2RH0A

Crystal structure of nudc domain-containing protein 2 (13542905) from mus musculus at 1.95 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
133
structure length
133
Chain Sequence
FEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALAVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NudC domain-containing protein 2
publication title Crystal structure of NudC domain-containing protein 2 (13542905) from Mus musculus at 1.95 A resolution
rcsb
source organism Mus musculus
molecule tags Nuclear protein
total genus 18
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2rh0A02
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2rh0A01
5DS2A 3IGFA 4YDZA 2XCMC 4YLBA 4ZJ9A 3L1EA 3QORB 4I88A 3O6QB 4YE0A 4PBDA 4ELDA 2O01N 3GUFA 3L1FA 1WFIA 1X5MA 2Y1ZA 3J07A 4M5TA 4MJHA 1OZHA 3GLAA 3GT6A 4M5SA 4YL9A 2MNWA 2WJ5A 4JUTA 2O30A 3QORC 3N3EA 2Y22A 3QORD 2KMWA 3EUDA 4JUSA 4YLCA 2KLRA 2WJ7A 3AACA 2K8QA 2RH0A 4RZKA 3L1GA 3QORA 1EJFA 2CG9X 1SHSA 3W1ZA 1WH0A 4PCKA 3VQMA 5DS1A 3VQLA 1GMEA 2JKIS 3Q9QA 2AXCA 5LUMA 2N3JA 1RL1A 3AABA 3Q9PA 2CR0A 1WGVA 2N0KA 2BOLA 4FEIA 2Y1YA
chains in the Genus database with same CATH superfamily
4URTB 3NA9L 3QI9B 3ULUF 1NKGA 1G7MA 2OYHA 1QRND 4GAYB 3E6FA 3D48R 1WF5A 4JM0A 5K39B 4FTVB 4Q7DA 1EUTA 5JDSB 7PCYA 4UINH 1RE3C 5TJWK 4EO5A 3U4EB 4C58B 2H3XC 4AZ8B 3WNMA 3U0PA 4A6YB 4MNQA 4XNMB 3VXSE 2AMGA 3MRNA 3KCWA 4GEIA 1F4AA 2UUDH 4L8DB 3OAZK 4G43B 4MAYA 3K46A 5FKPB 4RMQA 3P0VL 3I9GL 4JYBA 3RX7A 1KC5L 4WJG3 5EOTB 4G2AA 3MV8A 4FOMA 5F70A 2CGRL 2XX0A 4BFEA 4CC1A 4J6IA 4TSAL 3L9BA 2ZUVA 3G6EP 3PE9A 4ZS7H 4M7LH 5CWSA 2JB5H 4F8PA 1GGTA 2ZSWB 2RACA 1XO8A 1E6JL 2HA1A 1JDDA 3EYVA 4ODWB 5F7UA 1QR1B 4O2EB 5EO9A 3OG6B 5L2KB 4KK9D 4MJIE 5FYJD 1EVTC 1HOEA 2CHDA 5FYLE 1BVLA 4DZBA 3H32B 3WKNA 2V7QJ 1NUDA 1B3JA 1SXAA 5LJYH 1QBML 3CHQA 5I5IA 1SQPD 2ATKB 3KH3A 2K3RA 4L1HA 1AXSB 1S5IH 2XXCB 2X3BA 5DHVH 3SGKC 4BXLA 3I55P 1S9YB 5INCB 4EIZC 4MB4A 2YPVA 1R34A 2VSCA 3QAZC 1KN4L 4KKZA 3OKEA 5A2BA 2RKLA 4AYDC 2K4WA 2A7BA 1RQUA 1UCBH 4FI7A 1DJGA 5JHDD 4M5ZH 4ZW5A 4IFFA 4FDWA 4RFOL 4L4TB 3TO4A 4BD4A 3BZ4A 4KZEH 3CC4P 4HG4J 2FEDD 1JF6A 4MNHB 4PN6A 4X9IA 1A1OA 2YRZA 1AG6A 1LWUC 4XNYH 5HHOD 4L5FH 1E4HA 4NSKA 4PUBH 4Y2DB 5IT2H 2Z31B 1J5HA 4OCRL 4HUCA 3RL2B 1I8MB 3P32A 1NU1D 2HRPL 5FUOH 2XZQL 2P5WB 2APXA 2AP2A 1TSHA 1PZDA 3TYGH 5I18H 4KFZC 3LS4H 4YSCA 4JZNA 5APVA 2CO7B 3C5ZC 2WUCH 3DX9A 2EXSA 4HS3A 1IAII 5C39A 3QJVB 4XNUL 5A16A 2OYPA 2F53E 3ULUL 5CJOH 5IFAH 4HJJL 4PRPA 3EGDA 3N44B 4HIEA 2OTJP 1JNNH 1RUAH 1BCCE 2QRXA 5F88B 3WJJA 3AEBC 2LFEA 1RZJC 1QOKA 5HPMA 1CTNA 3NCBB 1IEAA 4ZTPH 1HYRC 3D33A 1JGEB 3QXUA 4P3WA 3H9SE 3FL7A 4RSYA 1OE1A 4NBXB 5DHEA 2G75A 4OH8B 1VZIA 2N56A 4WY4B 3B8SA 3I6KB 2ICCA 3SE9H 2XWCA 4XPBH 4AQEB 1K05A 2NXYC 4WCYL 2XWTA 1G7QB 4R7XA 2CO4A 