2RH0A

Crystal structure of nudc domain-containing protein 2 (13542905) from mus musculus at 1.95 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
133
structure length
133
Chain Sequence
FEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALAVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NudC domain-containing protein 2 (13542905) from Mus musculus at 1.95 A resolution
rcsb
source organism Mus musculus
molecule tags Nuclear protein
molecule keywords NudC domain-containing protein 2
total genus 18
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2rh0A02
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2rh0A01
4JUSA 2KLRA 2WJ7A 3EUDA 3J07A 2RH0A 3QORD 2O01N 5DS1A 2N3JA 3GLAA 2BOLA 1EJFA 4JUTA 2K8QA 3IGFA 4ZJ9A 3QORC 4YLCA 4FEIA 1OZHA 4ELDA 4PBDA 2AXCA 4PCKA 2O30A 3N3EA 3GUFA 3Q9QA 3O6QB 2Y1YA 2N0KA 2MNWA 2WJ5A 3L1FA 3VQLA 3L1GA 4YLBA 2Y1ZA 3AACA 3L1EA 3QORA 4I88A 3VQMA 4M5TA 3QORB 3AABA 3GT6A 4YL9A 4RZKA 2CG9X 1RL1A 2JKIS 2CR0A 1GMEA 2Y22A 1WH0A 1X5MA 4M5SA 4YDZA 5DS2A 3Q9PA 5LUMA 4YE0A 1SHSA 1WGVA 2KMWA 2XCMC 4MJHA 3W1ZA 1WFIA
chains in the Genus database with same CATH superfamily
1FAVA 1FWXA 4XAWH 4ADIA 2WN2A 4IOSA 4UQ2A 4QRTA 2EDHA 4X5XB 1ZTXE 2ICEC 3DETC 1S5LH 3MV11 1J1XL 1T0MB 3UC0L 1E9OA 1UIXA 3P8CE 1B0IA 4OB5L 4PJ6A 2V5TA 1EXJA 1M05B 2E7CA 4GG8B 1GTFA 3QEHA 1D3CA 1SOQA 4IJTA 2ZUUA 5IHUH 4PRDA 2WUBH 3K5SA 4OLWH 3WTWA 2XA3A 1FV1B 3QXVA 3NOIA 4AQ8A 3EYQD 1LNUA 1J1PH 4JN2A 4HIEA 2HR3A 2R59A 1N4XH 2PO6A 1P7HL 1T7VA 2FECL 1LTXA 2QPEB 2ZVOB 2Z31D 4NM4L 4DJGA 1HYSC 2J72A 3II6A 3O6ML 3EG9B 4G8AC 3UC2A 1ZK9A 1JGDB 1S9XA 1TYJA 3ULUC 4ODSH 3CK0L 4WJ5B 1U2YA 2O26U 2Z35A 5FM8A 1C5BH 2M3EA 2NPSB 1AJ7H 2OTUB 4X5RA 5TQ0L 1EXUA 5IVZB 4WEBH 3ZTCC 3II1A 1IBZA 1R3IL 2IVFC 1T5WB 1D7DA 2JMRA 3VXRE 3ZKMD 5MEQA 3WNJA 3EXJA 3W56A 3EJUA 3A4AA 2E4TA 4LVOC 4GOFA 1KPUA 2F1EA 3V4PL 3ULUE 1A7OL 2KUTA 4HH2A 1HZLA 1VQKP 1MLBB 4OF3A 1AQ5A 1GW6A 4YIQB 2NY0D 2O01N 4JO1L 1KNOA 4QXGH 1HILA 3VXUA 4E9VA 4ZTEA 3JWDL 5HI4D 1OB1B 5APUA 1IAKA 4BK4A 3T0EE 4ZUUB 2EIZB 1UQSB 4RBPK 4YXKH 2ADGA 3JWNE 3LMJH 3D70A 3ZN6A 3CBRA 4BM7A 5JTWA 4GFXA 2GTZA 3SPIA 4NRZB 2WXQA 4NBYB 5HI3C 3TYFB 2IIJA 3VXRB 3WNLA 2FLBT 2Z8RA 4NPEA 1I7TB 5I76B 3AUWB 1P4BH 1KYOH 2WTPA 4H1LG 1TZGL 4YEFA 3CFIC 1IFJA 3VGAB 1GZPA 2E9GA 1GGCH 1FAIL 4M9PA 5EZOL 3NGBC 2Y23A 4FFWC 3SCMD 5KSUB 2W60A 2XZQL 5K1JA 4HDIB 1ADQL 4X5QA 4ZMTA 3IPFA 3VGGA 5HHXL 5E9DD 1NCUA 1RXLA 2G60L 3BPNC 4IOSD 1UOVA 3OPUA 4HZLB 4OQTH 5DD3L 5AOKA 4C83A 2R29A 3CLWA 4GRWF 1X8YA 4HH8A 3AROA 3J8F7 2ZSWB 3KPPA 4H40A 2ED8A 4S0TD 3S36H 3N1QC 4GAYA 1I8AA 1IGIL 2GUOB 3AFLA 5DJDA 2VDOL 3MMEA 1VF5C 2Q0ZX 3GLZA 3VI3B 1HN1A 4EDXB 1KLFB 3WHE1 1GDTA 3V0WL 5KYWB 1WD9A 5GXBB 4G6FB 4JFXA 5AVRB 1JNHA 3TJHC 1YEKH 2FJFB 1PY9A 4XPAL 1TJGL 2ZUVA 2BM3A 4Q6IA 4B5EA 4PSPA 3D4ZA 3OKLB 2NZ9D 3KPLA 3FQYA 3H7BB 4P5TB 4OQTL 4IKIA 3P1VA 4LCIH 3SDDC 5IJVB 2HPOA 4JY4A 1MZ9A 2GVYA 4BQBA 4YNYA 1H3WM 1S8DB 1SLVA 3DMMC 1OSZA 4CSPA 5L9DH 1PLGH 1AGBA 1TJHL 2FX8H 2FX7L 1M90Q 4MDIB 2X42A 3QCUL 2WVRA 3NSCA 1SYVB 2DTMH 1YTZI 2P8PA 1PPJD 1ZHBA 5I24A 5DGQA 2B3RA 5DZVA 4JRXD 5FO9A 3KLHD 3QEQD 3FH7A 1SJVA 1V55B 5AVSB 1MWAL 3IFMA 3HIZA 5EBWA 1NU1E 5D1ZI 4L8CA 4XCNB 3PHLA 4PTTA 5LQBL 4GG6E 4TV3A 1V7ML 1HINH 4WWKA 4N2FA 5SWSD 5C0EA 1RJYB 1Q0XH 3U1PA 3SGDI 1YYLH 2BIQA 2YAQA 1M42A 3BO8B 4M5ZH 4F80A 4H26A 4AK1A 1VRSA 1XHHA 2XWBB 3BWZA 4YBQC 6CGTA 5HHVL 3OX8A 4JFVA 1OAQL 4TQ8A 4C56E 2NR6D 2ZSVB 3T1WA 4P2RB 3IPEA 3ASWA 4ZO8A 4Z1MH 4AE1A 3MGTB 5I1HH 3LEXB 4EVNB 4Q6YA 4NQCA 2GITB 1M57D 2H2PD 2K3TA 5F7KC 4OFVA 5FOBA 5T3XD 3QUXA 3RNQB 1C7SA 2R56H 2V7NB 5ISZD 2EDLA 3O45B 3E7JA 4TKWA 1IFRA 4LVNB 4N0CC 1NC4D 5I1LB 1OAXL 4XE0A 1HHJB 4I3RH 4OAWB 5I75C 4KOCA 5IMKB 1GA2A 4L8SC 4XT1C 4WENB 1LQBC 4BINA 2EUZA 2D3NA 1U21A 3D69B 2YKLL 2WXJA 3MJWA 4U1IB 1FVEA 1TEGA 1KTKE 2WSFJ 4BDVA 2H0PA 1KELL 1OEZW 3ABZA 4MB1A 1WCBB 3FT2A 4NQDA 3FFCB 3L5HA 1USDA 4PGEB 2H26A 2AP2A 3ZKQD 4GG6F 1FZAA 1C5CL 2AGJL 4YHOH 2XG5A 4PJBE 3KYOB 3NGBB 3OAZK 2VH5L 3HJ0A 3KZIH 2CLZA 1UHVA 3L73D 3L75J 1BAFH 1QBLL 1SOXA 4ZG1A 4HCRA 4K3HA 2BINA 4LNRB 2XDJA 2WB1A 1A7PL 4LOUC 4KKAD 4N2DA 1E6JH 5F7MC 4U49A 2HT3D 2P46B 3KG5A 5AVQB 1XR8A 2QR0B 3EO0B 1SHWA 1UACL 4M6MH 4RQQA 4XBEH 4LLMB 3BAEH 4YDJA 5ALBL 5E2TH 1JXFA 1NCCL 3AE5C 3FBQA 4IIZA 2MCAA 4DZ8A 4EUPH 1RZGA 2AK4D 3FU3A 3SE8L 4C4KO 4UILL 1IGIH 1I7RB 1JGEB 2AK4B 32C2A 5EF0A 3QEQA 4I18A 2W0FA 2EC9T 5GS0C 2NY5H 4UB8H 1SY6A 4Y5YB 3BPCA 3QUZC 2YRPA 3KXFE 4QT5B 1ACYL 2Y5TB 3MRQA 2B20A 4C7RA 1DQDL 1F42A 1IBGL 2V2WB 3BVUA 4I9WE 5E1IA 5SWSA 2QIWA 3CSFA 3NZ8B 4FMFA 4YDMA 3RWHA 5GGUB 3UTTD 4OJEH 2D0HA 4AK2A 3L1EA 3L48A 2QQLL 3GIVA 4K94H 3TJHD 1B2WL 3U79A 2K3RA 3I6SA 1F3DJ 1N64L 4Q6IC 2X9XA 3T8MA 2FR4B 2KQNA 1YNKL 1KV3A 1EO8L 3P9WB 4JKPL 3TESA 3TBTB 3ZY7A 3D18B 3TVMC 4I48A 12E8L 3B8SA 3IE9A 5FHAL 4WJG3 3FB8B 1JY3N 2EUWA 5D7EA 1E79H 3AY4A 1FAKT 1RJZB 2A73A 2BIIA 3PY9A 4U3FG 3BCCJ 1PFOA 1JTOA 1WHOA 2WXIA 4PJ8D 4XOCA 1DQTA 3GHBL 4IRSD 5IEHB 3L37A 4NQSA 3GJFK 1UUNA 5CGYD 5EO9A 5B1CA 4P2AA 1UM6H 