 1IGML 4P3WA 3HNVH 3JTTA 4OAWA 3H6PA 1K9TA 2C0WA 2W0FA 5T1JA 4JPQA 1Y1UA 3MRHA 4NQVB 5IVZB 2R3CA 4P3CH 3IGAA 2ZAEB 1A22B 4PJ0H 4HKXA 1OWAA 4PRNB 5EZIL 3O3BB 4F5CA 1VQ4P 5GGRA 3D25B 4BWWA 4H2AA 1KBGH 2X70A 3LZLA 4QHLA 4DKAA 3IDJB 4KO5A 1RIHL 3C9NA 3VFNA 3VXOA 5HYJD 2DQIH 3ZT7A 2BP8A 1DBBH 2AAAA 1Q7YQ 1NTZK 1XCTB 1XSJA 4XI5D 4G9FD 1EFXD 2F6AA 4OB5H 2B2XL 3ELAT 3IMTA 2BC4A 3TIEB 3P3TA 2Q3EA 1ZLDA 5CCHE 5GGSA 5D2NE 4UF7C 5I1DB 4PJGB 1RE3A 1YEEH 4G7RB 4CU6A 3QZLA 1JN6B 5AUMB 1G6RB 3G08B 2IWKA 4XMWA 5CSGA 5B1BB 4AQ8A 4BQ8A 3G71P 4C7RA 5CJXC 5HDWA 2BSBA 4JQ0D 2JDIH 5FGCE 5TJWK 2V3EA 1BQKA 2AKRB 4YDJA 3MZWB 2QTEA 4NO3B 2Y9YA 2YUVA 1DBAH 1J5CA 3FTUA 4L8CB 2KT6A 2L91A 4OD3L 3NAAL 2DL2A 5I18L 3OHXB 3DMMB 1LGVA 3RPIB 1MCOL 4BWNA 1JI2A 4ZFOB 1YYLH 5BW7A 2PF6A 3A6OA 4J8RA 5I0XA 3C2SA 3UC0L 2R0ZH 3ILQC 2KYVA 1R33A 4C83B 1F00I 1D7CA 3HPLA 1NDGA 1SLVA 2XXMB 2ZOLA 1JYNA 4V33A 3SGEI 1WRGA 1MCWW 3F3HA 1PZ3A 3CSTA 1WFIA 1BZ7A 4H40A 4ZAKD 5KWYC 3L2LA 4ODVH 2WPQA 1MZZA 3H1HD 5TE4H 1NWPA 3FT3A 2V5RA 3FB7A 1P0SE 3N40F 4LKCA 1XX9C 3QG7L 4UM9A 1QYGH 4OH8B 1BQHB 1OQOA 2BERA 5DMGD 4RESB 3CFIC 3WL9A 4E9XA 4HOWA 1FZOA 3PNWA 3D2UB 2X2HA 4XPTL 3UZEC 1OANA 2HP4A 3WKQA 5L8JB 2FE0A 1X44A 2CGZA 2IAMD 1E30A 4FG4A 3CQFA 3FOMA 3U1SH 3PP4L 3RU8L 3MLYL 3HC0A 2XV5A 1CS6A 4Y4KB 4D2NA 2F53B 4Y9GA 3H0TB 3JSSA 5I0YA 3PJLA 1T2QH 4EDWH 3KXFA 5EEWA 5C9JB 4KFMA 2FT6A 1DUYA 4M7ZB 4JDVB 3TT1L 4MCZA 2EEXA 3II1A 3LNGA 1EJFA 1A7PH 1I9EA 3HG4A 1YTZT 2OGUA 4JJ5A 4OM0L 4XPGH 5DJ2B 3VWKB 4BZ1L 2IO5A 3BYTA 4OCLC 4X6EA 3SY6A 2CK3H 2XDJA 2YZ1A 1C1EH 3H1ZA 2NRDA 4LRIA 3Q5SA 2WQUA 2YPKA 1F58H 4A7GF 1K05A 4CN6A 3U1QA 3KGSA 4I4WA 5CAYB 2FZ3A 1Z3GL 2YAMA 2A45I 4L3CA 3G6DH 3V4VA 5I8OH 5DD1L 2MJWA 4BINA 5IQ7L 1HWTC 1QI3A 2WSPA 4NKDA 1GSKA 4M62L 1SQMA 3R0MA 4XHJC 4E41A 2BIHA 3UYPB 3AEEC 3WCYA 3ARVA 4XNDA 1VESA 5DC9B 4KMQA 4MAYB 5H37A 4EI6B 3E0GA 4KFZC 1F02I 1DVFB 2V2XA 3KBHE 4JN2A 1VAHA 4KRPD 3ECVA 1INDL 3QJHA 3HZVB 3CMAP 3W2DL 5IJVB 3QEQE 4WDIB 4WSGA 2YXRB 3BASA 1ZHBA 4YGVB 4OUUA 1SFHA 4LSRL 1YMME 1FBIH 1XGPA 1MLCA 1KJMB 2VQTA 