2R69H 2BDNH 5KBPA 2IFFH 1A3LL 3V55A 2PR4H 3FBQA 5C7XH 1FSKB 3MC0A 4AK1A 1FP5A 3LNGA 3MHZA 4OT1H 4X6DB 4JFFA 5AOJA 3WD5H 2F08A 1MQ8A 1NIFA 4HD5A 1K5WA 2MJZA 1J9RA 4YX2H 1NGQH 1ZHKB 5HJ3A 1ZXQA 2RBLA 5HGBB 4BA8A 4QRRE 1KIRA 4H0GA 4YHIB 2WQWA 3CFBA 3QHZL 4XMUA 3P73A 5LB1A 4GKOA 5IHUL 1K4CB 5JPNA 1YJNP 1FZGA 3FMGH 5LGJB 1WEJL 1NGYA 2DDQH 1NTDA 2VW7A 3C9NB 4KH2A 1G9HA 2J8HA 1WVZA 3MLWL 5KYYB 1KLGA 3BAEL 1F2XK 3MV7D 1FC2D 3SWKA 1X9VA 2JO1A 2E6QA 3ATFA 4U1NB 3T8XA 5E99L 3AT9A 2AJ3A 1P4IH 5G5DB 1CIDA 2A06D 4M93C 3DYMA 3FUHA 5ITFA 5B38G 3JC22 3O9WA 2ZUWA 5J0BA 5GGTL 1I8IB 3SYOA 1BBDH 5IQOA 4ZW6A 5FWQA 4M5TA 4AGOA 3MJGX 4OQ1A 2UYLA 3VWKB 5I1IL 1MF2L 4X5WA 3CK0L 2IOOA 5HI3D 2ORBH 4ZMNA 4FNLL 3AS3A 1CD1B 1TPXC 1EUUA 4J28A 3KWWB 2PN5A 3THML 2ZWSA 4HBCL 2CM5A 2KC0A 3QDAA 3SOBL 1D2OA 3OLGA 4CNIB 3SBPA 4WGWB 4IHOB 4X8JB 1UM5L 2H6PA 3JT2A 3LKPA 1TR7A 3PHOB 1CCZA 4G80A 3PL6D 4XPHL 1URQA 4PGDA 1W16A 1HIML 1EXGA 4FEIA 1CXIA 5BV7L 3VTMA 1A7PH 4AL8H 3ZDYB 5EG6C 2IZ1A 1BIIB 5EZPA 4B5ZA 3CG8A 3PWPE 4HZ1A 1Q0EA 1XCQB 4NZTL 1GYVA 2FUTA 3DXAB 4FKKA 3V4PH 1NCNA 3CDZB 3UBXB 1MKFA 1NDGA 4KDTA 3LHPL 4RISL 3RG1C 1MCKA 4BHUA 4O4YL 2DBLL 3FQXB 1AJ7H 3FT3B 4NWTH 1SY6L 3QPQC 4R4BA 5A2LH 4IQHA 1NOHA 2F74A 4KOCA 5HSFA 2QZ5A 3ZLQC 5T1MA 1ZT7A 4NC1E 4KI5D 5DF0A 5E8EB 5GIRB 3PUCA 3S4SA 1MY5A 3GI8L 2GM4A 2LXBA 2FL5B 2GY5A 4E41E 2QA4P 1QSEA 1T04A 2X44D 1RP9A 1DVTA 5BOPA 3QZLA 5KAQF 1FO0B 5L8KB 3RWCA 1INQA 3GHGB 3O4OB 4NO0A 2M1KA 4WW2B 3VNYA 2MOVA 2D0HA 4K3GA 2IOMA 3IFNH 4AENB 4NZUL 4X4XB 1BG9A 2P7TA 2VW4A 3TTYA 5I1DA 5IJVB 1E3ZA 2ENSA 3IR9A 4X5XB 2MRYA 2XA8H 3L17A 3OAYH 5ACMA 2FHCA 2NW2A 3KDPB 3H6PA 1FYHB 4HFWB 4I87A 4L3EA 1NHLA 3A6CL 2H9GB 3OLIA 5BQ7A 1UTDA 2BIOA 2JK5A 5IVNA 5ESVA 3UTTE 4JL2A 4EQ2A 1A3RH 4KU1A 2KL6A 1ETA1 3QRGL 3L3DB 5JHLH 1RIHL 2IDUA 1SFCC 3VH8G 1FNHA 4GMTL 1JUFB 2V8MA 2PWDA 2QLYA 5F7KC 1OT2A 2LU3A 3ROOB 4UIMA 2DYSB 1XR9A 3V6OC 3WEXB 3RK2D 3GK8L 2YMXL 1AIFA 5EN3A 3QFJA 2L3BA 4K94H 5KS9F 1LP1B 2ZYGA 4NM4H 1PZ5B 2AC0A 4YXWH 5AVRB 4F7CB 3PJLA 5I1CL 1OAUL 4JRYD 2B1HL 5FA3B 4X6CF 3K4DA 3QIWA 1EJOL 4WKZA 1C16A 4AM0Q 2QSVA 3M91A 2AMUA 3ETBF 3GSVA 4NZJA 1TTRA 1WG3A 1S7QA 5BS0D 2WLZA 3CVHA 3GXTA 3HN5A 4FQJL 1EFXA 3OKOB 3LIZA 4WWKC 2ENPA 5CCKL 5D4HA 1LO5A 4GB9A 3VXRE 2AXTH 4HUWA 1PAMA 3MN8A 4WI5A 1SBSL 1U3HA 3BPNC 2DY2A 3KYMB 4PJBB 3IB4A 4BWWA 2R27A 2Z4TA 2VDQH 1KBGL 2VXUH 4PGCA 2IBZY 1JL8A 3HC2A 4MDRA 4DQOL 4FMVA 1G87A 1P2CA 1GZPB 1WWBX 3B7TA 1PTZA 1QSFA 4IIQA 4L4VA 1RZ7L 2QVTA 3ZE1B 4M6MH 4ABQA 4YSSA 5B1AB 2CGZA 2C3XA 3WTWA 4U1KB 5AAMC 3HNTL 4QNPF 3CLEH 1U58B 3AS1A 3KWVA 4YPJA 4PQXA 5T1LB 1LEGA 1DJYA 4BFNA 2X4UA 5KSUB 1CTMA 4YXDC 1OT4A 3PV7A 4Y5XC 1HAWA 1LLAA 4GKNB 3T0BA 1LMIA 1R5IA 1BJ8A 1CR9L 4LDEB 4GAAA 2AKRA 5FIEA 3W5NA 2JEEA 1BFVL 3AE5C 3K3QA 15C8H 1RJYA 1WBYB 4Z7VA 4NT6B 3S37X 