5KSBF 2X3CA 4NYLA 2OMWA 2WUCH 5C09B 3WL9B 3IB4A 3NEXA 4K7PY 4HKXA 4BFRA 5HBBA 4F37K 3QDGE 1F6FB 4FXGA 5ID0B 3S3JA 1V3LA 2P8LB 4B53A 2GTWA 1IAMA 4BCYA 5KOVC 5IW6A 1DBJH 1KLUA 1AS8A 4NQDD 2CPSA 2YK1H 4EVNA 4NP9A 2V2TB 2OJZL 2R0KL 1MDAA 3O41B 2OS7A 3TP4A 3IJSB 1HL4A 3T65A 2OZ4A 1E90A 3LKSB 5AKVA 3H1HG 1IAIM 1JHKL 1FZFA 2P1JA 4N2AA 3OHXA 1DDHB 4G9DA 3ELAT 1LD9A 1LE9B 1IKOP 4R0LC 3QHZH 5I1EH 4JHBA 4ANKA 3IETB 3BI9X 3T2NL 4X7TA 3L71D 2DQMA 4GEJA 1NGXB 3IKCB 5K1VA 3CZFB 4JFPB 1MUUA 4Z7UA 3T6QC 4XC1L 3L7EB 3GO1H 4IKLA 3ZTEA 4LVEA 1A1MB 4ENZA 2I7OA 3QS2A 4YAQA 1DL7H 1PX3A 1CGUA 4NNPL 4XCCH 4NO5A 5SV3A 1SQXD 2K6YA 1BVOA 5DJ8B 4G1MB 1ZHLB 1KJMA 5ACZB 1FFPB 4IL6X 1QX1A 2ICCA 3RU8H 2LABA 4A67A 5HYIA 4H13C 1SLWA 2OCJA 4P4KB 1NCTA 1KXQA 2CJTA 3JTSB 4YDIH 3KVQA 1RL1A 5D4JA 1PZ3A 3L4XA 1NCBH 2F2HA 4EN3C 1XGUA 1J18A 5D71L 2YXWA 1KQLA 1WBXB 3QUYA 2Z5IA 1DBML 1FRGH 2ED6A 3H8NA 1BGYJ 1H0TA 1UJTA 1URLA 3B9AA 5EEWA 3M6DA 5T3XE 3EYUH 5BV7B 4NQDE 1Q86Q 1U42A 4WI4A 1HINL 1JPSL 4K9JA 3KNBB 5CSZA 3GPEA 4Y99B 3GSWB 3PRZA 2R44A 1RFDH 1RULL 5ALBH 5E2TL 3FOLB 1NTZE 2MQGA 1DE4B 3WLBB 1J1DB 2OYIC 2YGNA 4M6ML 4NIKB 4QHUB 4OW6A 5DWUH 4L75A 3MZWB 1E9QA 4Y16C 3E1IA 1VZIA 3RNQA 2EVFA 3BP6A 2BCKB 5KLVG 1BQHG 4GSXA 2NOYA 3V2RA 2DI8A 1WFOA 2PUQT 4QXVA 2OSYA 3ISYA 3MUGB 2QKIB 3P30H 5C09D 1ET7A 3HI6H 4RMRA 5A2FA 4KV5E 3WFEH 4D6TG 1E2WA 2LAAA 4RRPG 2QA4P 3B9DA 3O6QB 1SZNA 4MD5A 4BFJA 3BLKA 4PP2A 2PW2B 1FFQA 4MQTB 5I8CB 1G7JB 2YAOA 2FIKA 2IALA 5DHXB 3MCLH 1G9ML 3ZGIA 4ABQA 2WQYC 3TT1H 1A14H 1QSEA 2PP8A 2WB7A 4FHKA 1VL2A 3B7YA 5I8OH 4JVWA 4HKBB 2PNDA 4GP8B 5F93C 4IRJC 1IAOB 2YN5A 5MEND 4TNFA 5KG9A 3CK0H 2XTSA 4N2LA 5LXGL 1WFMA 2BSED 4FL4C 4G42A 1KFAH 1NGZB 3DBXA 4ZMPA 1BPVA 3FXEA 3D0AA 4JMXA 3IU4H 4HYTB 2WWMD 4HV8B 4H25B 4RZCA 4NHCH 4RMVA 3SE9H 5FUOH 2IOOA 4W6YB 1OSZB 3NSYA 3CVDA 4QGYA 1GK4A 3I3EA 3AWGA 5EBWB 2VXVL 1UG9A 3MOBL 4LIQE 2HLAA 1IARB 5MHSD 1VQ4P 5E8DL 4OGAC 5IV2A 3Q5RA 1TR7A 3O6LH 1LO5B 2HN7A 3F65A 5JPNC 4IKKA 2Y7NA 2FY8A 3HLKA 3W2DL 1QA9A 1KB9J 1G6RL 2WY3B 5JW4Q 4ICWA 1Z9NA 1FBIH 1D6VH 1IGML 1RZQA 4XR8C 2CXKA 1SQVD 1U8NA 3MJ9A 4KTYA 1P4BL 1PIFA 3NIFB 4MJ5B 5D1QE 2WXOA 4AGLA 2E74C 2VAAB 3EBGA 3IAQA 4HUWA 4U6VH 1QSFD 5ICZB 3H1KJ 1YDPA 2V5SA 1TQVA 3V4PB 1U8MA 3UBXB 5E6ZA 1MAJA 4BCXA 4JVUA 3BKCH 4U3FE 3G6AA 1KMIZ 5L8RJ 1T4KA 2CNZA 4GRLA 3KYKH 1Q9OB 4L8DB 3QXAB 3TU6A 4G6FD 1O6TA 1X0TA 3PIQB 2X4UA 3HUSA 2DEYX 1ZLVK 1DFXA 4UT6H 2CUHA 3O6FB 3REVA 2F18A 2DM4A 1E5AA 1URIA 3O6FD 4HT1L 4LSDA 4JDZA 5CBNA 3WJMA 1YNTF 3D39D 1UFUA 3L70E 3MRNB 2OYHB 3QHFH 5FK9B 5KBDA 2A73B 3TS8A 2WLKA 3WYRA 5GGVY 1L6PA 3W38A 2GFBA 3KYAA 3FKUS 3HE7C 2R2CA 4KHTL 2MHAA 4UQAA 4PAZA 3GMMA 5IJCC 2QBWA 3WUWA 2WBJD 4HUVB 3BAKA 2X0WA 4Z7WE 1FVEB 4P9MH 2O6DA 3CXHI 3UIYA 5GTHE 1KN7A 1FPTH 3OW2O 4HAFA 4I3SH 4L5FH 5SWQB 3VD0A 4JBSA 4LSUH 4UM9D 2P5WE 3VFSB 6FABH 2ADJB 2FYUE 4ZXBD 5CJBA 5IKCB 1CIDA 3U59A 4X80H 5APWA 4LDEB 3DURA 3ZTDC 2NZ1A 1IU1A 5CN3A 5GGTL 4TNEA 2BIMA 3OG4B 4X98B 4AUWA 2QEXP 3ZDXE 5KYYB 4DOHE 1Z66A 4I1RA 4HMCA 4X4ZA 1RIHL 3E3QE 3AE1C 1G1IA 5B4MD 2Y2TA 5C0NC 4NKIL 2A9NL 4BK8A 1NAML 2EYTA 4GQ9H 5J6GB 1HXMB 4KKPA 2J1YA 2QVAA 3UBFA 3NT0A 1KYOD 3QEGH 4C58B 1L5GA 3S3DB 4WUUB 4KQ3L 3HC4H 3OMAB 4LLMA 2BWIA 4QTIL 1FPTL 4L5FL 4G8GA 3VH8G 4K5OA 4AM0A 4FA6A 1USEA 4KKRA 4LEBA 2BDNL 5FS5A 4G7YH 4XHJD 4X7CC 3RZCD 2NR6C 3OC8A 2CUMA 4XNZB 1MFBH 4F8LA 4BRYB 4NHUA 2EINB 1S9YB 2ZUXA 4PD4K 5F6HJ 3F5WB 3U9PH 3LNGA 4CSTA 3N40P 3DIDA 1ASQA 4NZFA 5D2NE 3B5NA 2IXQB 3ZIMA 1BZ9A 2MEJB 2GSIB 1MREL 3HE6A 3HFMH 3MRFB 4I0KA 1NAMB 2DYPB 1YN6A 1QSFB 1T1YA 4HCRL 4P5RA 4RAUA 3HR5B 1Q9KB 5BVPL 1WBXA 4L3EE 1JGLH 4NCC1 4XNUL 3ESMA 5T3ZH 4Y89A 2ZWYA 1L9QA 4I0CC 5IVXE 3DSFH 2YFNA 5I1JH 3DMMA 3GLEA 1A4BA 1NGYB 1D6EB 4XP1H 5D93C 3V52L 1JPSH 3A6BH 3C87A 3RTQD 5FGCE 5KOMC 1U3HB 3F7YA 3G5XB 1OANA 5CJQH 2F54E 1M1XA 3IRZA 4NWTL 3QJFA 4UBDC 5KSBA 3BQUA 3EYOA 4E5XB 1FH5H 3FC8A 1RY7B 4BXSV 4R26L 3F64A 3FUIA 3BZ4B 2DWTA 3CUPB 1H8AA 5E94B 3T6WA 1F6LL 1YAZA 1BQ5A 5CCGA 5DCCA 2IGFL 1J8HB 3Q44A 3HMXA 3HRPA 1KBVA 3V0VB 2Y3AA 1P6WA 4PJHA 2IWGA 1TZHA 3K74B 4RBPH 2D3VA 3E6HA 3QC6X 3BGMB 5L2JA 2QADC 1LEIB 4KXBA 3ZQWA 1BZQK 1UZ8B 1MLBA 4HISA 5F6HI 1NPNA 3O3EA 1AMYA 3P4MA 4WI3A 1I3GL 3KPRD 1KCKA 1CFNA 1BBDH 1MDTA 3CLFL 4TVPH 3S2CA 3FSWA 3MREA 4UAOC 1LO4H 1OMIA 2MCPH 4UQ3B 5FX3A 3A0HE 2KDGA 2X2HA 5CUSL 2OTKE 2VL5A 1NTKK 2APXA 2LR4A 3W0WA 2BSRB 2VRSA 1MCEA 4L1HA 5T5NG 1ZA3A 3S3BB 1QATA 1V5JA 4H4NA 4CSSA 3DVNA 3UAJC 5IB5A 2DLFL 2JO1A 2PABA 3EDJA 2EIEA 4JPKH 4P23D 1G9MH 5EO0B 2QG4A 1NCWL 3PWJA 1DUZA 1VGEL 3Q5YA 4NO0A 2WLYA 3GXIA 4QJ4B 3CXHK 4P3DB 4CMMA 4ODUB 5DRNB 1AACA 4B95C 2BVQA 5T3XH 3VXNA 4B9FA 3K81A 4HOMA 3EXLA 3L5JA 4KKLC 5ACMA 4MXQD 4N78D 1WZ1H 3WS3B 4F3FA 1SS1A 4PJDF 1JWMB 2VDOB 3F83A 4AITA 2JEEA 3DGGA 3HPLA 1NAKH 3GJFB 1QRND 1VLXA 2D03H 3EF4A 4OCXL 2IYPA 4BFKA 1J88A 4LSSH 2VDML 4JR9L 4XNQA 3MTRA 3PNWB 3RK3D 3H1IJ 3IDNA 3HE6D 1ZLUH 4PY8I 1MPAH 2Q5BA 5DS8B 3D0LA 3GM0A 4XMKL 3A5TA 1E4KA 4NQVB 2DMCA 3QUKA 3NJLA 5JXAH 2QLYA 4N0FA 2DQ6A 1EGJL 1JNHB 3G6JB 3QO0A 3L3KB 