4Y9FA 5L88L 5EBWA 4ODUB 1I82A 5GS1C 3RUGF 3GUFA 3QUKB 3ABZA 2NW2A 4BFBD 3IDGB 2JCCA 2MMXA 2F7RA 3W81A 4YWGH 3DSFH 4P9HL 5CMAB 3MLPA 4LNRB 3B2UC 1J86A 3D51A 2J57A 4YHPA 3RGUA 3RGVD 3WIAA 4ZX6A 2QSIA 3TYYA 3QDJD 3UCQA 5I1IH 1VCBC 1FO0H 4G6FD 3FRUB 4XZ4A 2J88H 1JD7A 3QIBC 3DBSA 1D5MB 2AJSL 3NP3A 3P4NB 2VWEE 4JUTA 3FT1A 4MJHA 4OD1H 5F9OL 2X4TB 4AKQA 4BIKA 4MAUH 1I1CA 5CBOA 3ASWA 2XNAA 1UWEL 2DB8A 3HS0B 3O2WH 3QEUA 1U6AL 3QJVB 4DEPC 1IBBA 1N2RA 4LGPB 4J2QA 3ARBA 4AIEA 1BYNA 4CSZA 1WS7A 4YZFF 4PRHD 1FE6A 2BZ7A 1I3UA 3BD3A 4OJAA 1K3IA 2Q7YA 4H44D 3IM1A 2BDNL 1A7QH 1RIUH 2CUAA 2VISA 4FTVD 2YGPA 1IQDA 2J2ZB 4EDFA 2WXJA 4XXCA 5BOZG 5CJXA 2JKSA 2V5TA 3FRPA 3RL1A 4KJWD 2VDOB 3SE9H 4QRUB 2XQBL 3LB6C 2CU9A 2WIIB 4JFOA 4ETYA 4WI5A 1MCCA 2WXMA 5EOTA 1AMXA 1NEZA 3HKFA 4LFHD 3L5XL 5JHLA 3T2NL 3AAZB 4AW4A 2WYZA 2PPEA 3MBWA 4ILDA 3G5VA 4XBGB 1L0ND 5KJRH 1LD9B 1IAMA 5EB9A 4MCYB 3IJ7A 1KLFA 1G7HB 1DBJH 1C8PA 3EZ8A 1WIOA 3HE7C 4PJEF 4JS7A 2OYKA 2FKWB 3H1HJ 2J6EA 3JV6A 4R7VA 3U46B 3K71B 2Y5TA 4ZFFB 4AYMC 1YN7B 4AGOA 1U42A 2YSTA 2ZYHA 2K7PA 3V2PA 2X4UB 3RDTC 1SQQK 1Z56A 4FQIL 4KQ3L 5DURD 1FLRL 5DR5L 3MUZ1 2PWHA 2Y7QA 4A55A 1XD1A 2Y36H 1A7OH 2HPTA 1PNCA 4M7LH 2AXJA 4LBAA 2HT4C 4DPAX 5AOZA 4MNQB 4XMKH 2A06G 3L3GA 5CN3A 2W80C 3WXWL 2NSMA 4CW1A 4YX2H 1DEEG 2QKIC 2GJJA 2D4DA 5D7IF 1X5YA 3NFPA 4UUJA 5I76A 1DLHB 3CFBB 3K8MA 3G4SP 2ADGA 5E99L 2VZUA 4ZS6D 2FYNB 5HDBF 5ALBL 1FYTB 2BINA 2W9EL 4PJ7E 3S4SG 2QADB 5L9DH 3L1GA 2DYPB 3GGWB 1MG2C 3KCPA 3DPBB 3KCWA 3NCEB 3V6OE 3WKPA 1ZLUK 3TURA 2EQDA 5AVZB 1TCRA 2C7UA 5E03A 2YOCA 5CGBA 2ZG1A 3G3LA 3L74E 2BHYA 4OAWB 1TQBB 4F9LC 4R2GC 2W0FB 3AT8A 1BQ5A 2FIRT 2CDEA 4QOKE 3ARPA 2FECI 1IAIM 3MRHB 3MI6A 3IGAB 5EIIG 3TBCA 1DCLA 4QY8A 1QW8A 5CJ4A 4HKXB 3IRCA 2BP0A 1F8TL 3L16A 5GGRB 5I28A 4POYA 2X70B 4QHLB 4YDZA 5KVDH 3CZLA 1XV8A 2QVAA 4JFZL 3VXUE 3O2VL 2C4XA 1F41A 3KW7A 5I16B 3C9NB 1J1OL 3VFNB 3VXOB 1U9KA 4YDLB 2BP8B 3SPJA 4AVJA 1R47A 1TTCA 4N2EA 1P84D 2BC4B 2FJGA 4KQ0A 5KZCD 1XTMA 1SHSA 3UAJC 1HH9A 3GT6A 4FFZH 2A9NL 3D3VA 5GGSB 4LVNB 1YSOA 2E7DA 4QHKI 5AWNL 2PGDA 