4L8CA 1IAOA 2X70B 5I1JH 4APQC 5EFWB 3SDCA 3QCVH 4G8EA 3VYNA 2B14A 3HG4A 2ADFH 4OLUH 4NNYB 4GLRH 5GRVL 5LXVA 2R2EB 1DBJL 1RZGB 2BC4A 1FYTD 1Z66A 2Y22A 3X2QB 4BFFA 4JHUA 1P6WA 3U4AA 1P9MC 4Z3HA 2EXWD 3O45A 3WKML 2M5AA 3ULAB 5GGSB 2VRSA 1FL5B 3AREA 2OKMA 3QUHA 3U36A 3PAUA 2YAPA 4WK4B 4BQ8A 1YY8A 3P40A 1MFEH 4D9QD 4WB4A 4YHZL 1A3ZA 3LH8A 2OYOA 2IWKA 1JEKA 5D7SH 3GB7A 2LW3A 4ZO6A 2BSTB 1FZMA 2NPSD 4FFVC 4GQ9L 3R0MA 4NQVA 4Q0XH 2QKIA 3VI3E 1NCDH 4FQIL 2OSXA 3LXUX 3FRPB 2YGOA 4YL9A 4AGLA 1ID2A 2Z5HA 2G5RA 3I9AA 2XFGB 3QC6X 4H13D 3TJHD 5DD3H 1GVIA 3WNLA 3KPQB 3T0EE 1HX0A 1OLLA 5T3XD 3G5ZB 2E42A 3GI9L 1KJ2A 5E8PB 2AK1L 2CUIA 3FRUB 4D0CA 3H1LD 3WEMA 2OMWB 4NQSA 4OD3L 2VC2H 5TQ0L 4M1GL 5AB2A 2B7DT 4D0DA 1UKTA 5DFTA 4E5XB 4KK5C 4DEPB 3D2UD 2H8PD 3FB6B 5CCGE 1HYSD 5E0QA 4IBQA 3QXDB 5J3HC 3RIFF 1A7QL 2NY0C 3MNMA 4IM8A 2GK0A 1URLA 4RFEB 3KLLA 4L5FE 1JF1A 2YA0A 2B9AA 2AJYL 3H1HJ 3AB0B 4IU3B 4PB9L 3C2SA 2XUWA 4MASA 5KZCB 1SJXA 4XC3L 2G3NA 3JZYA 4B9FA 5DO2C 4YDKH 3HI1B 4NGHH 5DRZB 4CJ0A 1IM9A 1OOWA 1WE5A 5GJTL 4B95C 1X5KA 5DJDA 3S8WA 1O9WA 4NOFA 1AD0A 5DRXA 1VCBC 2FYVA 3DOSA 4F33A 4NUJA 3C60B 1RLBA 1KCVH 4MMYA 2W38A 1HZKA 1Z9LA 2ZAGA 2JB6B 3N41F 3BWUF 4JHZA 3CDGB 4UBDD 2X40A 4QGTA 3EDKA 1ES0B 3DDGA 1R5WA 4IRJC 4XPTH 4ORZC 2HJLA 3M1OA 4QRPD 4YHYB 5KSBB 3ZE1E 1NMAH 4PJDB 5GRXG 3VFOA 3X12A 3EOBA 3T6XA 3VXTA 1LWUA 2B88A 4HWZB 3B2PA 5KLIC 1AV1A 2WXLA 3UC2A 3UZQB 1OHZA 3O81A 3PFUA 3AEGC 4LLMA 2XWDA 4QHLA 3VJ6B 4NZ8A 3DO3A 1N8RQ 5KYUB 2LR2A 2V5YA 3EYFB 3RGVD 1XGUA 4LHUG 2EDJA 4Z78A 3MYJB 3MX0A 4WI9A 3TTSA 1MFCH 1PZAA 5DLML 3NZ8B 4KWUA 2R9HC 2OGUA 3QEHB 5ESQA 4ANVA 2R39A 1ZT4A 3PJNA 4F2MB 1XIWB 2XJLA 4HH2A 1CD8A 1MI5D 1OGTA 3P2BA 4HALA 4O5LL 1ADQA 1NAMA 2O6DA 3RVUD 5MENE 4PM1A 4ERSH 3HE5B 1KPVB 2JJUA 5F6HI 2F7QA 2GBAA 3H42H 3QJFA 1RK0B 1ZVSB 1P84I 5B1KA 1AGFB 3WN5A 3PWVB 4ZG1A 1DQVA 4ZFOB 4LSDA 5EUOA 4JFDA 4R0LC 1MPAH 4IFMA 2QM7A 1DLFL 2LVEA 1U0QA 4G6KH 2WP3T 5T8IA 3ZE2F 4KK9C 1XGRB 1RF0A 1KQSO 1UOKA 3WKQA 4E9QA 1BCIA 1NICA 4N1EA 1RFDL 1CXHA 4XA4A 4L29B 2A6KB 1LK3H 1Q2NA 2KYIA 1DBML 2Q7YB 4PY7B 1ZLUH 1R17A 2WXOA 5C0ND 1AKJA 3L48A 2DI8A 2VLRA 3FCBA 2NY6B 2Y36H 1DN0A 5C0BD 1KILD 1CI6B 1ZLEA 3QVAA 2A73A 3EYSL 5CCHE 3LN4A 3FUMA 4WU5A 3IJHA 4LP8A 2LQRA 1HL8A 2DLHA 1TQBC 3KJ4B 4OVNF 2BMKB 3OKDA 3CCSP 3X11B 3C5SB 1SJEB 1SN0A 4MSWA 4D94A 5K1JA 1T7XA 4FQXB 4NERA 1X22A 4JGMA 4ANUA 3WFBH 1BJMA 3CIAA 4LSRL 1E5AA 1HL5A 3CSFA 3BKYL 4I77H 2ZOWA 1FNFA 4U0RC 2FH6A 5T1KB 3HS0B 3TEXA 4HEPA 1K8IA 1MWAB 1FPTL 1LEIA 1IFGA 4NKOA 2AEWA 2ERJB 3EOYG 3UDWA 25C8L 3TEUA 1PX4A 2ICEB 2YPLD 4DHLA 4FAAB 3ARTA 1LWJA 4HHGA 3SD2A 4ODBD 5C86A 3ZTEA 3VFPB 1BSNA 3GF3A 5H37A 3I75B 3QEGH 4QT5A 3ETTA 4XNZB 2OTWB 1NGXA 3G08B 3BPOB 1Q81Q 3Q1SH 5TF1H 4DK5A 2DB8A 3QYMA 1W0YT 4JO3H 2OJEA 1A22B 2FX9L 2EDYA 2WQSA 2WTYA 