4PV9B 2L7EA 4NUQA 1HVXA 4I0PC 1PYWB 5AG8A 4JHAL 3D25B 2A83B 4ODHH 5C70A 4Q2ZB 2NX5B 2SPZA 2PR4H 4Y99C 4YHKL 2VWEE 2VDMB 5GS2H 1SFCC 1VFMA 1MXGA 5GRVK 3X1BA 2XV5A 1Q81Q 4CDHA 5FO8A 5GZOC 3QDGD 3MGOA 3PFQA 5HYQA 4Y16B 5EUOE 4J3XA 3ZX1A 4QXTA 1CF1A 2YRLA 3PQYD 3LN4A 1DH3A 2IALB 4XWOC 4GS7B 4QRRD 4AQ8C 2PAJA 3GHGC 1DJIA 1JF6A 2A77L 3Q48A 4ZPVA 4PW4A 4WFFD 1OF2A 2I24N 1F3JA 4LLAA 1HTYA 1ZRTD 1F4HA 1SQ2N 4WWNA 2LU5A 4HKBA 3HAEH 4WW2B 4KZDL 5KANG 2JDIH 1CVSC 2Y7LA 3H1LJ 4ZMQA 5IKCA 4HKZA 5E99H 1UWEL 2XNAA 2F19L 1X5ZA 3GHGA 4ZMDA 3O0RH 25C8L 4O02A 4P9HC 4DKFH 4Q97A 1LT9B 1JHKH 2EDJA 3RA7L 3W0WD 1QX8A 2Z8WC 1I3VA 4RGND 4NFCA 4P9ML 4UOW0 5KVFL 5D1XB 2HRGA 3APFA 5IP4A 2LLLA 4NX0A 4L4TE 3BFWA 1AHWB 1BHGA 3EQ2A 2IDFA 5BXFB 1UWGH 2W9DH 3EFOB 4N8UA 3MLPA 1N7MH 3ENEA 5GJTL 1BMGA 2HN7B 3JUYA 4P48A 4KJPD 4HAKA 3WFCH 3NK3A 2OSWA 4DAGH 5KSAB 2CHXA 5IJKC 2YO3A 3VH8A 4C56B 3RI5F 3AT8A 4PGBA 2EYSB 3NCJL 3BRFA 4WV1B 4YLCA 2IWFA 3QUXB 3GI8H 3VX1A 3ULVC 3VMAA 4WY4A 1CT8B 1HOEA 5CFHA 3LZLA 4AQRD 4U1HB 5HY9A 4ABWA 5EUOF 3UJTL 1JDAA 1IGCH 5KTEL 4JHWL 2XQBH 5I0YA 1E4XL 3MBEB 3MRCA 1T4KB 1DQIA 1KZYA 4FI6A 4R4BB 4OZHB 3NJFA 4XVTL 3RGHA 2E5TA 2E27H 4FLHA 1JPFA 4BBWA 4ZMOA 4MMZC 1QLEH 3UX9B 3JXAA 3PAVA 2EH7L 1KPVB 3N41F 3QGVA 2Q86A 3Q7JA 5FYKH 2UWEA 3B9VA 1YPZA 2RFXB 2IMMA 4X7EC 4N0UE 2A6IB 3FTZA 3MX0A 4XNXL 1A02F 1MFEL 5A2BA 1AZVA 2PETA 1JYWA 1XSKA 3V10A 1N5AB 2NUPA 2X2UA 3KGTA 1BE3J 1EQWA 3LZPA 1MQKH 4EN3D 2ETWA 3FFCD 5C8JA 4PRDB 4KOBA 3BO8A 3JV6B 1NTMK 4PRAA 1BF5A 1RZFH 4Y9EA 3WUWB 1JL8A 4APQA 4DZBA 4MNQB 2QTVA 3MRBA 3QNZB 4JFOB 2V5YA 1VQPP 3O3BA 2VOTA 3UBHA 5I30H 3BZ4A 3CUPA 1E5WA 1TTGA 3IF1A 1X5IA 4KKLD 4FKEA 1U8KB 4HJSA 3FFOA 4HOWA 3LH9A 1ZGLP 2H43A 4P06A 4AJ0A 5MEPA 1W2EA 3TN0B 4UZSA 2DKUA 2NY6D 4AGNA 1LK2A 2ZF8A 5TTRA 4XPHH 4KGLA 1XO8A 2F1BA 1IV8A 1JK8B 2FATH 3KLAA 2WWWA 3EJTA 1TJHH 3KWWA 2XQYG 2UWEE 2G0KA 4OUUB 3TA3A 3US9A 5DDHA 2E7DA 1FO0A 1F13A 3IFNH 1K4CB 3UTPE 1TKWA 2M5AB 4L3EA 4UT7L 2NYYD 4U1IA 3U30C 3FRPG 5AOZA 1KOAA 2ZUTA 4BFGA 1QWNA 4CU7A 4PJIB 3V8OA 4EI0A 4D6TJ 3OKLA 2WKOA 1DBBH 1XTCC 3EJJX 5EOTB 3MRKA 5HGBB 5AW1B 5IREA 3X12A 3Q2VA 2ATPB 5CZXC 1A4KA 4LHUA 3SDDA 5A16A 2Q9IA 2BNQB 3VYNA 4MFHA 4R6UA 3H1JD 2C26A 3BKJL 2WN3A 1JY2N 3RI5K 3NZHL 5KLVJ 4ZX3A 2IBZI 3GQFA 2ZYGA 4JY5L 5D7IB 3DUUB 5CJ4A 3PHQA 3MV7D 3RFRA 3BKCL 3T1FA 5BNXD 5LCVA 5C39A 4TVPD 3O4OC 3T4AA 3ZK0A 4CVZA 3VTPC 1QASA 1MV8A 1KYOK 3PWPE 3W67A 4B0MM 1YZZA 4RWYL 1M4KA 4WW1A 3V5KB 4TQIA 1KB5B 4OY9A 4AIOA 3G5ZA 3VXSD 2RQEA 4RQQB 1PGPA 5GS1C 2F1AA 3F04A 1P7QD 3KMDA 3G08A 3EJSA 3X1FA 1QVOB 1A7BA 1D5BB 1AVYA 2ZX9A 5CEZH 1JOCA 1FFOA 3G04A 4DZ8B 4QMAA 4ZSOE 4LFHG 4OFDA 2R5BA 2FEEL 4CVXB 2ZOKB 3KHUA 1HVVA 3PXJA 1J1EB 3HE5B 1AZBA 1R24B 3HTLX 3BWUC 2Q7AA 2Y0SA 3FO9A 2RIKA 3ULUF 1DFBH 4EN3A 1DJZA 4CU8A 5DRXB 4JDVA 4XZUB 4KNSA 3HG5A 2LU4A 4HU2A 4MNQD 4I3SL 1X7SA 5F1SA 5MERA 3L4CA 5CCHE 4A2GA 4EOWL 3IT8D 4Z95L 3RG1C 4DOHB 1VZHA 1L2PA 1EXIA 2B1OA 5IMLA 3KPLB 2CO6A 3QNYB 3WFBL 1RUKH 2F7QA 1PL3A 1ZVHA 4NERA 4GSDL 1GJIA 3TN0D 3EOAA 3QI9D 5DF0A 4AXWA 4BH8A 5LGHH 1GL2D 5G5DB 4O9BA 2D2CD 2UZYB 4AENA 5KYNA 3STZB 3TTSA 3U1QA 1M3JA 4XN7A 1QBMH 3VYPA 3SY6A 2D31A 1XVSA 3GRGA 4NSKB 5FPIA 1WPCA 1XEDA 5BQ7A 1EPFA 5IW6B 2WUCL 3BE1L 2QHLA 3B5NC 1PZCA 3QDJE 2DQDH 3MV9E 2EDNA 2FLRT 2HSIA 2Q7YB 5L7XH 3B3BA 5LDSA 3EYSL 4JNXA 4Y9BA 3P9MB 3GF8A 4F24A 4F7EA 4QCIB 4PJEE 4TSCL 4J3SA 3VWKC 1XR8B 2QR0A 3IBOA 3DX4A 2FB4L 2EIBA 3MKGA 4WTWA 1MRFL 2OXGB 3SPHA 3FQNA 3QULB 3TO4A 4F57H 4WUKL 2J56A 3ZHKA 2P5EA 2EE9A 2VLRA 5I1GL 3AS3A 5IEKB 1E43A 2ZSVA 3P8CD 4G5ZH 2AK1H 3L45A 1XH3B 3WMM0 3VXSA 1UXMA 3I9AA 4M5TA 4MQSB 1P7QA 5HJ3B 2Q2EB 3T0EA 1BGYE 1YVLA 1DQQB 1YEIH 2P26A 3EZ8A 4PGDB 4X50A 3RILA 4DVRH 3CZEA 1JYXA 3QQDA 2DL2A 5T5FL 5EOQH 3T3MF 1QZNA 4AMKL 2JJSA 4JE4B 1GC1L 4NS0A 3QIUC 2FXPA 5DD5H 3BP5B 4OI7A 2D4DA 2BASA 3L72D 3L70G 2JKXA 4X0KA 5JDSA 4YO0B 3WFDH 1YC7A 4JZNA 3MFFA 4JFDB 3MRJB 1JE6A 4N8VG 2O30A 5GRXG 5FHBH 5ABZA 1LLAA 1MCNA 1SMDA 3STLB 1XZ0B 1CD9B 3BSHA 1X22A 3DIFA 4LL4A 1KYOI 3PQYB 5I1GH 1WBYA 4D7BA 1QFUL 5E1HB 2EVGA 1OTUD 3UBXG 3MV01 3TM6A 5HGHA 2FBJH 4MNHA 5CILH 4HIPA 2K9JB 1RPUA 4MDJA 4FTVD 3PHOB 2HJFA 4MNQA 3CVHB 5AENA 3LIUA 5D72H 2KUBA 4Z7WB 3KJ6L 2WTYA 1VEPA 4AQEA 1IO4A 2KZJA 2PKDA 4WW2A 5M7QA 2VR6A 1JYNA 2F53A 1JGDA 2O61B 5GS3A 4AV0A 1J1EC 3D51A 3RVUD 4G6MH 3GHGB 1TXKA 2YWZA 4O02B 3VXPA 5T1LB 5DO8A 3TN0A 1HT6A 4OKDA 1HNGA 3U7AA 2ZOLB 2R3SA 4N8PA 4EN2A 3N0AA 5DUPL 2X53A 3NDYE 4OD3L 4XN2A 2GC4C 2P80D 1LP9A 2C0XA 4O58H 2VAAA 4HUWB 1VSCA 1BM7A 4XRCA 4Z0BH 2VMJA 1NFKA 3T5WA 1T04B 4G8GE 3GHBH 2NNAA 3RVUC 4ANWA 3L72G 1EFXB 1ZKAA 2HRHA 3GJEB 1YRKA 4FADA 3DXAD 3LIEA 5CIPB 3OZ9L 3NAAH 1KTJA 1VF5D 2VDOH 1YEFH 1MCFA 4PRBB 3LH2L 4PJ9D 1MHHB 3CVIH 1NCBL 1J5OL 2KHAA 4WNSA 2FEJA 1BP3B 2C7UA 4LSTL 1AGCA 3QSKB 3UZVB 3ZDYE 4FA7B 2ODHA 4JRYD 3DVIA 2DN7A 3F7RA 4ZKPA 5C0FA 2QSCH 2UUDK 2CGRH 4XP4L 5EHFA 4RO0A 1SFHA 2PTUA 2YARA 3D9AL 2MHAB 3QUHA 4DSYA 4ALAH 3ARRA 4QLRA 3M9BA 1JSYA 4FNSA 4QRRB 4ECNA 3MRCB 4F8OA 2NQCA 3T0ED 1KXTA 1ZTXH 4LAQH 4U3SA 4KNQA 