5IHWA 5KAFH 1F3RB 1HINL 2CD0A 1N2DC 5IKCA 3QIBA 3MMEA 1EVTC 4OCNC 1WFNA 2FB4L 3JZ7A 5D6CA 1U3JA 1A1NA 4YDJB 2V7QJ 2XKUA 3CWGA 4BSJA 4LEXL 2VLRD 1CGYA 3QARA 5CN2A 1QFUH 3H2WA 2PMZA 2LLGA 4HXBL 12E8H 4P2RE 4AIOA 1TZ8A 1TETL 1D5BA 3I9IA 3PU7A 1JXGA 1WUNT 4E9RA 4J8RB 4DNLA 1BQLH 1KQFB 1BGYE 2OTJP 2X6MA 2ZCLH 2COQA 2E9WA 2I1JA 2W91A 4U1LB 4IIQA 1RZKL 1WFUA 1F3JA 4HAFA 3HPLB 1NDGB 2ZOLB 3M07A 4LPWA 2FD6L 4JM4H 2JTYA 4RISL 2QJPB 4ZK8A 3TO4D 5HY9B 1E65A 4ODSL 1DANU 3MLXH 1E2ZA 3RY6A 1I3VA 2IBBA 1E5ZA 1RZQA 1M3JA 1SQPK 1J0YA 4RMVA 3I6LD 1JHKL 3FT3B 1Q90A 1M7UA 3F65A 2D31A 4P2QD 4X4XA 4LKCB 3WL9B 1IC5H 4LEEA 2ZOUA 3K8LA 1L0NJ 1CD1B 1M90Q 2VABA 4O02L 1FZOB 4AMWA 3PNWB 2WQRA 2Q5UA 4JBSA 1UM5H 2YK1H 4ZAKC 3VXSE 2FYUG 5E2WH 2BY1A 3RIAK 4YJZL 4JM2F 2VMJA 3FOMB 3HE7A 3Q48A 2ED6A 4Q9RH 3HC0B 4G80A 1AZCA 3D85D 4RGMB 1U21A 3DTUB 3LQZA 3KXFB 4L3EE 2ZAIA 4DKEL 3R18A 4DZ8A 1DUYB 1L9NA 1KEMH 4H1LA 4MCZB 3MR9A 4JJ5B 5HJDA 3U2SB 1TU2A 2IAMC 2E9JA 1W9XA 4X6EB 3SKMA 3WNOA 1A6WL 4MBOA 1AA0A 2PETA 3RNQA 2V5SA 2Z9TA 4PJHF 1RMFL 3TL5A 2YPKB 4BCZA 3IMSA 4I4WB 2FZ3B 3A5TA 4WI6A 3H1JE 3PWLA 5AKVA 5LBVA 1PP9G 4L3CB 5JDJA 4H8PA 5GGTL 4NKDB 2YARA 5DK2A 1AHMA 1T0PB 3UZVA 4E41B 1NAMA 2ZUQB 5DJXA 3FQWA 4ECNA 3GXPA 4QHUA 3ZDXF 5LLIC 1BE3G 1LNQA 5C09D 4D6TD 1DBKH 4EEEA 1J5OH 3VGHA 4OD2B 4F92B 1GJWA 1SXBA 3B2XA 4QI3A 2V2XB 4JN2B 2NNRA 3QJHB 1J1EB 1MW0A 1ILUA 3MCKA 1MEXL 1ZHBB 2B7DT 2FWLB 3NZ8A 5E4AA 1NCBL 4OUUB 2QV4A 3O9WD 3BZ5A 1XGPB 1MLCB 4N2DA 4CMHB 5LNDA 3ZYIA 2WTRA 1LO2H 3ISYA 4F9LA 3HI6H 4R4BA 2J4WH 5DMYA 1KBBA 4U7JA 2JB5H 1AQ5A 3HG1A 2G4EA 2XTJD 2JCCB 1M4KA 4IEFA 3UPRA 15C8H 4RFEA 4ORGA 2XV2A 4PJIF 4HBCH 1J1DB 4YHPB 4BK5C 1GMIA 3MACL 4R5TA 2P10A 4PBVC 3UO1H 2XZAL 2P2UA 3KPEA 1NFDE 1LWRA 2GI7A 4XHQA 4O4YH 3V6IA 1NCAL 5IBUG 3RX7A 3TV3H 5GRVL 4NSKA 1TSHA 2VNCA 4OFKA 4DKFH 5SWZD 1K72A 2A77H 1HXKA 2XNAB 5H2BB 3QEUB 1T2KD 4PJXF 4GYBA 3BRTB 1N2RB 2DLFL 4FQXC 3ARBB 2IMMA 3KPRD 3V6ZA 1MFBL 3N43F 1J1PL 3MROA 2WJ5A 4CKVX 3J2PA 4DESA 4EXKA 5IMOA 2WZ0A 1EANA 5HYJA 1UZGA 2Q7YB 1CE1H 2B1AH 4M61A 4G9FA 1EFXA 3VG9B 