3K1KC 3DYOA 2WTRA 3V9FA 3UADA 5GGRB 3H9HB 1H3WM 4JG1L 4LEOB 1XFPA 3EO9H 2I7SA 1I4FA 1IAIM 1QFWH 2LU4A 1OTUD 4N6JA 4LP4A 1PKQE 1T0NB 4GAJH 3X1BA 1BEXA 1LP9A 3L08A 4PRNA 2R7EA 3BUYA 2CRMA 3PGDA 1BWWA 4AQ8A 1R5VA 2EC9U 3M8OH 1BAWA 1KTCA 5C0JB 2MKLC 2TSBA 5FB8B 5LQBL 1CK0L 5C0CB 2EIDA 4ZFFB 4FHJA 1T1WA 3FOMB 2CBTA 4P2QA 5EORL 4Z7NE 2B20A 1NCWL 1QSZA 1JO5A 4IJ3B 2MNWA 4KJYA 4JUTA 1PZBA 3VO0A 1TKWA 3FU7A 3ROLA 1ONQA 1ZHLA 1FC2C 3E7KA 2BFVH 3LEVH 4U3FG 1IFHL 4Z7WA 5CD5C 1A1NA 3UPRB 3AE8C 1TTFA 4ZMXA 1Z9PA 5JQHC 3FO9A 4I85A 2MIZA 3Q9PA 5HHNB 4FA7B 1IEHA 4U1JB 4H8QA 4CW1B 5E6YA 4F92B 4POZC 3N43B 2VL5B 1EZVG 1YNKH 3EBAA 3VB8A 3WL9A 4HS8H 4ZFGH 2APFA 2W07A 3ITKA 2AXTE 1Z9SB 5F7DB 3M07A 5AAWC 3HIZA 4Y1AE 3DK0A 2QIWA 5ADOH 4K3HA 1T5WB 4WDIA 3L1GA 1HHIB 1SHSA 3NDYE 1ADWA 5CFHA 5KJ7C 4PSPA 5HDQL 3PL6C 4MYWB 1EXIA 4FF9A 1Q86Q 1ZLSH 2NY5L 4GSUA 3AGWA 5F9OL 1IGYA 4YN3A 4RMTA 3INOA 5C2UB 3ME0B 4N6QA 1U36A 4BWNA 2FCBA 4FG0A 1LD9A 5D1XA 1JZ6A 3D05A 1DFXA 1BBJB 4X2UA 4JZJB 4Y16C 5B1JA 3RL0D 1WITA 5DZJA 4DAGL 4B3VA 1LMKA 2ZAEB 3UBGA 3KBHE 1FGVL 2Y06L 2GY7B 5K9KA 1PY0A 2YGNA 5F96H 1QBBA 3VXMD 3QJHB 2WB7A 4NO5B 1ZA3A 4FRWA 2G3XA 1D5BA 4PRIE 1JY3O 4GI8A 1C8QA 3S5LG 3APFA 1DQDL 1PDKB 1H8OA 3IGUA 5D7IB 5ALBH 2WO3B 3OC5A 4KI5C 4QKXB 3JWDC 3CCHA 4E41B 3P3RA 4WTWA 3LV3A 2XNDH 1L9SA 2C3GA 5I0ZA 3V0DA 1ZIBA 1MW3A 3K2UL 1KQFB 4Z7VF 5E9DE 5D1QD 3RZWA 5IROD 1SHXA 3R06B 3NCCB 1DQML 1E5UI 2JCCE 4J7RA 4OVUA 2MH4A 2Z65C 3ZKXC 1HCYA 3NAAL 4FXKB 1C5DB 3GD1C 1DVQA 2CRYA 2XZZA 2VLKA 4YBLC 5F7EL 1LWHA 1DANT 4GOFA 1PQZB 2RH0A 1PD6A 1U91B 1ID5I 3HG1A 1MH5B 4JRXB 1MG2C 3LPGA 3SDAC 1T1ZB 4J3OD 2J8OA 3UTTB 3OR7A 3BXNB 5CP3H 2XWRA 4ADJA 1ZWIA 3KXFD 4L0PB 1D9KD 3OPZL 5CJBA 3BVWA 4U0QB 4YEFA 3BGFB 2P47B 2Z91B 5FCUH 3SB3A 3IFMA 2XZAH 4Y89A 5CEZH 3FCTA 4F7PA 4Z7QE 1M56B 3ILQD 2KH2B 3RIAK 4KBPA 2A38A 4GW4A 2XBZA 3KVDD 3CVHL 4RNRA 4YFLF 3TH4T 4D9LH 3CCEP 2HT2C 1U3YA 5IEHA 3DI2B 3LIZL 1HAUA 2ZKMX 4JFXB 3OKMB 2CCWA 3TN0C 4JFOB 4PJXE 5DGRA 2FQGA 5MEPB 2ODIA 4PJCF 2ODHA 4MXVE 3ZL2A 5G55A 4QDGA 1W0WB 1QEWA 1RMFL 3C6LA 2XQBH 4Y4HB 4CADB 5GS1B 3S3PA 2AVGA 1F5WA 2Q7NA 1A8ZA 3MRBA 4HEME 3MR9A 3QO1B 4PSRA 3UTSB 3Q06A 1M05B 4EDWH 3ULVE 2X12A 2G5BA 1REIA 1OZUA 2L7JA 4I5BB 1ZGLP 4LCWA 5C9KA 2A99A 5I5JA 3BD3A 2N9YB 3NIGB 4PS3A 2KSJA 2YKKA 2DRUA 1QW8A 5C0FA 4RX4D 1HTYA 5ICYA 2HWZL 4FP8H 1NBZB 3Q6FB 3MFFB 3GLDA 4JM4L 4CC0A 2E56A 2LE9A 2PPAA 1DQQA 1MIML 4M43H 3H1KE 2YZ1A 4N22A 5DUBA 4P23A 4EBQH 5SX5H 4NPFX 2VO8A 4UT9H 3NFPA 4AIZB 3ESVF 2X6BA 3HC0A 4G6FD 3QXWA 5CLTA 2WGXA 4NQUA 1KBVA 4ZSOE 5DK3A 4NYLA 2C3WA 2PWEA 1C5CH 2YN5A 4GI6A 1AQDB 1WIOA 2OAAA 1DD4A 4J3BA 4LF3B 5E6IB 4MB5A 3IDYB 3EYUL 2EE2A 1X5IA 1HJBA 3AM8C 4WO4D 3QZBA 4HLZG 3M0DC 4N0FA 4ZUUA 1WFMA 1T6AA 5I1KL 4MKTA 4G7VL 3B2MA 1BLNB 2KQMA 1OSZB 1BFOB 2DW5A 2K9JB 2BCKB 