1I8IB 4QYOB 3RNKB 2A6IA 4P2RE 4D0DB 1TITA 4UILH 3ZT6A 3MLUL 4TM9A 3DTXB 2WQUA 1X6NA 4K8RL 3ZT5A 2GCYB 4Y2OA 4N9OB 5FECB 2QVMA 1SUHA 1PZSA 3GMLA 1ASPA 2IAMD 3DJRA 1T2KD 4IM8A 1XSOA 2ZSWA 3DX1A 4XMZA 4MJ2A 4JQXA 3AQDA 4JFDD 3N1MC 4XH2A 2EVHA 1FQ9C 3HHRB 5BRQA 4QY8B 4BGLA 1U8MB 3CI9A 3EH1A 3ZDYB 4F1ZA 3V4WA 1YEWA 1KWKA 1WIPA 1QBLH 3F7VA 1QWUA 1KLUB 5TDNA 1SN2A 2QJYB 4Y1TA 2FCBA 4G59C 3T0VA 3JT0A 4JRLA 2NTSP 2BSSB 1S9KE 2ESVE 3RVTD 3HPJA 3PPEA 4BQ6A 4BA8A 4GLRH 4Y2DC 1KC8Q 5F7BA 3UJIL 3QUZB 4MJ6A 3KPQB 4WI8A 4I85A 2FYUJ 4XNMA 3ZDWA 2EXTA 1Y7VA 3MV9B 4DW2H 1PQZB 5CLZA 1FSKC 3VXMA 4C54A 1FO0B 1LK2B 4UTAA 4W81A 4Y8DC 4D0CB 2VDNH 3MBWA 1RHHB 1NU1K 4KRMB 3CWBD 1E8WA 5ICYB 4M00A 3GLAA 1FNSL 1GL2C 4P23C 2MNUA 3DRQB 4FERA 4K8RC 1KUMA 4D7PA 5DMGC 4HUVA 4Q0XH 3EGSB 1GS8A 1RF1B 4PRPE 4OFQA 2BJMH 3KVPA 1P5VA 3PJSA 4FQJH 4W9JC 2FT8A 4S0HA 4GY4A 5JQ6H 1RD6A 1UUSA 2NYKA 4XCNA 3KLSA 3VI3E 3DMMB 3LD8B 5F7DB 3V0IA 3EFFK 5GIRB 2I07B 2O1AA 4P2OC 2XKMA 1AHKA 3QARA 2OMTA 2BMKA 1E40A 3AADB 3CXDL 4PJ9A 4U6HA 5FW6A 4NB7A 4AJVA 4G1EA 4JKNA 5CLYA 1WCQA 1AIFB 3ATBA 2DQHH 1MY5A 1NLBL 3GTTA 4KVNL 4MLSA 4ZO7A 4WHYG 2DLGA 3L3IB 3ULVF 1VKXA 4HDIA 1QVOA 1ZPUA 4PGCA 4XMLL 3I6LE 1OTTC 3O8XA 1MI5D 1G7LB 4G5ZL 5HJGA 4P9HH 4MN4C 1WD8A 5B7MA 2F7OA 1IUZA 2HKFH 2R69A 3FCTB 5DJYB 3Q3GB 4APQC 3EDEA 5L2KE 1MRFH 1UACH 3GC3A 2DOCA 3H55A 2J6EL 4F9LA 4IRSB 2FHFA 4BJLA 3NCMA 5I17A 1Z56A 3QZBA 3UIAA 1B9KA 1FS0E 5KYWA 2IAMA 1RZIA 5BOZG 5EWIL 2MPAL 5D9SA 3MFFB 3BXNB 4JFDA 5J13C 1BOYA 1B3JA 2KIKA 3QJUB 4X8GA 5CSGA 1RZ7H 1LWUA 1B90A 4PVMA 3IYLW 3D2UA 4KVCL 4J2QA 1MHPH 3US1A 2G3ZA 5JUEH 1HAUA 1AOZA 4X5XA 3O3DB 4TQEH 1HDMB 3U4AA 1I8LA 1N73A 2FXMA 2IQ9H 3MXWL 4WEBL 3AMLA 5KBNC 4RGMC 2HJFB 3WTSA 3QNXA 1OP3H 3QA3A 2B14A 1M1KQ 3H2WA 1LTTC 4A2HA 5A6MA 3S8WA 1DJGA 3JYBA 4EI2A 5KG9B 2ESVD 3F7YB 3G5XA 4FF9A 1HI6A 2E75B 2O01J 4DETA 1KBPA 5JXEC 3VXMD 4X6DE 1KGWA 2WMMA 4OT1H 4RKUJ 4W70A 4K94C 4C47A 2WPGA 4ZOEA 1KB9K 2ZJSL 3P54A 4YFLI 4KXCA 1J1PL 1N3NA 2FK9A 3U7YH 1XCTB 1Z1WA 1THAA 4ZTOH 1CR9L 5I5RA 3GRWL 3V0VA 1A21A 5J9PB 1CXKA 3DDFA 3ILQC 2Q87A 2JIXD 3VTAA 4MWFB 2B3IA 2JIXB 2DMGA 2F54D 1Z5LA 4MS6A 1AVOA 5FB8B 4XN9A 4LLQA 3L13A 5DQDH 1MCCA 3B1TA 4L1DA 3CFBB 1AKJB 1AVAA 4G43A 3R1GH 4HF5L 1EC5A 4R7DB 3EADA 5EORL 3ROOA 1W72L 3NJGA 3QIUD 4IBTA 1MF2L 2EYTB 2HTLC 1ETB1 2VSCA 2P43B 1FSKB 4OZ4B 3HLAB 1GJUA 2A9MH 2CLVA 4LL9A 3UBXA 4XMVA 5E70A 1PX8A 4JANA 2OXGA 4B3VA 1XV8A 2I27N 3HRZA 4P46D 4E9TA 1MWAH 2V6HA 2JVUA 1S7TA 1BIHA 4QHMB 1X5MA 3MRLB 2Q2LA 1HILB 2C4FU 4QHNB 3ZZSA 2F53E 3L3HB 5EU7E 4LGDE 4WNQA 3HFFA 1YEFL 3KWXA 4KQ4H 1HSBA 3PWVA 1N8OE 3REWA 5ID1B 2W6JH 4ZUUA 1CFSB 2V33A 5D4IA 4F5CE 2VC2L 1NM9A 5D1ZA 2Y36H 2C9RA 3HD7D 1KWGA 3KQGA 1PIGA 4X6DF 4MBRA 2AI0L 1VEOA 1IAIL 4WVRA 3WXWH 1OGPA 4WFHD 1TYEB 3GEWB 1U33A 4X4ME 1GSMA 3FT2B 4PW9A 3LB6D 2Q8BH 3CSTA 4G7SB 4AEFA 1Q7YQ 3FX0A 4K2UH 3WXVL 1BD2E 4L23A 1Y1DA 2LVCA 5JMOC 1U93A 5I19H 4L8BA 2QTEA 5E5MB 4OJYA 4EBQL 4Y5XB 3SYPA 2B7DT 4PV1D 4RFNB 1XZ0A 3MOQA 3TXAA 3NTCL 1MFNA 3DJTA 4ODTL 5FGBA 4LEXL 3VD4A 3B34A 5GGQH 5I8KL 3TGUE 5IM7A 3SGEI 1A6VL 2PWGA 4OCNC 4FE9A 4HIEB 5A7BA 4X5WA 3KLHC 3AXHA 4U1KB 2N0KA 1TJIL 1LO2L 5EV7A 2FBJL 2ZOLA 1DZBA 2YLKA 2COQA 3OKMB 5C07D 5JHLA 2R8SL 4PLJD 2KK7A 4Y28J 3L4ZA 1QLFB 3CHXA 1PW3A 2EAEA 1KGJA 2ILLA 3I6KB 3GSOA 2Q20A 4MVBD 1UZ8A 3QRGH 1VFUA 3FTVA 4HJIA 3LIZL 3CNKA 3GSRB 4DH2A 2MFNA 1OCOB 4YSEA 1G7MA 3S9DB 1UD8A 5FKAB 1K6QH 3O6FC 3B9KA 3KBPA 1EFXA 1JDCA 4H2AA 1NGQL 1QEWA 2DF3A 3C5SA 5GRJH 1KJ2H 2VSMB 4FQIL 2VLJB 3L1GA 5E2JA 5LDUA 2DMHA 1I8KA 3MRMA 3HZYA 1NOLA 4ZUTB 2OSLA 3K1DA 4YHKH 5L8LB 3MD0A 3RWFA 4KZEL 2LKMA 1JWSB 2EEBA 2AEOA 1V3JA 2ICWJ 4C46A 1WFIA 2YD8A 3BAWA 4N8CH 4S1QL 2DWYA 2OR9H 3QUYB 5AVTB 5TD4A 4LQFL 2I1JA 2CGZA 3WDJA 1HHGA 3NAAL 2ZKYA 4GEIA 2AXHA 4L3CB 4YR6B 3OJAB 1DJSA 3U4EA 4WI0A 3VFRB 4HJEA 4EI5A 1R8EA 2YIUB 1NFDF 3DVFA 5JW4R 4LL1A 1O7DE 5BXFA 4M1DL 2DDQL 1S5HA 2HVJA 3RVWC 3IJYB 1EHLH 3PE9A 4GFTB 2EZ0D 1I8LC 5F3HA 1QZ1A 2J73A 2BHFA 4XI5C 4HEME 4A2LA 2D0FA 4JFTA 5GS2D 5H94A 1BFSA 2D7OA 2QM8A 3Q3GA 5MEPB 4L0ZA 5DHVA 3GMOA 3Q6FA 1TEYA 1KENL 1WQVT 2WCPA 4FNUA 2F74B 4TT3H 4JKWA 5E9DE 1S7WB 3E1RA 4UIMA 3BCFA 3W37A 2D2CB 2CKBL 4KITB 1CGYA 5KJ7E 3OB0K 4PJIF 4I77H 3UZEA 1BGYG 3VYIA 3L4WA 1CVRA 3IDMB 3WN5C 2QHRL 4BUGA 5AALA 3PV7A 5E5LA 4M6NH 2IPUG 3UP6A 1NBQA 4G6JL 3P4MB 5LAPA 5HDQL 5EFIB 1UWEH 1DN2A 1FE8L 5TK2A 2WM0A 2ITDB 2W80C 2F5AH 4P5SA 4JG0L 3WG7B 4QTIH 3QBTB 4R4LA 3MQIA 3CFEB 2FNBA 2ZXDA 1WIUA 3RBGA 2I9TA 4LP4A 3D3VB 4JYBA 2GIMA 5D7IA 4RH4A 5T1KB 2B15A 4JUTA 3A6CH 5HDBF 1HI6B 1M53A 2WIIB 5I66B 1IFPA 3CC1A 4HGWB 3U7WH 1MNUL 5BZDB 5ACZA 2R0ZL 4RIRB 5T5NF 5ITBH 3MBWB 1L0NG 4MD4A 1DR9A 3MBXH 1KACB 3T2LA 1M6OB 4JFHE 4PW3A 3BIKA 2QFRA 4W9CC 4DZOA 1XGUB 1MZZA 4WY7L 4HWZA 3B9KD 2X1WL 2H1XA 2XG5B 1EFXD 2J1ZA 3O11A 2PYEA 4ODHL 3S35H 4JCMA 2PWFA 1NL0L 5SX4H 2CK3H 4NJAH 4R2GD 4JRXA 2NY4B 3BFOA 1EMTL 3JWOL 5D1XA 1JXKA 3L71G 3A0BH 5HD8C 2B5IC 4G82A 2BO0A 5D7SL 3V4VH 2B1AH 2X4NA 3FO9B 2IAAC 1RJLB 2K7PA 2KLVA 2R7EB 3O2DA 4TSCH 3IVKA 4FP8H 4OD1L 