3VD2A 4AC4A 2WO4A 2VISB 2J5UA 4LAJH 4KHTH 1AJYA 4XP1H 5D4JA 1DE4A 3GKZA 1S5IL 3FRPB 3A0OA 4HS8H 3CD4A 1E6OL 3BH9A 2D7MA 1CFQA 4DSYA 3NBNA 4P5RA 3A0HE 2FX8L 2CPSA 1JOIA 1F0LA 2QVFB 4JFOB 3WFZA 4EZKA 1L6XA 2KZKA 4L23A 5BO0D 5EOTB 3ZE2F 1NEZB 2IZ1A 4PHXA 3F83A 4ERSL 4KJWC 4RAUA 1WWBX 2A45G 2JI1A 3MBWB 3G5VB 4LLMA 5I6MA 4OLWH 3IN6A 1NL0H 4XR8C 3ZUCA 4KTEH 3L70E 5FKPA 3STZA 5CFHA 3BSZA 4PD4H 1KLFB 2DH2A 3FO0H 3O6KL 5DJAA 2OFQA 3FU5A 1NC4A 4NKQB 4I87A 4ZDHA 4ZMNA 2OMWA 3G3ZA 3ECQA 2VXSH 3JV6B 1S5LH 4CADB 5CKGA 5I1KL 3VGFA 5SWSE 4ZD3L 2Y5TB 4YHML 4S1RH 5KTBA 2UUDK 1Y07A 3R7RA 1MIEH 1BCIA 3ECUA 3V4QA 1U0QA 3OJDB 4QYOA 2E56A 2G2PA 1SM3H 4G5AA 4ZAKA 1XTCC 1WK0A 3BVNA 1ZCRA 2Y7QB 3CCQP 2P7TA 4HFUL 3HAEH 2BASA 1NLDH 4PGCA 5LKNA 1IZNB 3NDZE 1CFTA 2R59A 3WMSA 3SOBH 3TZVC 1UB5B 5TE7L 4KX9A 4K8RD 5MHSE 1U41A 2VQ1A 4CW1B 3ZO0A 3Q06A 3KZ8A 4XPFL 3QHZH 3FO1A 1P4BL 2FNWA 2PO6D 3NFPB 2IAMA 4R8WL 3QT2A 2OJZL 3KHQA 4M8QA 4UUJB 5I76B 4Y1AD 5MP6L 4UNIA 5L2JA 2AJZA 3W37A 3PWJA 3BAWA 2ADGB 4BQ9A 3QI9C 1J88A 3MRCA 2V6HA 2ATKA 2YPLE 1FFNA 4B9YA 1TZOA 3ILEA 4XVUD 3OB0H 2VC2H 2VXUL 5E8DH 3O2DH 3F5WA 3NCYP 2EVHA 3KCPB 3WMPA 1XQ4A 1T03H 2R15A 5AZ2H 1TCRB 2C7UB 3AEBC 3EF7A 3FFDB 2MCMA 3EYSL 3BIAX 1CXLA 3QO1A 1X5GA 4NUPA 4OGXH 3CBRA 3B7RL 3Q7JA 2CDEB 4POZD 3HNTL 3KPOA 4ZNEA 3TO2A 4XXDA 3VGBA 4YQXL 4KJPC 4QY8B 3BRDA 1N6QH 3QYNA 1VQ7P 2BP0B 5IB4A 3CBKB 5DJ6A 3CC7P 1L2PA 4QRRE 3ARRA 5H35A 1RPUA 3EF4A 3GSNL 2ITFA 3CDFA 4WI7A 4Y4HC 2W9LA 4EIZC 1PGJA 2EDRA 3ZT5A 5TFSL 2HKHH 3ITKA 2JKIS 1MRCH 3ARZA 2WGNB 3LKSA 3LY6A 3NJJA 3VI4E 3IDMA 2FJGB 4OCRL 4JG9A 1HH9B 1S3KH 2O5ZL 3D3VB 3PUUA 4KK5D 3MRJB 5E2TL 5D1ZC 4N0CC 3NIDB 1O6SA 5IKCB 1BJ1J 3MMEB 3QIUD 4M6ML 4QR7A 1M2OA 2HFFA 3QISA 4XMLL 5D6CB 1MAKA 1OZTG 5EOQL 4C4UA 1J9RA 1UCTA 4RBPH 4UT6H 3L7EB 4IBZA 2R8SL 4JNXA 3JWNH 4QIRA 2CJUH 3RGVA 1TQWA 4DEPB 3QDJA 4GJTB 1QFOA 3EFFA 3UADA 4O02A 1KILD 2FX7H 4B9PA 5IESL 2VDNH 1M71A 1U2HA 5D7SH 4DW2H 3F6IA 4OCXL 1RD6A 1D5BB 1K04A 1B0GA 4CSTA 3CBJB 3L73D 3CD6P 3VU1A 1OY3B 1HWGB 3Q05A 4FERA 4BA0A 4IIQB 4X9BA 1F3JB 1JWUA 