3EBHA 3E7JA 2MPAH 4BSVA 4OJAA 1NCAH 1HHGB 2XWJB 5DMGC 1BSIA 4KO9A 2E74B 3WO4B 5AYQA 3X13A 4H1LB 3BFOA 2LFGA 2EADA 3MOAH 1OP5K 2LU7A 3DHPA 2ARWA 5T3ZE 3SY0B 2GABA 4M8UA 1T0MA 3QEQA 2ITCB 1CZQA 1F45A 3Q01A 4UQ3A 2K9YA 4MQTB 5H8DA 1RIUL 1Q9KB 4NAMA 1DVXA 3WU2H 4R90L 5E95B 1KGIA 1W8OA 5AOLA 3IJSB 4GYBA 2A9MH 1XL6A 4QHKI 5IOPA 5T33H 1K8DA 4TUKH 1RSYA 4XB7A 3ZPDA 5I1LA 4CGUB 1M7DA 4DP6X 6PCYA 4X7SL 4ACPA 5F3HA 1A4KA 1KJ2L 1OSYA 4YPGB 3VXPA 2J6EA 5BU5A 2N4IA 1MRCL 5E4AA 3U1QA 2I5YH 3LXBA 5KTEH 3RUGA 3GMAA 4XPFH 3RE0A 1RLWA 1AANA 1GRWA 4WQOA 3K8LA 5JMOC 3BRTB 2Q3AA 2X4QA 5EUOF 5FECB 1I8KB 4DCQB 5J6SA 1JM0A 1KZQA 4ALAC 2X1WL 3VYPA 5FKAA 1LVEA 5I71B 2YD3A 4LKXB 4U1MA 3IK2A 4DWHA 2AF2A 1UH2A 1XR8A 4BGLA 2FBWC 1Z3GH 3E1RA 2FQFA 1N0XL 2CIIB 4UDUB 3EOTL 1JZ2A 4Q9BA 3FF8A 4UAOC 5DJCA 4OAWB 2OK0H 1GZQB 4OKDA 3HUSB 4H2AA 1WPCA 3UTOA 3TURA 2NY3C 4PJ5D 2OQJA 4PD4H 2EDTA 4XPAH 1GGBL 1OAXL 1HZHH 3V5KA 4GKSA 2J43A 1SLWA 1JOCA 2MHAB 1ZGLB 4UANA 2XKMA 1XZ0B 4S1RH 5EWIH 4M02A 2HODB 2G0LA 3IF1B 2IGFL 1EXJA 4MGXA 4X0KA 3X1GA 1VEPA 2FSEB 4M1CD 1R5SA 2PCFA 5C09B 1GAFH 4QF1B 3L5XL 5EF1A 3ARFB 3S3SA 4HVBA 3WAJA 2ZP0T 4GBXD 1E9OB 1MNUL 3NSDA 3F84A 2ZONA 4Y4KB 1N9PA 4XOEA 4KQ0A 1KZYA 1IL1A 5JHAA 3ECVA 1UXSA 2GTQA 5KOMC 3F89A 1AFVL 1RZJH 4OUUB 4KRPD 3D39D 4QLRA 5CSZB 3FPXA 4BYHA 4GAGL 3W82A 4A39A 3LQZA 4PRHD 5JHDA 3OWEA 2BNQB 4LKCB 1GDTA 2J8UE 1CFQA 1SP4A 5KYNA 3K6OA 4UCFA 5HHOA 4Q97A 4TULH 1ADQL 1NAML 1SQ2N 2X4OB 1JXJA 4PIBA 3S3JA 3FB7B 1HWTC 3MRJA 2FKWB 1UACH 1YLBB 2A6DB 1JK9A 2WM0A 3PIQA 3R0NA 4JKNA 4NOBA 2HFGH 5IG7B 3TZVD 5K59E 4LAJH 2LAGB 3ARDC 3DRTB 5J06A 1VFBB 4ZO7A 1MSPA 2F9BT 1OWWA 3MBWA 4HPOH 2J71A 5BPPA 4DP9X 4H8WL 1OPGL 5MENB 3IFOB 1LP9F 5BZXA 4YSPA 1FNSL 3F85A 1GY2A 4HULB 4W6XB 5H2BA 1I7ZA 3ZHKA 3WS3A 3FQUB 3VW3L 5HYQA 5EUKA 5GRYA 3O3DA 5GRJH 4JVPA 5H94A 3PDGA 1SGKA 1YQ3C 1T66C 1V54B 3BI9X 3AEAC 4XBGB 3SE4C 6CGTA 4JHVA 1ZP0C 1FFOA 3UMNA 3QWOA 1W5CE 3GMMA 3T1FA 1MWOA 4H26A 3BVHA 1QHOA 5I28A 2PYEE 2PPEA 2G2RB 4Z7WF 1S7UB 3SGJA 4ZXBC 1AIZA 5EOQL 4QRUA 1NAYA 1VA9A 3U0TB 1NTZG 1E9PA 3DVGA 2VMDA 5BV7B 1EIBA 3ARGD 4N0UE 2WXMA 2OPCA 1VZGA 1BW8A 1H0DA 4U1HA 1KV3A 1JZ8A 2KOGA 1BQ5A 5AYUH 3ZKSD 2QVFB 5L2JA 5TDPA 4OIIH 2GC4C 3VXQA 1YPZA 4XP6H 4DEWA 3RX8A 1TJIL 3F5WA 2HFFB 2P48B 3OB0H 1EX0A 4LE8A 4QMEA 5D7JD 4OD2A 4Y5VC 4F7EB 4GO8A 1PFIA 1LO3H 2ZP8A 3DV4B 5AQ0A 1SUJA 1RUQL 1YEIL 3LRHA 3ARBD 3B7YA 3PRZA 2GUSA 3G5VB 4B3EA 3LHAA 4I13B 4N78D 3TPUB 5DJ6A 1TMCB 2OFQA 4NLHA 4I2XB 2CE6A 5CFAA 2X7LA 5IGXH 1WRFA 4JMXA 1P7KA 5HYSG 4TSCL 4QXTB 2MCPH 1NKOA 2QBWA 3GPSA 2CO2A 4NI3A 2KDGA 5EC1B 3KWTA 4ZMYA 3GSNH 5HBBA 5AAWA 2OMTB 5FGBC 1ITCA 2NDGA 5HYIA 3US0A 1X7QB 2R29A 3F6JA 5CJQL 5F9AC 1Y1UA 2K8MA 1TEFA 4OZIA 1JWSB 1Z2KA 2V9RA 3PL6A 5D96C 2OXHB 4L8SB 4Y9EA 1QGKB 2BCCD 4YHLL 1AVYA 1OCZB 3P3UA 