2CK2A 3B9KC 3BESR 1OSPH 2GPZA 3DGCR 5FYLD 2DMBA 1GZQB 1OARH 4XNAA 4Z1PA 2QADD 1SBSL 3DX3A 3TCLA 1R75A 2RN0A 4G80B 2V3DA 2DMKA 4QHMA 4J3VA 3ULVD 1EEZB 4MAYC 3CX5J 5I9QB 1T0OA 1F4YH 1JGEA 4GW5A 3FUHA 5CP3A 1CFSA 5KUKA 1FA4A 2W0FB 2EIMB 4DGUA 3DUSB 4ZAKD 1HF9A 4YDLC 3BEVA 3MJ8B 1ZSDB 2HFGH 3F3HA 1ZWIB 1C1EH 4DT0A 3II2A 1DD4A 2NMSA 1E8YA 4OZFA 2ZOWA 4WFGD 3OAUL 1HWHB 5MEOA 5D7KD 4DQAA 5IROA 2VDQL 3CIQA 4F20A 2BCCD 4PB0H 4FQCL 1FFOB 4P3WA 2JQZA 1N5AA 1PGQA 5GTIH 3BN3B 1FZJA 1E3ZA 4KC3B 1PLGL 4KDWA 5EO9B 3U4KA 3H42L 4P2QA 2G5UA 1TZOA 3FB5B 1MJUH 1R24A 4ALAC 2X6VA 2FGZA 5DJ0A 5B8CA 1GYAA 4NCC2 2ZJSH 3KYOA 2K6WA 4LCWE 4NQXB 3OLDA 4XPTL 2VMEA 5EU6A 4EEEA 1CXHA 2CRZA 3AJ7A 2HT4C 4WO4C 5I0WA 3QULA 3SFDC 3KYNA 3HN8A 4X80L 1AHWA 1ORSB 4QRBA 2E75C 4AYID 2GAZA 8FABA 1L7IL 3EYQC 4ZPTB 1B4TA 3EFOA 1R4XA 4Z3IA 3QZPA 2BSTA 3VVVA 4KTDH 4P04A 5KSAA 1N6UA 5LGJA 4YDJB 4EKXA 3AY2A 5IMOA 4PGBB 3CSGA 3KVDD 2PXYA 3ZL4H 3THML 1JMBA 2BS8A 2V2TA 4I0PB 3QR0A 4ICXA 3AE6C 3QRLA 2J58A 2XKNA 5BJTA 1S9YA 4TUKH 3FB6B 4XVJL 1ZV9A 2Y7MA 3ZHLA 5B3SB 3QEQB 5F7YC 3IGUA 4JZNB 4M1GH 2WKLA 5AL8A 2JKNA 3Q8EA 2X4UB 5EOTA 3RX5A 3TBSA 3HI1B 3NZHH 2XBZA 1EH9A 2WSDA 3BISA 5IG7B 3UTTA 3FONA 1IRAY 4JFZH 3NMDA 2IDCA 1NTMJ 2B8OT 4R97C 4X6BA 1X5JA 2XY1A 2BS9A 1ODAA 4KTDL 3BKMH 4OF7A 3FO1A 2BXZA 4F7KA 5LG6A 3C5JA 1ZEAL 1SMOA 3QEHB 4WW2C 5HYSA 2OYKA 4ONGL 2W94A 2BP8B 5EZLB 2PR9A 4R3SB 2C8NA 5LLIC 4I48B 3GDBA 5DD0H 4HWBH 4E9XA 4E9LA 4D3CH 3NEEA 3T2QA 3K4AA 1M8OB 2XWXA 1IC7H 2K9FB 2QGDA 2IANE 3FBKA 1DBKL 4Z7OB 3VGEA 1YEEL 2ZKHL 2DS4A 5EEZA 4FQ1L 2RQ8A 3ECUA 3ETBF 1PV3A 1AHWC 4E9RA 3ZYIA 4M8VA 1CLCA 1R17A 4LVOB 2AITA 4YDNA 1DLFL 1DCEA 4JGMA 3PABB 3G9AB 2H5UA 5JLZB 1QKZH 4F5CA 2B4CL 4Q52A 4PJBF 2V8MA 4FQCH 3A3YB 3BVDB 2XIBA 1OSPL 3QXDB 1NAFA 2HFED 3M1BB 4FFWD 1GAFH 4O00A 1U95B 4O9HH 3SCMC 5JZ7D 4OT1L 4HSQA 1AKJD 4U6XB 4UIKL 5HYJB 4MAYB 1G7QA 3HG1B 4P2QD 5I9QC 4WWPA 3P4OA 4K23H 1IQDA 2VXTH 3DX8A 4TL5A 3EDFA 2PWHA 2QKIA 1CDYA 1U4FA 1Z3RA 4YGAB 5EA0H 3DKHA 4KI5C 2XQ0A 2AQPA 4JUSA 3Q13A 5KBKA 1TLKA 2F19H 3O0RL 5F1NA 1A7RL 1NH6A 3N9GL 2GBUA 1FGNH 2ITFA 2XFGB 1FZMA 2GQHA 2OMXA 5EPMB 5EO0A 5GGVL 1F4YL 3ECWA 5ERWA 2KLUA 3TWYA 1HEJC 4KDTA 3ZRCC 3H9SA 4W4OC 1PDKB 4JFQB 5I1DA 5F44A 1ZT7B 2C9PA 1WO2A 1MFZA 2VLJA 3A23A 1A6TB 4EJ1C 2N4IA 4RLDA 4Z23A 3TYGH 4JFUA 3DUHA 3L1OH 2HJKB 2DYPA 1H3PL 2K7QA 1ZMEC 1MN4A 1NKRA 3BAXA 3E6FB 4PEEA 1MXDA 4XPBL 1KJMB 1T83C 2XZZA 3L7FB 4OD2A 4LQ1A 2YZ1A 4PJ5E 4Y2NA 1CC3A 4WO4B 1FE8H 3RKDD 1OW8A 1IGTA 4YPGB 4LSVL 2NY1B 5AB9A 1LMKA 4JRYE 4WDIB 1HHGB 4NQVA 2EXYD 1A9EA 3UTZB 1LNUB 1JPTH 3VFOB 1AO7B 3CD6P 3QJFB 2I60L 4XBMA 3W82A 2R0LH 5B1KA 3RHWF 2RJMA 3W2DH 1GJWA 3LKNB 4H5SB 1GMIA 3PJLA 5IEKA 4I5BA 4JGJA 5D2NB 3WJJA 4AVJA 5DVKA 3JZ7A 1FN4B 4AEHL 2EKSB 4P59H 2DBJA 1TT6A 3B5GA 4WO0A 3WJLC 2YRBA 3FT1A 3U30B 4HZ1A 2ENYA 4UOZA 1OVUA 4OLEA 3MJ8A 2XI9A 4YUEH 2X6BA 4ELKA 4OBRA 1F00I 3LH8A 3QJHB 4JPWH 3IMUA 4YSCA 4U7JA 4L3FA 2ITCA 4F8NA 1HJBC 1EUTA 3VMNA 4D0BA 3U0PA 3LIZA 1PPIA 5JW4M 2OXHB 3FJTA 2HFEA 3TEWA 2O4EA 2C5DC 1EXHA 3RX8A 3ULVH 4P5TA 3NA9H 4OGQC 1IGJA 3NP3A 2R2BB 1GIGH 1YJDC 1K4DA 1BGXL 1LT9A 1A3ZA 2A6DA 3ARGC 4PBXA 5C08B 2WIIA 1IAKB 1PG7X 3R7RA 2AV1A 4XP6H 5K59F 2X40A 1OW0A 2CLZB 4QY8A 3CSYA 3EO1A 4N28A 2UXFA 5TDNB 3HS0C 4CILA 3TURA 3FF8A 1SY6L 4WI9A 2APSA 3GJFA 4NJ9L 3O11B 4OVVA 4GKNB 1MCKA 1XF3B 4GXVL 1AOHA 4MQXD 4IIQC 4FXGC 3RFZB 3CXHJ 2VLJD 5DZAA 1M56D 1VQ7P 2PLTA 3BIKB 3HNVH 4Q9RL 1AQDB 3R4YA 2VM3A 4QKXB 4H8WH 4WI5A 1ND0A 3X3GH 3TO4B 3V6OA 3DX6B 4MQ7B 3NFQA 3MUDC 3IDYB 2DYPD 1JPEA 4N8CL 4OGYL 3E9UA 1TJIH 3HVDA 5APTA 1WT5C 3IPBA 2R69H 2HX7A 3FSAA 4PHXA 5I5JA 1NGWA 1XWVA 2HYMA 2B5IB 1FYTE 1VDFA 3AE7C 1I9RL 2QSVA 1RHFA 3FYIB 2P5WD 5AWNH 3GYRA 3HNTL 4X6EA 5CM1A 3AXIA 3QIWC 1EZSA 4FNQA 1INEL 3CLEH 1F1DA 2V3FA 3FO2A 3QFDA 3NIFF 4TTDC 2BOBA 3L5XH 4PJEA 5CZVH 4NQCD 2D7NA 5D1ZC 1RU9L 4I8DA 5I1AB 3OXSB 3AG4B 3B5NB 1C08B 5ISZA 4K5PA 3QA3B 2N1TE 4F9PC 3AEFC 2OMTB 2OL3B 1HE8A 4R4FL 3O6FA 4GQ9L 3KH3A 4R3SA 4WU5B 3ETTA 4W6WB 1T3FA 3GS4A 1WH0A 3H9SE 5EEYA 4N3UA 5FK9A 3QFJE 1PX4A 3HZKA 5I0XA 1OGAA 5ALCH 2XJLA 2OR9L 3ZBMA 2DWSA 2A4CA 4Z7WA 2WC7A 3UGXA 1M71A 5IVNA 2GCYA 4Y2OB 4NDMB 4MB3A 2E75D 5FYJE 4YXHL 1BYPA 2IBGA 5DZLA 3RURA 3N44F 1ODUA 4LCWA 4M61B 1KXHA 2A0LD 2IGLA 2R1YB 4GBXA 4U6YB 4Z5RA 3LNFA 4B50A 4BSVB 2IDTA 3HD7B 3QDJA 1E9OB 2DKMA 2IWKA 2XNDH 2QSTA 1JM0A 1UJ3A 1GS6X 2F68X 4F58H 4DGYH 2ZZUT 3QIBA 4QXUL 1HQ4B 4Y4HC 3R4RA 5DZOA 3D85B 4ETYA 4Q89A 1NINA 3F7VB 5DA4A 5DD6B 3PXLA 3TH3T 3TLRA 2QVFB 3S36X 2RAMA 3HMWL 1K4CA 4Z8FH 1J5DA 1H19A 2GAZB 5GRVL 3W39A 1VQ9P 3I85A 4WWID 4BE6A 3GSVA 1WC7B 4PCTA 2PW1B 3L2NA 3MROB 3MNMA 1SQBJ 1WV7T 2Y9YA 2PXYC 2VXQH 2ZUYA 5B21A 5JHBA 5KVDH 2ZF9A 4JYCA 5AW5B 4BH7A 4RMBA 4XB7A 2O1KA 4OCLC 5FWQA 3FRUA 4YHZH 3OKOB 1FZCB 3QO1A 4IBWA 2IPPA 5EZJA 1T6VN 2XWJA 4HC1L 1I1AB 3ABVC 3HAEA 3T1FB 5IB5B 1RZJH 2IZ1A 2X4SA 5FOBB 4YSDA 1BXVA 3AM8A 5SWSB 1SUJA 5LWYH 3C9NA 4S1DD 4N2EA 3BDYH 5C0BB 3TPKA 5KZCD 2CK0H 5IG7A 4HBCL 2G9HA 1GYCA 5FDWB 1CLYL 4K7PL 2VRAA 3T04D 4WGVB 4K3EL 5KYXB 