1PZBA 4NM8L 4TRPL 4XNMB 4WK2B 1E5UI 1VGEL 3NSXA 5CLZA 1KYAA 1B90A 2HG5D 2ZE0A 3CL3D 4FTVA 3H9HA 2GY7B 2F7PA 3CFTA 3TYFA 3L75E 3KYKL 1TJXA 2D31B 4U1GC 4X4XB 4LLHA 4I77L 5CWSA 2HJFA 3K2UH 2EDDA 2VABB 4X98A 5BO1H 3FXDA 2UZXA 3STBA 3I2CL 1F6FB 2VUYA 5GRUL 1MREL 2W90A 3INUL 2XFGB 5JIMA 4RAVA 1NCOA 2FBJH 3WFBH 2WQWA 4P04A 1NTZG 3HE7B 5JTWA 1TOXA 3IMBA 3EBHA 3M8OL 5JXED 1QSFE 4G80B 4MFHA 4FQJH 3QWQB 2PCXA 3MLRH 1SN5A 2D8KA 1DSFH 3LQZB 1SY6L 3B3BA 3GTVA 2C3HA 3HFMH 1TFHA 1UHVA 4H1LB 2P1YA 3MR9B 4ETQA 1TU2B 4MN4C 2A6JB 3SKMB 3TCTA 2R23A 1IFMA 2BVEA 4S1DD 4DOHB 3RNQB 4XNQB 1PLAA 3X1GA 3CN3A 3HE5A 2ENQA 2RCSH 3PWLB 2WXOA 1MCPH 1AS7A 1S2EA 1HEZA 5DK2B 1YEJL 4J3BA 3UZVB 1NAMB 3NA9L 1WZMA 3FQWB 4Y9BA 5DJXB 1R0AL 2XTLA 4XVTL 4QHUB 3ASOB 3H1ID 1KB9E 1WF5A 3MOBH 4F37F 3D50A 1VCAA 4GG6F 2BH0A 3JUYA 2B87A 4GMSH 1JGUL 5DEFB 4UNVA 5GJSH 1JTOA 3HNSH 1AYOA 1MHEA 2FATL 2FX9H 4LSPH 5CLXA 2IBZE 3NZ8B 2NQCA 4YXLL 5C08E 3IFLL 4BFGA 2V37A 2WTRB 5C0RH 3ARQA 2QPUA 2ZVNB 5GGRY 1NANH 3RZWA 2DQEH 4YHOH 3MLZL 4R4BB 1BLNA 3HG1B 2E3VA 1G4MA 1UYWL 4N8VA 4ODTL 4RFOH 5CCKL 4IEFB 3UPRB 1ZLWH 4E36A 3O9WC 1EZLA 4ORGB 3MLVH 1SMOA 4JY6A 1UCBH 2QV2A 3EFDH 1CTOA 3LEYH 2FEJA 2CUHA 2WINA 3NIGE 3SQOH 5IHBA 2CK2A 4WWID 4PJ9D 5L6YH 1LE9A 4NSKB 4Z3EA 1F2QA 4JGUA 4DVBA 3PJSA 3BUQA 2ZKMX 4LMQE 1OKEA 1QAWA 4FXGC 4Q9BA 5DQ9A 3RWDA 4CVXA 1AZVA 3PL6C 3PHAA 1OSYA 2UXGA 1L7IL 4FJZA 3V6ZB 3WUZA 3MROB 5DD3H 3RIFK 2YD1A 3NMEA 4KX8A 5IMOB 3NACL 5HYJB 1JM0A 5JMOC 2CKBA 3NABL 4M61B 2P8PA 1ZS8A 2HPOA 1EFXB 4G9FB 1EGJH 3OWEA 5IV2A 1S7VA 1M05A 2H3XC 1T2KC 4NJAL 1A4CA 1DE4B 5L8RJ 1NTMG 4PCYA 2XFXA 3NEEA 2KIKA 2BRRL 3ZTDC 3NK3A 1JYVA 2NW3A 3FYIB 1MCQA 2BIPA 3BH9B 2AEPL 2YXWA 1CFQB 4WQOA 3II6A 2MRYA 5IMMA 3D33A 1GPOL 3D69A 4GKOA 1LJ2A 3T6VA 3L73J 3GKWL 4UILH 2QR0A 4GAFB 4D0DA 1ZS2A 3IBOA 3RFZC 1GD2E 3TJPA 2V5YA 4RAUB 4LLMB 4WWOA 2VLRA 1DQQA 1ZE3H 1MQKH 3B7TA 4X6CF 4G6AD 2QQLH 4LARL 5FKPB 1S9XA 3STZB 1BVOA 1L4IA 4W9HC 3O3DA 5ADOH 1E43A 4R7XA 2VL4A 5DJAB 1NC4B 4H7VA 4AEIL 1URQC 3Q01A 3ULUL 4ZDHB 2OMWB 3HUJA 1NIAA 2CAKA 2CRIA 2J55A 4LIQH 