3REWA 3L3KB 5A43C 3BH9B 3RURA 4YK4C 2EYTA 2FNBA 3RNQA 3DVIA 4I1NB 5IFHH 1LO4L 4D6TG 4X5QA 3GC3A 3MJWA 4PD4J 3RK3C 1QBAA 2NTFA 2Q3ZA 5EDXA 3HE4A 3I6LD 2XZCL 2E5TA 3EFFK 3FYEB 5IQMA 5LNDA 4W93A 4Y19E 4NNPL 3MGAA 3SQOH 1S4XA 1JGUL 4LQFL 3L36A 2ZOLB 3OMAB 2OARA 3ECUA 5FLVA 3KPOB 3DOIA 2PWFA 3FC8A 5CEZE 4FS0A 2K1MA 4KTYA 3O4LE 3FTGA 1VF5C 2E76B 3DVNA 2IH8A 2PXYB 2UVFA 2WINA 3W0WB 2L04A 4NLAA 5FHAH 4OF6A 5T5FH 4MJ6B 3KGRA 1MCEA 4FQCH 4PLKC 4NFDA 4XRCB 3B9EA 4I9WE 3U6XA 2XG5B 3MLSL 2WWMD 4WEMB 1MIEH 1HKFA 3GO1H 4HUUA 2FD6L 3CQPA 4MA3B 4YSTA 4BFRA 2Z35A 4ZUSA 4ELMB 1GYAA 4UT7H 3FQTA 2CLVB 3TO2A 3VDAA 2BNRE 2JI1A 4W9KC 1A3QA 5D2LA 1SQXG 1F02I 5D7LE 3CSBA 4YGAB 5FDWB 4ZFQA 4JDEA 4MJJA 3HB3B 5L8JB 5LWYL 1KNOA 4HAKA 1X5MA 2Y1ZA 2KZWA 3WI9A 3QCTH 4Z95L 3NGBC 4HJSA 3K6SA 1E3XA 4JFZH 4JDTH 3P77A 4KITB 2HG5B 2WWOA 1AZNA 5JIQA 3KXDA 1D5RA 1YEEH 4ANXA 1X6NA 1F6LL 3F8UB 2XKSA 1AC6A 1OK8A 2IBGA 3HMWL 3F00A 4A1RA 2BM3A 3U9PL 4OTXH 4PPTA 2N1TD 3GUTA 1CBVH 3TFBA 4JRYA 1AHWB 2ADGB 2AEMA 4LRIC 4OH2A 1VQMP 4WFEE 4XCEB 2W6BA 4MA7L 4I48A 3TGUD 2HVKA 4I4WB 4YUEH 2AEPL 3ZXAC 2Z8VC 3TCXA 4YHML 2WNKA 4U6HB 3P9LA 4XMVA 5FGCB 5BS0A 4P0DA 4CILA 4LLDB 3QORC 3H9YA 3L37A 4AEEA 2J1WA 5KS9B 3TNMB 4PRIB 2CZNA 2YQ2A 3BKCH 3E0GA 2XLLA 4UV7H 1U8OA 3QZNA 2FJHA 3ZR5A 4IS6A 2XX1A 2E6PA 2JXMA 4NQCE 3SKMA 4JPKL 3W2DL 4X6CB 1R3KA 4EMZA 1OOAA 4NJ9L 4N9GA 3TT3L 2YD1A 3RNKA 2RA1A 4YSRA 2R23B 4P99A 2ICWB 1XTLA 2FGWH 5DA0B 5I15H 2NY7L 3I50H 3HZ3A 4XHJD 4CSZA 2D31A 4HS6B 3SE6A 2O5ZH 1ILUA 2F54E 1R75A 3CGTA 4C59B 5IROC 4HC1H 2YO2A 1EBPA 1SDAB 1DE4A 1N3NB 5GS0L 2R8SH 5CZRA 4ONGH 5JUEH 2WKGA 3S6CA 3WU2E 2X4SB 3EG9B 4HUXA 1KB9H 4XBEH 3SPGA 3II1A 3BX7C 4RGNE 5I26A 2VW6A 4R84A 1TSRA 4JO4L 5ICXB 3BWSA 3MQIA 1RKRA 1J9QA 2H0FA 2M8XA 3VP8A 2XYCA 5DD6A 5LDSA 1I9IH 3L4WA 3MLZL 5DWPA 2WMPA 3DTXB 1MCNA 1PMYA 1RF1B 1FZKB 4JM2D 1O6TA 1SQBJ 4UNTA 3MODH 2KIKA 2Y5TB 3B5HA 1KGCE 4I3SH 2VLLB 4WF7A 2DQFA 4GOSA 5CGYC 1FRGH 1UWXK 2F5BL 5AVQB 1ASQA 5EU6B 1M71A 5I6NA 3BP5B 3MRLA 3NTCH 4LCIL 2DKSA 2DIBA 3ILQC 1KV4A 1CB4A 4PVNA 4PGZA 1CZ8H 2R4SH 5G2NA 1RAMA 3RUGF 1OALA 1PEWA 4L2YA 4LCUA 4XVJL 3ABLB 3VRIB 4G8IA 1FYTA 1NGPL 3K91A 1EZUA 4JE4B 5MI0B 5HD8C 3GSRB 5L7XL 4M6OL 1J1DB 3JTSA 4XZUB 5EU3B 2WQVA 5ANHA 1MW0A 4PD4E 1HF9A 3L3OC 4P4KC 4H4NA 5AVSB 3GSUA 4I89A 4BRVA 3DSFL 2AHIA 1UQSB 1FDIA 3I3EA 4R5VA 4XMKH 3D6YA 2R4RH 1Q9WB 5D1ZD 3O3UN 4OM0L 2ZVOB 3H1KG 2ADIB 2Y5EA 4G42A 3FO2A 1NC4D 2NPSA 1JZHA 2P26A 2X1PA 4BWTA 1G7MB 2OYHB 4H7VA 4OLWL 4U2YA 4EXKA 4M7JL 2F8VA 4OJYA 1KYOD 4YBQD 5CP7A 4XVTH 4PV9B 4GQZA 1CFSB 4XCNA 2JIXB 3CFCH 4XN5A 3CBKB 2XDHA 3QUMH 1EEZA 5CJ8A 3FN3A 1TQCC 3VD5A 3MRNB 2A4EA 3RQ3A 1KSRA 3A67H 4I8DA 4MAYB 4DKEH 3NP3A 4AV4A 4JB9L 3FK3A 3HAEG 5CJXA 1OSPH 5DZPA 1KY6A 4OGQD 5ACZB 3MV8B 4ONHA 3BDYL 2H8PA 3WFHB 3HRZC 2F5AH 5CJ4A 