3MLXL 3HI1A 1BLNB 3V4VB 1KIQA 3EH2A 3FO1B 1QUPA 3AE4C 5E2UL 3F58L 5JYLA 2UZIL 4HJUA 3P0YH 4H8PA 5K9QI 1CICC 3FT9A 3BVNB 3NDZE 1CR9H 1UOWA 3EBHA 4JRXE 1URQB 1TVBB 3VFMB 3RFZC 4XNQB 5JW5B 1UA6L 5FUOL 1NUGA 5D7IF 1T2JA 5AYUL 4AVIA 4YSSA 1OAYH 3H9HB 1ULVA 3EWKA 4XVJH 3QDGB 2L91A 3ATDA 3TO4C 3QYNA 5I0DA 2GJRA 3U6XS 1JMMA 2J2ZA 4V2BA 4BFNA 4YSOA 3EYSH 3FOLA 4KUZH 3FQTB 4UQBA 2W0PA 2Z1PA 4KXZI 4U3HA 3AT0A 4QHUA 5D6DC 3WE6B 5EF2A 3CZSA 4TRPH 2G3AA 2LAGB 4JY5H 5KSBB 3SDYL 2YAHA 4PFEA 2VABA 1CE6B 3WMPA 5F9AC 3GRWA 2F7RA 2C9XA 3SYCA 5EULV 2X1PA 4QWWC 3R1GL 2Y22A 3U0TA 2Q6WB 2OMUA 3AGWA 3MV9A 3B4NA 3OR7B 3QDJD 2E6JA 2SEBA 4M1CC 1ZDSA 2Q1KA 2OMBA 4XHQA 2Y0CA 3CXDH 1MCPH 2FIKB 3QIBD 4Z3FA 4Z3HA 3MYJA 1M7DA 2KSJA 3GSXB 2QMKA 1G7IB 1CG9B 1CFNB 4NN5C 4J3WA 3UACA 1G5AA 1X6LA 2QJKC 5AW6B 3U7YL 2XV0A 1KELH 5E6IA 1ONQB 1NEZB 1PZ2A 2BJML 2FL5A 1BSHA 1ACXA 4FQJL 1SEBA 3ERXA 3H1IG 3MNVA 3QNFA 5B1JC 1JVKA 1PBYA 4FGMA 4PBVC 1EDLA 3EJRA 2P52A 3VD7A 3MAWA 2J57A 1G6VK 3KS0H 4J27A 4PBWD 4Z7AA 1XMEB 2C1OB 2OMVB 4Y5VC 1FFPA 4WW1B 1MVYA 2BRRL 2WBWB 3M1OA 5FA3A 3TFKC 3V5KA 3C08H 1IL1A 3U1SL 2FWOB 3VMZA 3RYMA 4LAQL 3HUJF 1E9PA 4DW2L 4TQEL 1N19A 3GB7A 1DVXA 3U9UB 3L73E 4ZUWB 4JN1H 2ZPKH 4KO5A 2WUBL 3VFUA 3ASOB 4N6RA 1EEYB 4F91B 4NKDB 5H2BA 5IBUB 3P0GB 3LHPH 4QJ3B 2NZIA 5T3ZD 2F7PA 1FJKA 2NY0B 1E42A 3VWKB 3GM8A 3VFOA 5F1IB 4XTRD 4RMUA 3WCYA 4JW3A 4GW4A 4LIQL 4M7JL 5ECJE 4WDIA 3D12B 3NIGB 1QLEL 3CN3A 3QWRA 5DS8A 5KVEH 2M8RA 3L73G 4HUKB 3G6AB 1RUAL 2FBWC 5DHYA 1Q72L 2FHBA 5B38B 1M7IA 1CXIA 5FYKU 3B56A 4U3FD 4QRPD 1MJ8H 3S0PA 4LKCB 1RK7A 5A2LH 3BP6B 2VXUH 3QWOB 4QDGA 1J2JB 4P2OB 2WXFA 4PVNA 5AAMA 1MW1A 4LFHD 1DVYA 4QRUA 4YSRA 4NENA 1JXGA 3CQQA 5D8JH 5H37G 1T20B 2A45I 1ZLUK 1N59B 2W1NA 3DI3B 3A4DA 3HBQA 2Z31B 4IU3B 4EZKA 1XIWB 2C9VA 2WANA 3FHQA 5A2CA 5KAQF 2POHA 4GKLA 5FO8B 5IB3A 1XSJA 3ARDA 1XR9A 2QSCL 2YBRA 1BD2B 2IQAA 3S3PA 3EJQA 2GC7C 2IADB 2GA1A 3L3GB 4LP5A 3SSUA 1IEHA 2X9WA 1RURH 2DQUH 3MRBB 3QNZA 3RGVC 2JELH 1X44A 2N7AA 3TGUD 4HKJB 4I9WD 2BSEA 3QIBB 3N6YA 2N7BA 4YWGL 1HL8A 1LK3L 2QGCA 3AAZA 4F7TB 1U8KA 2OKMA 1S2EA 1AI1L 1Z9SB 4HHGA 4HOXA 4YHYC 1IK9A 4HKXB 5IB1A 2WZAA 3SPGA 4N0YL 2VISA 3GS0A 2R9HD 4X9HA 5J13B 3CL3D 4LPTA 3EUDA 4PB9H 3X3FH 3ILPA 2GBVA 5CBEA 4DVBA 2B2XL 2EKJA 2FBRA 4ORZC 5IV2B 2LU7A 4UB0L 5EU7C 4HUNB 5LBSL 5DD3H 2G0LA 4HUUB 2K45A 5D7JB 1P1VA 2H0FA 1YAIA 1YSOA 2VQTA 3NJHA 5J5EA 4MCYA 4HIXL 3QDHA 4X6CA 3FUNA 4PJGB 5K9QG 4U2ZA 1F1AA 5IJKA 3WXVH 5ECGA 1YTZT 1XQ4A 1L0NK 4LBAA 2CMRL 4LU5H 2BVOA 1Z9LA 2G5BA 4NN5B 2NNFA 3REVB 3K2UL 4ABUA 4OJDH 3IDYC 4GQPH 2KYVA 3L3JB 1TSRA 3AEDC 2VC2H 3QXWA 1Q9LB 2YD2A 2OYHA 4ZFZB 3T97B 1TIUA 3K2IA 3LMJL 1WRFA 4UTBH 3ZTJG 2WMPB 5FUCC 4QT5A 1JCCA 3OXSA 5TJWK 5DFVC 1T1YB 3B2PA 2AC0A 3NH7H 4WF7A 1UCTA 4PI2A 3FW6A 4OQTA 1K85A 3QFDB 3BKYH 1OVRA 3TH4T 3QFJA 3C8HA 1N5YL 1FHNA 4QOKA 3QPXL 2Z34A 1SOKA 4DCQA 1LEKA 1Y8AA 1P5UB 5KKZB 4HIXH 1ZTXL 4S1SH 1X4YA 1A9VA 1I1YB 4I2XA 4XGZB 1U8PA 1G9NH 1USZA 1HH6A 2WLIB 1NGQH 4EI5B 5A2JH 1JFQH 3HE7A 1R5SA 1F4WL 1O9VA 3GSNL 5CIPH 2GIXA 4AMKH 5A6LA 1DQJA 5L4JA 1M71B 1MJ7L 2J8HA 1HJ0A 1BF2A 3APMA 43CAB 4NO2A 4C7NA 1TQSA 3CPLA 3GWJA 4OM0L 4LCWB 3GSNA 5JOPD 1MWAB 4LBEA 1DJYA 4K07A 4RZCB 4P57B 4EF3A 1JZFA 3AT9A 4JFDE 4KHXL 4TVUA 4IGBD 3HUSC 3ARDD 3HAEG 3OHMB 2WBXA 1FLRL 1JFHA 1NFDB 5L2KA 1KBKA 1QFUH 4IFMA 3HE5A 2YEZB 1DX7A 2HRPL 2QJYC 1T04A 3V5DB 2C9QA 2O6FA 2W0KA 4MJHA 4X98A 1G6RA 3S37X 4JPVH 4G6AC 3BATA 1S78C 3A7OA 3LEVL 3VXQB 3QWOC 4Y2DB 4UM8A 5MI0B 5DUBB 2C9UA 2VZ3A 1EDJA 4OZIE 3L3DB 1PG7W 3TA3D 1M3IA 1MAMH 3BIBX 4X4YA 1ZT1A 3W0WB 5EIQA 4ZSOB 3H1KG 5MHSE 3HZVA 1NQBA 1T2QL 1IM3D 4Y5XC 1MSPA 1F58L 3L8QA 4YIQA 4ZNEE 2C1PB 2ORBL 3VTMA 5GS0L 2ENPA 2PTTA 2WLMA 3NP4A 4KPHH 3T71A 3H56A 3P2TA 4DOJA 3SYQA 5FCSH 1GGYA 4FNTA 4LLWA 1GYUA 2YA1A 2XA8L 4P23B 3DYOA 3UZQA 5GSRA 5FO7B 5LBSA 4NSKA 4C57C 1A7NL 1OAQH 3HR5A 3GW6A 1UZ6F 4FTVE 4KAQH 4M6OH 4ACTA 4AGQA 3HBPA 4M4RA 4JO4H 1FZCC 2VM4A 3DVGB 4MX7A 1L4AD 4OF5A 5BO0D 1T0PB 3UAJD 1JWMA 1ORSA 4YDVA 1AG6A 4Z95H 5HI3D 8FABB 1UM5H 3DYPA 1RSYA 1U4EA 1NCDH 3A2AA 1G43A 4RISL 4K5LA 2NX5D 3WEOA 1DN0B 1U58B 5KYUA 1GD2E 1L4IA 1P84D 3VNZA 5ESVB 2QKSA 4WTQA 2OCFD 2KB7P 1J7VR 5ESQB 4AY0A 1HXYB 4YE0A 5GRJL 4KQ0A 1TTFA 3VD9A 3GXFA 3H1KE 4PCYA 1A66A 4K3DL 2H3XC 1GCYA 1K8AQ 1UZGA 4QOKD 1XH3A 3C6SB 4ASVA 3KLQA 1IQDB 3M9HA 4KI5E 2O5XL 2VN5A 4NC1C 4PRPD 1LTGC 1PFCA 4PB9L 5HJDA 3HPJB 4FRWA 2V2XB 2VLRB 2UXGA 3G3LA 1XD0A 2ZONA 3N3EA 1HGVA 3H2PA 4UQDA 4UNIA 5KYYA 1VGEH 1MOEA 3QQ4B 2CR3A 4JG1L 2V9TA 4F7MB 4MRBA 1K5NB 3N42B 1S7UA 3DC0A 4JDVB 2FYNC 5EC2A 1CD8A 4XPAH 4AQAB 2R3CA 5FM5M 5DSCA 5TE4H 2WPRA 1P69B 1WEJL 3ULAB 3ZE2B 3BWSA 1H0DB 2YXRB 3KPRA 1N26A 3IU3A 4YE4H 3MREB 5LAXA 4S1RL 1H6UA 5IJVA 2XXMB 1NTZK 5C0DB 5I30L 2IFMA 3QUYC 5DMIL 2NLJA 4EBQH 2CO1A 3M88A 1EAOA 4Q8BA 1TU2A 1IGFL 4ZS7H 1LJMA 1PKOA 1QP1A 4MA3B 3D50A 4PS4H 5FV1L 4UINL 4IRZL 4GMSH 5D7KE 1BG1A 3SDCD 2D2CC 2W83C 1D5MA 1TQTA 2K8MA 3WS3A 5F1OB 4YPGA 4NUGH 4NAJA 5ELIA 2FYVA 5LXGH 2DRUA 1J86A 1XGTB 5DC9B 1ZJAA 4NO0D 1GGBH 3OF6D 5F72S 1EWHA 