1EJOH 4BE5A 2FXMA 3JWNC 2QJKB 3TO4A 4QYOB 3B6SA 3AE1C 2UWEE 4ZAKB 3BVNB 3IU4L 3ATEA 1KN2L 4PJFA 2KZBA 2B3RA 3MA9H 2P7TB 5DQDL 2PPDA 4IRZA 4P2QA 1CFTB 4MB4A 4N90E 4U1HA 5I1EL 2QEXP 3G04B 2DQCH 5KVFH 1YQVH 2PXYC 1ZA3A 2VQ1B 3LIZH 1QMUA 4HLEA 4NJ9H 2RBLA 1YITP 1ET7A 1TFPA 1M9SA 2Z7ZA 4IDLA 3FO1B 3HG3A 4UT7L 3BHBA 2IAMB 4M8QB 1PEZA 4KNSA 3O6FC 1BECA 5L2JB 2AJZB 4H20H 3PWJB 3W56A 1AANA 3D85A 4K8RC 1J1XL 1WZ1H 2V2WA 4LCIH 5FHBL 3T2OA 1A25A 3MRCB 4Y2LA 2FL5A 4HWBL 3US9A 4YSSA 1JD9A 2ATKB 1FFNB 3JBG7 2GABA 3U1CA 2EO1A 4AM0A 5E08L 4M7LT 1J5IA 3SGJC 4G82A 2KL6A 3F5WB 3BVUA 4KH9A 3DDGA 3TEUA 4IQHA 5GS2D 3ZE1E 3PFQA 1PG7X 1RURL 5AZEL 3ZHLA 4RZCA 5FHAL 3VFPA 3A47A 3QO1B 1O7SA 2VN7A 4HLJA 3M9HA 4J3VA 5JYMA 1NHLA 3LPFA 1TEGA 2DICA 2Y7SA 3KPOB 1TEYA 1PZQA 2F1EA 3TO2B 1K8AQ 4XXDB 5BZDA 3RRQA 3LXAA 5AQ0A 4F7MA 3FT9A 1CVSC 5APYA 3K6NA 1LGHB 1MCDA 1YRKA 4GQQA 5IB4B 5DJ6B 2YD6A 1GGTA 1WFTA 2I5YH 1CBJA 3NSJA 4HEPA 2VR5A 3GXTA 3DX6A 5H35B 43C9A 4JBZA 1WZAA 2EE9A 2GYSA 1JY3O 5C09A 2W65A 1CXKA 1OL0A 2J59M 2TAAA 2VZVA 4KNTA 3PXLA 5CILL 1CVRA 2OJ1A 2X28A 3QCTL 4FMKA 2AXTE 3LKSB 4KRPB 4AJ0A 4BRVA 4Z7WF 1SQQG 3IDMB 3HI1A 2YUXA 1J5HA 3NJVA 5C71A 3OLEA 35C8L 4N4YB 1SFDA 3O9WA 3V4PA 1Q82Q 1QO3A 2YO2A 4MKTA 4TSBL 3EWKA 1SQBG 4K73A 4PP2A 4UOW0 3Q1EA 4FABH 1O6SB 2PABA 2VT0A 4HS6A 3BE1L 4F93B 4JRWA 3HS9A 3QDGD 3BWUF 2XOTA 3C09B 4Y2NA 2HFFB 4GUPA 3UIAA 1KGXA 2OQQA 2R69H 4F27A 2PWEA 2XU9A 5D7EA 3RGVB 4FXGA 3BD4A 3QDJB 2GTQA 3EFFB 4O02B 1ZLEA 1QFWL 4G6FB 4WAFA 2CA4A 1M71B 2Z4TA 3VI3E 3SDDC 1B0GB 3PLNA 3N55A 1K9MQ 1ZHLA 1OAJA 5SWZA 3QEQD 2G4GA 5JPMC 1YMMD 3BATA 4R4MA 3TGUG 4RMQA 3PHQA 3KPRA 2WC7A 3DGDA 1KILC 1CF8L 1JWUB 1P2CA 2I85A 4RJTA 4PRHB 2P46B 4OT1L 4XPHL 4KVCL 5JQIB 2WTYA 1MFCL 2WCGA 2B8OT 3E1IA 1QGKB 3V0EA 4FTVB 3H9HB 3OMIB 3TYFB 5I1CL 3FUKA 4DPBX 5HY9A 4WIQA 1G9HA 2N1TE 2HJFB 3V0WL 5IP4A 2OMTA 1CLOH 4QHPA 2YQGA 1KWKA 1A6VL 4H13C 4X98B 2PFXA 2UZXB 4ANWA 4F33A 5IEKA 2SEBA 2EDMA 4PJ5E 5KLVK 3DSNA 2LXCB 1DZBA 4RAVB 5B5EH 1F42A 4R97B 1URQA 2YKPA 2WPGA 3OAUL 1I1RA 1EPFA 4FLQA 1V55B 5DWPA 5AW2B 3E9UA 