5DFVD 3ARPA 5EEVA 1ZS8B 5CWSB 5BQDA 4Q9RL 5FYKL 3QUZD 5F0MB 2D73A 3PWLA 1GYCA 2ZYDA 2XBDA 1E4XI 3ABGA 2MCMA 2Y0CA 1BVLB 4IKIA 1MCQA 1UA7A 1WS8A 2E9GA 4N8VA 1AXIB 1E5YA 2FB4L 3CSGA 4Y4FD 4R5TA 4ZS6D 3BN9C 2GITA 4P06A 2FR4A 3RJDA 2IGTA 5IWLC 2CGYA 4F7KA 3EYOA 1JI1A 4GJTB 2LLLA 2J6EL 3O0LA 4R97B 4XCCH 5KVGL 3OKEB 3E8UH 2IPTL 3Q2NA 1T03H 4HIQA 4X6BA 4XX1E 2DWSA 3BSZH 4P3CL 5F97E 2XN9E 2KUBA 4W4OA 4Y8DC 4UOW1 4YVNA 2JF1A 3QE5A 3KVPA 4OCSL 2BVQA 5L2KD 2C1OB 2HX7A 4QRPA 1A1OB 1P7BA 1B2WL 3GHBL 3PYCA 2B3IA 4NSKB 3H3PL 1T5KA 4HFUL 2FX8L 5LNEA 4M4PA 5HGHB 1KWKA 2XQ0A 3RGVA 1SQVG 4JZNB 1BGYG 2QQKH 1TQSA 5D7KE 3DX9B 5FOJA 3N41B 4YS4A 2BVYA 3P0VH 1KC5H 2COQA 4PRPB 3AXLA 1NLBL 4TSAH 1N7LA 4NPKA 5H35A 1MI5A 5HPMB 3MRMA 3KPPB 12E8L 5FYJL 4K3DL 1E6JH 5T1DL 3CLQA 1MCOL 3KPNB 4Y2DD 3UPAA 1EEQA 1QX1A 2G75B 5CU9A 4AKQA 1AZVA 2J59M 2XTJC 2P5WD 5HYJE 1T80A 3P11H 1I8AA 4X4YA 1FL6B 3IKKA 1YPZF 2XWTB 2FEEL 3GLEA 2ZX6A 4JG0L 4AUUA 4LCCC 3CMAP 2AVFA 1TQWA 5LNGA 3QGVA 1SQBE 4Q2ZB 4HK3J 5DRWB 3PABB 4JFFB 3C1LA 1KN4H 2F68X 1J0HA 3PTZA 5HJ3B 3CX5D 3TWYA 3U2SB 4N8PA 4YLCA 2XN1A 1KIRB 4RMSA 2X9WA 3E38A 3DJRA 5C6TL 3ESNA 5E2VL 1NGYB 3E6HB 3MXWL 3UZVA 5ILTL 3N6YA 2NZ9D 2ZOKB 4UZUA 3BPCA 5C0BA 1H3XA 1U8MA 1AMYA 1KILA 5CAYB 3EXJA 3L3GB 3UG4A 2CHNA 1NIBA 1T1YA 2HRPH 3FFCD 5CEXA 3QJXA 2A9CA 2FK9A 1JZIA 5D71L 1S8DB 1NMBL 1T7WA 4HCIA 2AJ3B 3T8XB 5DJTB 1Q9OA 5ITFB 2JE8A 3QXVA 3B3BA 4ELKA 4G5AA 1NBYA 2JJWA 4OZIF 1QTYT 1S6NA 2YN3A 3AITA 2EDDA 4NPJA 3ZHNA 4XNUH 2KNCB 2K6YA 2YWZA 1J0JA 3BPLB 5I8KH 3ULUH 3WJLA 4C83A 1GU5A 4IRSB 4ZUWA 4BK5C 2Q86A 1X7SA 3VWJB 3CHPA 4X5WB 4DT2A 3IU4L 4URKA 2WOYA 3DX6A 3UYRL 5I19H 1CICD 2FHBA 3BKJL 2QT6A 2NR6C 2XACC 4DPCX 2B1AH 3EHBD 1SN5A 1X4ZA 3CXHK 3HZKB 3HVDA 4MD5B 4YPCA 2LT9A 1AI1H 4G80B 4NKMB 1URQB 3V6OE 1IK9A 3ILPA 1XGPA 5GGQL 2ITDA 5KWYC 3MO1A 5ID0A 3D4YA 1MCPL 4RGMC 2MPVA 1NUNB 4B5EA 1BF8A 5SV3A 3NEOA 1GOGA 3L4CA 5HHXH 4C7RA 4PLOB 2ZNXA 4EVNB 3VWKD 4KI5F 3V10A 4BFKA 2IQAA 4E36A 3V0JA 4PVLA 3QHZH 1XCXA 5IHUH 2KI7B 1L0QA 2BSSA 3RWEA 2EEFA 4YHOL 3I6GB 4N8CL 4R4BB 4YJZL 4LGSB 3VX0A 2XXFA 3MLPA 4PWKA 4BRYA 1K6QL 2QSCL 3MLWH 3N9GL 2IIJA 1OWAA 2F74B 3Q2YA 1DD3A 1HNGA 4PJHE 1QTPA 4PR5B 3LB6D 5DK2A 5T1MB 5D2LF 1ZT7B 1FFQA 3IMRA 5GSVB 4CDGC 1I8UA 4Y1TA 1O0VA 2WSEH 2EKSB 2R0LL 3QARA 5GGTH 3SWFA 1J10A 2H2PC 2YD8A 1UXWA 3N06B 3MV9E 2YPKA 3DXAD 1LDSA 1E43A 1WBXA 1HSBA 4P5KA 1M7IB 3PWJA 3LPWA 3W56A 5D7JC 2LKMA 1MF2H 1INQB 4RQQB 3RWCB 2FO8A 3AFLA 3STLA 4TLUA 4MA8H 3T4AA 2V4LA 1JRHH 1TVHB 4ZOBA 2R29L 1UXLA 3THMH 4OFKA 4FCHA 1KDIA 5I1DB 4HBCH 1R24A 1PG7H 4A38A 2HN7A 1U41A 2NW2B 2B5IC 3IFPA 4M6NL 2JK5B 1AR1C 1QAWA 3CZKA 5ESVB 4PU2A 1HIMH 1L9MA 2GT9A 4XI5D 5EIQA 4ILDA 5D93C 5EZIL 4MD4B 1NTKJ 3FWLA 1EJFA 1FZJA 2VDLL 4FQ2L 4U6YB 2V7HA 1FJ1A 1ET8A 4HOWA 3IAOA 1Q7YQ 1IBZA 3VVVA 