5L4FA 2K0RA 5EZOH 2VZTA 1IE4A 4JRXB 5JIDA 3FTUA 1AKPA 3NQKA 1DO6A 1R19A 1IC5H 2Y24A 1AXIB 4HEMA 5ICXB 4XP5H 1CD0A 4QOKE 5CKAA 3IS0X 3NVQA 1Q0XL 3K6IA 3GTVA 3GDCA 4O9HL 3WHXB 4GXUN 4N90D 2OYPA 2ERJB 5IR1B 4Y5VB 4L2YA 4B0MB 1T1WA 3H7LA 2Y07H 4TLUA 5DMKA 5I8EA 1J0ZA 3MACH 3BKML 4Z7VF 3SKJH 5MI0C 3OLEA 1ZN5A 1JZ7A 2C9LY 4DKTA 1FYTA 5E2UH 1UWFA 3BW9A 4X7SH 4F7CA 1OZTG 1SVFA 3VB8A 3O4LB 2IYOA 2OYOA 1S5LE 3TNMB 2WNWA 3U46B 1A6TA 1IC7L 2GKIA 3VCLB 1Q9LA 2FH8A 4U3CA 4E5XG 5JDJA 4OM1H 3J7HA 1ZLSH 4MJ5A 2CRYA 4M56A 4GAYB 1C1EL 1CGTA 4NO3B 3WNNA 1QSVA 3SDXB 1H5BA 3LTVA 1CIUA 1NJIQ 3LN9A 3F84A 4ZFFB 1JNNL 1L9NA 3H1LG 2R5DA 1DO5A 4PRPA 2EH8L 3RK2D 3C6LD 1I8IA 4QYOA 1FZGA 3T3MB 3F85A 4TNGA 5I6NA 2BSRA 4TN9A 1BIIB 3VOPA 3OAWA 3ZE0B 1RZJC 2AEQH 5I2IA 2VW7A 4XB3A 2P48B 4H2CA 3KLDA 5C08E 1QNIA 4JRWA 4QRRA 1AZUA 4C7NB 1U8LB 2VR9A 4QRSA 2FEEI 5EDSA 4E9SA 5HGAA 4M43L 4IOFD 5KSAC 3IXTA 4WGWB 2D7TL 1ZT4B 3S96A 1SY6H 4TUKL 1GMJA 2C0WA 5CHXA 5GGTH 1TUPA 2F53D 1SDDB 2IEPA 1WTLA 1SQPG 3O3AB 4KVCH 4PWGA 3FOMB 3D1MC 4F58L 2FUQA 5F88B 1CF8H 1YNTA 3BSGA 3NZSA 3WKMH 3VXPB 3GRBA 4PJAE 3RGVB 4DK6A 4ODSL 3HG1E 3D4CA 1BQHB 4NZDA 4XXDB 1FC2D 1OZHA 4FI7A 5BRZA 2FYNB 1JNLH 3VXMB 2Z64C 2AV7B 1WS7A 1NCAH 4YX2L 1D5IH 2EO7A 3ZDXF 2BVUA 3MLTB 4X4KA 1SGKA 1U8QA 4MCYB 1MG3C 4HC1A 1BXUA 4G11A 3MRKB 4OJFH 4PJBB 5HGBA 1Q2NA 3S88L 3BYTA 4DN3H 4WO4D 1R0AH 4O2EA 4KRLB 4MMZA 1RK1B 5CF3A 4HKZH 5I5MA 4XCEA 3RPBA 5KAFE 5E2VL 4AL8L 3VQ1C 1F56A 4BZ2H 2H6OA 1G94A 3N85H 2VDQH 3UG4A 2OZ4H 4NQCB 3CLQA 2YGOA 5JW3L 4JRYA 3MNZB 2CK0L 1RULH 3H0TB 1AA0A 1Z3GH 2XQYK 1OARL 3MYZA 1ITCA 4U0RB 4EMZA 4TTGA 2VLRE 3UPAA 3G5WA 1I75A 2WSFH 1HIML 2WKOF 2R0LL 4G72B 4DVRL 5JOFB 2AERT 3QFJB 5IGXL 4ETQB 3T97A 1LTJA 2N1TC 5J6SA 1Q38A 5EEXA 1P4IH 2AJUH 4ODXA 5IHLB 2VC2B 2RA1A 4IRJA 3RLSA 3NFNA 2JF1A 2GBAA 4D0DA 3VMXA 5J06A 4OBSA 1IX2A 1LVEA 1ZVYA 3IDGA 3S35L 4BKTC 5JIQA 1OD9A 4YHPB 2N9YB 3WY4A 4HWUA 3GMLB 3L74J 4W80A 1MFCH 1LE5A 5IVXF 2P8MB 3MBED 4JFOA 4OCYL 3Q1EA 5KKZC 5DQJB 4ILDA 1VADA 1CI6B 3C5XA 4HWEH 2GTWB 1J8HE 3AU0A 4Y7OC 1BAGA 1JZ6A 1FNLA 2PW1A 1KYFA 2KT6A 1SJHA 4DWHA 3IDUA 5E51A 4JREB 4O58L 5BUPA 3H1LE 3NJNA 4R97B 2AKRB 1SOSA 3L5WB 3FO0H 1K5NA 5K39B 5EU5A 5C0IB 5CZRA 5C0CA 3V2NA 2AABH 3WN5B 3V2QA 2P1YA 4M7LL 1RE4A 3RK3C 3GZQA 4LB8A 5JHAA 2NSQA 1FZBA 4B60A 1ROCA 4OUUA 3D2UB 1OCWL 5JXED 3BWAB 4KXZH 3ALXA 3SJVE 2XIIA 4YLQT 5AAPA 3FN3A 2ZAEB 4F92B 4ZZKA 5HY9B 4MHHG 2KNCB 3EOAB 4BH8B 2H88C 2QVTA 3K2KA 1R5IB 4ONFL 1SQBE 2E0PA 5I16A 5D5ME 4NP4L 1XGZA 4HQQH 4OI9A 3SDCC 3QIWA 1CFMA 4LHUD 3SDDD 3SEPA 4XMKH 3T4AB 4CVZB 1ITBB 4MAZA 1U8OA 2XRAH 1TQCC 5DLLA 4X7FC 2JI3A 3EHBD 1J5IA 1URQA 4D9QD 5DEJA 5F9JB 1G7HB 1MHEA 2H2SC 4MNGE 5JMRA 1IEAA 1EO7A 1U57A 2GY5A 1S46A 5F9DC 4OZIA 1F18A 4L1TA 2NUPB 4OV5B 4ELME 4AUYA 1C7TA 4MWFA 3GGWB 4HUCA 4YLBA 5JPNB 4FJZA 3QW9A 3BQUC 2NY4C 3D3VE 4LSPL 3NMEA 2P5EB 1EZVY 2Z0UA 1LNQA 3KCPA 3NQIA 4XTRC 2VR5A 5D2LE 4MZRA 3K6SA 1IFGA 3CVIL 3U48A 3SCMB 5HVHC 12E8H 2XJKA 3X3GL 1IBHA 1ICTA 2CLVB 3WE1A 4HPYL 2R2EA 1HHHB 4MLIA 3QDMB 4UDTA 5TQ2L 5A3ID 4FFZL 4Z7NB 1PPJE 1KEMH 2VDPB 4UB6H 5D4QA 1KYAA 4PLNC 3ROOB 4B9GA 1TZ8A 3QZMA 5I28A 1R46A 2YNYA 4IK7A 3C9NB 3OG6B 2YSSB 4M1DH 1PIXA 3QQ4A 2AXTE 1AS6A 3TFKD 3PXHA 4FCHA 3BE1H 3SWFA 1UGKA 4QRTB 3MNWB 3VB9A 3H32A 5FFGA 4R7VA 1GKEA 1I7ZA 3MBEA 1CBVH 3WO3B 2XWDA 4LSSL 5C09E 1WGVA 4YL4A 2IBZE 5EC2B 4I6MC 1NAKL 3L3KA 4JFFB 4YDLB 1OT2A 4XPGH 2ODIA 3C8KA 1LT1A 1V7MH 4JQVA 1HOCB 2R2HB 2YPLB 4IW4C 3HUJB 3BRDA 4PJFF 4HXBH 3RGUA 1K4DB 3CDZB 1UVQB 2Z0BA 3K80A 2Q7CA 2Y3NA 2AJZA 4GT0A 4F33B 3CFCL 3QUZD 2VAJA 2ADYA 3F7KA 4D6TE 5H2FH 5GGTA 5F3BA 2AZAA 2WO3B 3HJEA 1ZR2A 1ILUA 4H7VA 1NTKE 2V7QH 4YUEL 4AIXA 4YFEA 1JB0J 3GMRB 2JJTC 1DEDA 4U05A 3TIDA 3ARQA 4YSUA 1Z9MA 1H8NA 1JHTA 3DSFL 3ZR6A 5I1JL 1U8HB 2E9JA 3NFPA 2EDXA 5JIKA 3E8UL 4JKKA 4LOVA 3CX5I 1XH1A 4RX4A 4K2UL 3QIUB 4M7LT 4NKQB 3SQBB 3OR7A 2EICA 3OZLA 5DWPA 2JQAA 2Z92B 3HUJE 3DROA 1H0TB 2D8KA 1P1ZA 2P9RA 1JK8A 4X6CE 4FQQB 4PRHD 3V0WH 3CDCA 4G43B 1KBGL 2R0WH 1MH5B 2VLRD 2YD0A 2SODB 4XN5A 3I9PA 2MIZA 3GLDA 3WOVA 4Y4KC 3C5SB 5F7EH 2R56L 4KY2A 4UU9A 4N5EC 2QJDA 5IY5B 1I3UA 1AGCB 1SN0A 2H6UA 4LCYA 4PGZA 4RSVA 1F11B 5C0RH 3CC2P 1RP8A 4NAQA 4V11A 3BN9C 5HYSB 4JRYB 3MA7B 1MCHA 1RZ7L 2EYRA 1J1OL 1NDGB 2NT0A 3HC0A 4OU3A 1FZEA 5KBMA 4DEUA 1A3LH 1XFPA 2A1WH 4TLSA 3WKNA 2IWEA 2QGEA 1M6UA 1S7VB 5ID1A 4H0GA 1E2ZA 4H0LD 1RCYA 3KHQA 4KDVA 2ALWA 4IIQB 3D0VB 2X4OA 3QE5A 4IS6A 4MKTA 5KYXA 2AJYH 3KM1A 3R06B 4ZUWA 2AQ1A 4IK6A 2GFBB 4PLKD 1SXAA 3V4VA 3PJSK 1NYHA 1BIIA 3K5BA 4YH6A 5I26A 3TBYB 1UH2A 1PZ5B 3CHOA 1KJ2B 2OJEB 2RFXA 1D2OA 1A4CA 4POUB 1C16A 5C3TA 5T1LA 3DYMA 4HJJH 4N2NA 5HHNA 2KZBA 3G04B 2ZCLL 1YY9C 3DPDA 3N7NA 4A7SA 4HD5A 3QYMA 3IK2A 4UF7C 4WK4B 5TJHA 2GSMB 2Y06L 4ZX6A 3ELQA 4G8FB 4O2CA 3L4FA 1BCCD 4QXGL 2M2DA 2ZYHA 3BZEA 3IDJA 3GHEH 1G5GA 3QR1A 1CFBA 3QUZA 3W81A 3N1PC 4N2MA 5A40E 1OL0A 1S7XB 3VRJA 3MROA 4M8RA 4NENB 1N0LA 3H42H 4NKIH 3JV4A 4MB5A 4QXWA 4DO5A 1UXWA 2W92A 2BVOB 3CSPA 3MODH 4JM4L 5DO2D 5DTFB 4LEEA 3U0TB 5JA8B 1GPOL 3FB6A 2XV6B 