4M6NH 4QGTA 4DFIA 3CMGA 4UT6A 4CMMA 5HI5D 2WSEH 4ETQB 3CLQA 1RULH 3J7HA 5HVWA 2NY1D 4JKPL 1EZVY 3QXAA 3IVKA 3GEWB 4FX5A 4NRXA 2R23B 4WFHD 3Q8BA 4ZKPA 1EZVI 4JG0H 5IM7A 4I2LC 3HE5B 5C3IA 2MPVA 5CZRA 2BO0A 3APNA 1YG9A 3AWEA 1Z9NA 1IGIH 5C0CD 3LOWA 2ZFCA 5DURB 3GSUA 1HEZB 2Y0DA 1WITA 3K0YA 2K6YA 4DK5A 1AR2A 4S1DC 1WISA 3MRNA 3FWLA 1QSED 1EEZA 2GBVA 2X5PA 3IMRA 2O93L 1HL9A 5FO8A 2YS4A 2DTML 4Y4FD 1M6UA 4PVBA 2GSIA 1F90H 5CN1A 5JHAA 5LXGL 2C9UA 4ELMA 1XXFC 3MLSL 2B87B 4FXKC 3GLAA 3TBVA 4Y7MA 3CK0H 2VDPH 5IROD 3ZIYA 2PO6A 1MHEB 4E0RA 2OMBA 3ZE0B 3OLDA 4Y1AA 5DU7A 1BLIA 3RVWD 2I32A 2KSEA 2EKJA 3A7OA 2C9XA 1CLZL 4PG9A 4C56E 2Y0SA 1AY1L 2K9FB 5ANMA 3FU8A 4XB3A 1BLNB 2IANE 4W81A 4B0MB 4BH7A 4N8VB 2ZG3A 2AVFA 4OV6F 1KC5H 1PZCA 3O4OC 5AKTA 3C1LA 4L29A 5FYJD 5CZVL 3D6YA 1JDCA 3ZKQD 1FCCA 5BZWA 2ZAHA 2XN2A 4JY6B 1JAEA 2DF3A 1WAAA 4N2LA 2P26A 2J43A 5EC2A 3O6MH 4LLWA 3RIAF 2WINB 2SPZA 4IBLT 1DEBA 2QGBA 4IOSD 2WCPA 3N91A 3LPGA 3O0LA 4GSQA 3WXVH 4MYPA 5D7KD 4BFIA 5E0FA 2V8LA 2ZX7A 3I9GH 3PJSB 5K93A 4RDBA 3MJ9H 3RWDB 1UFUA 3TF5A 4CVXB 2JXMB 1DQLL 2X0UA 4DN4L 3MAWA 1CDHA 3LPOA 4FG6C 4NBYB 3RIKA 1XF5A 3IXAA 1TTBA 2P80A 4JFDE 4W9JC 2CKBB 4XWGL 5DHEA 2P8PB 1ZS8B 4UNTA 5IV2B 2EIJB 1S7VB 1UOLA 1EAPA 1SFCC 1MFUA 5TISE 5KZCB 3WEBA 3PDDA 3E3QE 3FUMA 4MRCA 3VXNA 3L74D 4DO5A 4N85A 2NW3B 4QOKD 2YRBA 3SJVA 3VYNA 3H6AA 5HHNA 3BCCJ 1BMWA 4KMTH 3VD0A 3REVA 5IMMB 3QIUA 5KS9A 2X38A 3L45A 3D69B 3OKMA 1CGSH 2QR0B 2WXIA 1XIWD 2EXYD 4D0DB 3CHXA 3PGCB 3A3YB 4WF7A 3U7YL 1E2VA 4MLSA 5JPMA 3S4RA 3BSGA 2VLRB 1FORH 5FYLH 5GSRA 4G70B 3VXUD 4F7TA 4FA8A 3GB7A 4HUVA 2CPUA 1KILA 3EFFK 1BXAA 1S9XB 2CM5A 3GXFA 3O3DB 2O1KA 1E27A 5IFJA 3MFFA 3EBIA 1ASQA 1OTUC 1K2DA 3P69A 1NCCH 2Y6TE 1J9SA 4NOBA 1R24A 3WTXA 3HUJB 1KN7A 3NCMA 2WPRA 3Q8CA 2IDFA 1FFTB 1WZLA 4ES8A 4ELDA 2ZSVB 4DOJA 1A3RH 4PLJD 1HESA 3DHMA 3S6CA 3TO4B 3B6SB 4J6IA 5C7XH 4TVPE 1LO4L 2HG5A 3QQDA 4Z1PA 5F6HI 2FYUE 4Z7QE 1BEYL 5CCHC 2AJXL 3DOSA 4RSYA 5EZPA 4NQEE 5D2NC 4P2QB 4L5FE 1IGJA 4U1HB 4MJJA 1ZA3B 4OIIL 4GH7B 4K4KA 3QEHA 4L74A 1GU5A 1KIRA 1RAMA 3ZL4H 