3RPKA 4NHCL 1PCSA 3O9WB 1P84H 1WZMA 4L2LA 1U3JA 5IROC 1U30A 2GI7A 1INQA 3DXAA 1NSNL 3KBHE 1NFAA 3FSOA 4JPIB 5BV7H 1KQSO 2UWEF 2VIRA 5D2LB 4QIRA 5EZIH 3CFQA 4IDJL 2XZRA 4J3OC 4O2EB 2F5BL 3H9YA 3OM3B 1TKWB 2E6QA 4ZO6A 3SDXE 1OB1A 4R83A 1G2CA 3CH1B 1MCOL 3CBJB 2ED9A 1D6VL 1IGMH 1FBIL 4P05A 5F7DA 5AW9B 3LXAA 3S34H 1AGFA 1ZA6A 4LMQE 3QORC 1U6AH 1DVFC 4Y4FC 2V9RA 1KDJA 5AW2B 5EZLA 1PGRB 3P0YL 4ZFOB 4NC0B 2MRYA 3S4SA 5KW9L 1I7TA 2WWMC 1HHIA 2KERA 1SBSH 1XMWA 1F2XK 5D6CA 1HEZB 1G84A 2XWBA 1SXCA 3SYOA 4ETQA 4PGCB 1BJ1J 5IMMA 2ZXWB 3Q43A 2KMWA 4P57A 5E2VH 1YUHA 3I2CH 4AL8H 4JQVC 1YPZE 4X6DA 2J4WH 2UV3A 3NABH 1JZGA 2LE9A 2Y4SA 3EZJB 3B7TA 3V4VL 1TPXC 1AE6H 2C34A 1K73Q 2BSCA 4PD4I 2YWYA 4AKQA 2ZXBA 2DQJL 5AZ2L 5H94B 3E7KA 1C8QA 2N1TB 2P8MA 4DO4A 1RJLA 4W9IC 1MFDH 1BX2B 3IJEB 5J12B 4P49A 1UB6A 2NQDA 4G2AA 5DA0B 1MIEH 2L7QA 1V27A 3WGUB 1YQ3C 1Q1PA 5EIVA 2WPVB 1UWXK 3ATAA 1RKRA 3WTUA 3INUH 4TVPE 1NBVH 4YDKH 3MLVL 4UUJA 1I31A 4F1SA 4F15B 4ZFZA 2IFFH 2ID5A 1H3GA 4LKCA 5KLIB 5BUGA 2DLTA 5ICYA 1ROWA 2TRHA 4NQDB 3UERA 3HB3B 5JNYA 4Z76A 1AFVL 2A6DB 2WAQA 1PMYA 2XN1A 3PU7A 5FO7A 1NCGA 3FT4B 4CC4A 5IOKA 3HN3A 1ZA3B 4GDOA 1DD3A 5SWZA 1U7MA 3OJDA 4YN3A 2I9TB 2ALAA 3H1HD 1R47A 2OW7A 3HS0A 4FABL 1S3KH 5IMLB 5E6RB 3JV0A 4PJ7A 2LOEA 1SF3A 2AAAA 2WCGA 3CQFA 5MP6L 2NXZC 1Y07A 3UYRL 3I9GL 1N9PA 4JFHD 1JRHH 3A0HH 5J6HA 2IANA 1L9OA 3ZKMC 4WFEE 4X4MA 3SB3A 1CFTA 1G0XA 5CCGC 3L3IA 4G7VL 3VQ2C 3UPRB 4GI6A 1UD2A 5GIRA 1J0JA 3MGAA 5DJ2B 1ACCA 4BCZA 2PYED 1KPRB 2BVPA 1P6FA 3IMRA 2Y7QA 1KT2A 2B0SL 4NWTH 3CFBA 3LZFL 1RZ8A 4HG4J 4AYBA 1MJJB 2WSEH 1CZ8L 3ROLB 5DUBA 2WSEJ 3AGVA 4IL6E 2YUZA 1RJYA 4H88L 4KO6A 1MPAL 2JKVA 1T21B 3O8XD 5D2NA 5FW7A 1AQKL 3LCYA 2KI6A 1JJUA 5E4OA 2K9YA 4HLZH 5F6IC 1HCZA 4X6FA 2HPCA 1JGLL 5T3ZL 4RFOH 4S1SL 3BQUB 5F9OH 2VLME 2CPUA 4NFDA 3WUVA 1YMHA 1XGPB 2YRZA 4PJ5B 3WJJC 3EKCA 1XGRB 4PQXA 2HLFD 3KXFB 4OFKA 1A7QH 2DIJA 3QHZL 5HVHB 3ILDA 3KPRB 4N26A 5LAXB 4JO5A 3PGCB 2EDFA 5DLMH 5HDOA 4LPXA 4CKQA 1ZLVH 2EEDA 2IPKA 1CYWA 1YN7B 4ZAKA 3EBAA 4Q9RH 1A65A 5KJRH 5C0FB 3KM2A 1DVFB 1KZQA 2HFEB 5E5UB 2QPUA 3ETBJ 3ECQA 3WIAA 2VN4A 1AC6A 5JHDA 3HE4A 2CDEA 1NC2A 1CTNA 1UKSA 4PJDB 5DZNA 5L6YH 3HUJA 4IRZH 1ET5A 3FQWB 3HC4L 3LKOA 5CSBA 4AIZB 4XAKE 2B4CC 7FABL 2AABL 1UVQA 5HGGS 5A2IH 2AJSH 3APCA 1UXSB 1F6AA 2YA0A 3FO0L 1SQQJ 3KEDA 3QORA 2NXYC 3CLFH 3MZTA 1VF5B 2YQ3A 3K8MA 3N4XA 1FO0H 1K3ZA 2PRRA 1H88A 4Z7VB 5CP3H 3PWJB 3FZUD 4APXA 2DBLL 3TPUA 2KS1A 3QJVB 1HKLL 3BGAA 4L18A 1AQMA 5KVDE 1OGTA 2R1WA 2X4QA 2ZWZA 1MCSA 4MKMA 4AM0Q 1S3KL 4OCRL 5LGKA 2NPLX 5AD0B 4W9DC 2NT1A 2NPSD 2JIXA 4UV7H 3WIHH 2BVYA 4HUUA 3IR9A 3L70D 2F54A 4NEHB 5DSCB 2QV2A 5KLIC 4CL7A 4PG9B 3CXHE 1NANH 4TLFA 7FABH 2VLKD 4Y1SA 4X8JA 3ME0A 1QBML 3AG3B 2DZEA 5AZEH 3H4FA 4FNRA 5IVOA 3UDWC 1A1MA 1FNEA 5DRZB 2GJ6B 4Y5YA 4BSWB 4A6YA 5C2UB 5IHWA 1NHLA 3ATEA 2PXYB 1IFNA 1ID5I 1KN2L 1MH5A 4O2FB 4F8TA 1OZUA 1KB9D 1OSYA 2D3LA 1F4WH 4FDWA 4OZFG 3VGFA 3TO2B 2O5NA 2VDMH 1NBYB 2IBZX 4JR9H 4XO4A 3FQXB 3QIBC 3N04A 2KSEA 1I1AC 4LCUA 3CC5A 4NCDA 4XMUA 5FGRA 3K71B 5M94B 2NY2C 3GBNL 4OLYL 4XMXA 4AYFA 1RIUL 2P24A 2A9CA 1DQLL 1PDKA 2Q5UA 4IKJA 2F0CA 4LPVA 4U7KA 4TMPA 4G83A 1T8ZA 4FQ2H 4BWTA 4Y4KB 3L74G 3KJ4B 4MXVF 2WOBA 1TJMA 4UNTA 5E8OA 5DK2A 4G9FB 4DP4X 5CN2A 5IMMB 2I1KA 1R3LB 2VKWA 3C5JB 1JWUB 2OMYA 5CJ8A 4EIJA 1SXSA 2NY2D 1U3HD 3WKYA 1KCVH 3ESNA 4WFED 4HK3N 3T4YB 4KVNH 1FP5A 3FQTA 1U93B 3NRQA 4UTAH 4CDGC 2DWEB 2OTUA 1MWAA 3VU1A 3ZHDA 3ZMEA 1BX2A 3IJEA 4Y4HA 1T2QH 5LCVH 5FW8A 4WWKC 3PPSA 5CCKH 5I18L 1CWVA 2GSGB 2NNRA 4FMVA 2OTWB 5CCHC 4LVNC 2FJGA 2XTJC 1QLFA 4PJXA 4U1NA 3ARVA 2Z4TA 4HK3J 4PWJA 3SO3C 3LEVH 1V54B 1MEXH 1N10A 4PRID 4GUPB 3V5BA 1AKJA 4P5MA 2PPDA 3CN0A 4G8FA 2JKRM 4O2CB 3QJHA 4Q58C 4XX1E 4AC4A 4DK3A 5HHOB 1KCWA 3QC5X 4K23L 3QZNA 5HHMD 4F2ME 3BZEB 2KOGA 1AR1C 2EDYA 4OZ4A 3CFEA 3X2QB 3BUTA 1NTKD 4AYDC 2H32B 4L29B 1UOKA 4TUJB 3VRJB 1A7PH 3AQZA 4M7KL 2DQGH 3ILEA 4AH2A 3MRRA 1H15B 4BQCA 1LWUC 1KYOJ 1NBCA 3DBXB 2XWTA 3MN8A 5GGRA 1CYXA 1LP9F 4E36A 5J56B 5C0DA 2IX7C 3H9SD 1J9QA 1W72A 1AHMA 2R9HC 3QHFL 1VACA 1ASOA 2VLKA 5KJRL 4JPIA 4DP7X 1QYGL 2AGJH 3F05A 4YHOL 4YDKL 5D96B 5GJSH 1JD7A 5BVPH 5KSUA 4HWZB 2YD1A 3ZE2F 3VXRD 3VSUA 3M9QA 4X7SL 4XOEA 3SODB 5DWUL 2YBGA 5GRUH 3B3IA 4PJCB 1CB4A 1WTGT 4FQHB 2WSSH 4HS3B 2M8XA 3P11H 1AY1H 5GHWL 3TEXA 3KYMA 1LO3H 3QPQC 5FYJH 1U8NB 2APVA 3V6OC 1TCMA 1XB6A 3SE3A 3DX7B 1PSKH 5IQLA 2HVJB 3V9CA 4LHUG 4Y4FB 3OSKA 1NBZA 3WDIA 3Q5PA 1WDAA 5E1AA 3GBEA 4CN4A 5IR1A 3GSWA 2IDQA 3ZL2A 5HHQB 1A1OB 4PYGA 2NY0C 5E79H 4LHQB 4IBLT 4N0UB 4ALAL 2VSKB 5KW9H 1CF8L 4Q6IB 1QMUA 1XBDA 3L95A 4N4YB 3F58H 3NACL 1NAMH 2X6CA 1XGYL 5HI5D 3T3PB 3TVMB 5BRZE 1QQDB 3M17A 4YDIL 2EUVA 1DVTA 2Y7SA 4UINH 3C60D 3M06A 2GW5A 2IPKB 2W38A 5DK3A 4ZAKB 3PTZA 1OE3A 2W88A 4MNQE 2E7BA 1CFQA 3VE0B 1UASA 1PSKL 2AF2A 1JTTA 4IDJH 1PNDA 3SOBL 1VDGA 1JO5A 2JJUA 2PO6D 2MQ0A 3DWTA 2J12B 2P2UA 4F15C 3MRIB 3ZL1A 1NDMB 2G2NA 2VGLM 2IDUA 2HRPH 3ZHFA 1GPOH 1T5XA 2W0LA 4PJXE 1ANUA 2UVEA 2RD0A 1E28A 2QE7H 4TSBL 1UT1A 2Z91A 1P7KA 3AG1B 3LJ3A 3WU1A 1S3JA 3WFCL</