2A74C 3BHBB 4ZPVA 1IBHA 1BGYD 2JKNA 5FW8A 2OYHC 5MERA 5L0QC 1S7QA 2K7QA 4AVIA 2F8IA 5JXEA 3HI5L 2VMEA 3D85B 2V2WB 1YAIA 3DX7B 4I2XA 2FL5B 5E9DD 3WUUA 1CI3M 1F1GA 2Z34A 3SQRA 4AM0B 1GC1L 4NQCE 2B2XH 1PP9E 4W9KC 4JPVH 3ALXA 2XA8L 1RZPA 2MKWA 3SDCC 4PR5A 5F0JB 4AV4A 3BI9X 3KW8A 2WD0A 4YTPC 4RZCB 3SYAA 2GB2A 4N0YH 3ILPA 4U3SA 4IKKA 1BE3E 3SGDH 3AMLA 5BZDB 3U59A 4LOVA 2HB0A 2BVQB 1DEDA 4F7MB 1T83C 4HMEA 2VLJD 2XV3A 5AVSB 2QT6A 3HLAB 3CPWO 5E8EA 5IZ7A 4OD3H 1GL4B 1JNNL 3GPSA 43C9B 5I18H 1NBVL 2YAQA 5I5RA 1XTGB 4L3ED 1FNFA 5C09B 2W65B 3BQVA 4M93B 1NMCC 3FUHA 1FCGA 4NKOA 1XCXA 1YN6A 1ZTXL 4WI9A 5DFAA 3V0VA 4KVPA 4XP4L 3UC0H 2VR9A 1GGYA 5J57B 1C9SA 3HI1B 1OP5H 4QF1A 2Y07L 3TNMA 3WIIH 3PGFL 3A6BL 3PRZA 3O9WB 4J3OH 1F86A 1QO3B 2V3DA 3V4PB 4H8WL 4X6DB 4OLYL 2CJSA 4PP2B 4HS6B 1K4DA 4KK8D 5DHVH 2XTJB 3NOIA 4OQTL 1Z32X 5FFLA 1CICD 1J18A 5HJBA 1N5YL 2FRGP 5BQ7A 3WHE0 1MCHA 3FHAA 1T89A 2OL3L 2RFXA 1T66C 3QG7H 3K7UA 3P4LA 2Y2WA 4FXGB 3VYIA 1QPKA 3H1LJ 4K7PL 1W16A 2K4WA 5JW4M 4JMNA 4WWIA 4PJ9A 1ZHLB 2ERJB 4MAZA 4TSCH 5ESQA 5SWZB 1VENA 2OMZA 4DGVL 3MLYH 4NI3A 1DN0A 1NVOA 3PJSK 1EHKB 2QJYC 1BD2D 3KPRB 3PHQB 4K5MA 3FSOA 3L74J 4PN6A 1P2CB 3PP3K 4JZNA 5FM8A 3TT1H 2X6BA 4KDVA 5D1XE 2IDUA 4FNLL 4OM0H 1UM4H 3LEXA 4BZ1H 1FA4A 2ITAA 4UINL 1T5XA 3P30L 4C47A 5IB3A 4RETB 3MREA 5GSVA 2EXWC 1ZP0C 1J8KA 1P84K 3DVIA 4HJSA 5FYJL 2NQ3A 1QLED 2K8QA 4OVVA 4AQZA 5DZLA 2WLNA 4CILA 2E7CA 3VXME 3T3ME 2OMTB 4FXLA 1FFQA 3DBXA 1EA9C 2P58A 1CSBA 3FN0L 3EBAA 5DD1H 1JOCA 4KK6D 5HI4C 4F33B 1AE6L 2SEBB 5IEKB 3OQRA 3DSNB 3BDBA 5DZOA 5H37G 2MEJB 2O1JA 2H5UA 4JHBA 1URQB 5CHXA 3SDXE 3GNML 3TBSA 3E7JA 2WLKA 3UPCA 5DLLA 2YC1A 1W80A 2CHWA 1CZ8H 1UKQA 2CDFA 5KJ7C 2QDVA 2VWEC 3P77A 4CMMB 1INDH 4IBUA 3W2DH 3QXAB 4ZFZA 3IVKB 3UTPE 5IWLC 4GKSA 3RA7L 3QZMA 4NRXB 4LSRH 5CCHA 2AGJH 2EDNA 5L88H 5EA0L 5IM7B 3UABA 5ID0A 2OW6A 3FU6A 4KHXA 1EHAA 4N78E 2JCCF 3B5ND 1KYOH 3L3KA 3RVTC 2YMTA 1SQXK 4IKLA 3T0EE 1UOWA 3GSUB 4HQQL 1IFPA 1QTPA 2NX5E 4M5YL 4P9HH 1E5BA 2WVVA 4JKLA 1GYCA 2A74A 2P5ED 4LHUA 1NCHA 1Y6KR 4JFUA 2DWDA 4J6RH 5FO8B 2GSIB