1RQ5A 5EOCL 4EF3A 3JWDH 4FADA 3IS0X 3O6ML 4M7KH 2KB7P 5KN5B 4KZDL 4R4LA 4N2MA 4MQSB 4O4YH 3NT0A 2DD8L 5EU7C 3TYFA 3V52L 3GTVA 3UBXG 1SY6H 3TV3H 5IJKC 1P5UC 3A24A 4NN6B 3IMVA 1QWNA 3MTXA 3GSVB 3P02A 1IMHC 3IDNA 4PJFE 1S7QB 2WO4A 2WTOA 2Z8SA 4DFHA 3CVHB 4JKPH 1PP9D 2UXFA 3F65A 1EFXB 4CJ1A 4KTDL 5CMZA 1QFUH 2KERA 3OHXC 2E8YA 2JKJA 3VXMA 2JKIS 4HUWB 2YD2A 5EZJA 1U3HB 4N26A 4YFEA 3WLWC 1HC1A 3U0WH 2WQRA 5C2BH 1MJ7L 4UOZA 4GG8B 1ILSA 1IGIH 4KVCH 5AB9A 3MBXH 4PGCB 3MGTA 5F9WC 5FUCC 1G1JA 1WUZA 4GUPA 2UY6A 1AMXA 4GG6A 1DJXA 2GSGA 4NXSA 4IIQB 2UUDK 3LRKA 1YEJL 3D69A 2H0JA 5D1QA 5IROA 3A6CH 3DPBA 3NJLA 1MFTA 2AFNA 2VDNH 3L75G 1U2HA 3GBNH 2BNRB 1RIHH 1JZFA 1JMXA 5DI8A 1NWPA 1U6AH 1E79H 1LEGB 4KKAD 2X4UB 3GK8H 2YMXH 1FZCC 3MJ7A 2QJKB 4JQIH 4N85A 2VSKB 4Q8BA 1GYUA 3F6IA 4RGOL 4GEJA 3KXFA 1OAUH 1RJYB 4MCYB 43C9A 1DCEA 5HGAA 1D9KA 5K69A 1IX2A 1IAOB 1O5PA 5EO0B 2I9TA 3BASA 3FT9A 3MRFB 2AAAA 2VZTA 4R7DA 1EDKA 4KJQC 4G8EB 4PJ9C 3RWIB 2VN5A 4NEHB 2Q6QA 2WCGA 3CAFA 2BC4B 1U92A 1LTSC 2DQJL 3Q8FA 3MLRL 2VSMB 2N1TC 1F8TL 4FQJH 4Z1PA 5JIDA 2WB1A 5TJHA 2PRRA 4TNWK 4N3TA 4AWJC 1AA0A 1FQ9C 4HLJA 1LYQA 3ATAA 2AEIT 3AE6C 2EDMA 5D72L 5DMKA 3T2PA 3U36B 7CGTA 4WVRA 1ORSB 2MWCA 5FEBA 1ECYA 2H4EA 4PTUB 1BDCA 5TPWH 4FQ1L 1KBGH 2Y07H 2ENQA 2OP4H 2AV7A 4UYPA 5SWZD 4XGZB 2IOIA 4NQVB 5IMKA 2KLSA 4DP1X 1PIXA 1IC5L 4HKZH 3HNVL 1RZ7H 4I1RA 2EDQA 4KO5A 4PJCB 4G6JH 3NG5A 4UM8A 1XB8A 4OF8A 4RX4A 3QH3B 3DK2A 2XWXA 4XP1L 2F54B 3VGDA 1UB6B 1E42A 4FMKA 3V4UL 3L7EA 1H6EA 4NO3A 4GT0A 5F6IB 1KYOI 2CXKA 1FE6A 3JT0A 4HWUA 1G9MH 2YMYA 3C9IA 3S3BB 4RMWA 4OV6F 1N59A 1BFVH 3LS5L 4D0DB 5A6IA 5FFGA 1QQDB 1B4JL 2X3CA 1UYWL 4Q6KA 2R1YB 3I5CA 1OXYA 2Y6TE 3NJIA 2GK0B 4WO4A 5JW4R 3QYNA 3RPBA 1JF1B 1MFDH 2HP4A 1JHTA 1NC2D 3NCMA 2VN7A 2DQEL 3Q8AA 4HWBA 3LRLA 4OJFL 5MHSE 1L7TL 1DBJH 4BV1A 1SMAA 2X6VA 3Q3DA 2CR6A 2ADYA 1XVSA 2H41A 3N42F 5C3IA 1NTKE 3U7YH 1FNEA 1FJKA 2AEOA 3ILDA 5DRNA 3QQDA 2JELL 4TKWA 3VQ1C 3AY4A 3QQ3A 2WANA 3ZJAA 5DJDB 4WUUB 4WHDA 3K6NA 5DRXB 4F33B 5ALCH 2R0WL 2J6WA 3DGDA 4MMYB 3ZKND 4CDHA 3MA7A 3WMQA 5HI4C 3GIVA 2VKWA 4Z5RA 4YH6A 5D7HA 3VGEA 4CVZB 1SFDA 1J8HE 3GRBA 3DBXA 2KP8A 2H32B 4GQ9H 4K3EL 1R5WB 5GZNC 4OZFH 1YQ2A 2X10A 2HJLB 4LVHB 3SDXE 4AJYV 3QUYC 4DTGH 3ENEA 1F2QA 4UB0H 3VFOB 5KVDH 2X53A 3K6FA 5CILL 3EOBB 4X8CA 2WVRA 3B7RL 4KVNL 2I60H 1LWUB 1B90A 1GMIA 1TTCA 5T3XL 3U2JA 5D1ZC 2D7TH 1LT1A 5EZOL 3RHWF 1XGUB 1NCJA 1CD9B 1VGKA 2AK1H 3RP1A 4ZOCA 2OS7A 3FJTA 4Z78B 2O6PA 2WXJA 4FFYH 3KLHC 4OD3H 5CM1A 5IB4A 2Q5BA 3O3AB 4P5TD 3Q13A 4LP5A 3NK3A 1GW0A 2D0FA 5ES4B 1CMOA 4U3CA 1CVRA 2ZOTA 1CL7L 3ELAT 4UNUA 3R4DA 1OGTB 1J1XL 4E5XG 1A7QH 1AY1L 5MEQA 2UX6A 1SQQJ 1EHAA 2AJYH 1O9VA 3DTUB 4DNLA 3WN5B 4PJ5A 3FS9A 2DWDB 3F7YA 2CM6A 4CBZA 2NXYB 2AQSA 3TASA 5GJTH 5DS8B 5L4MA 4JFDB 4P48A 1TZGH 4O02H 4B60A 3QUZC 3ULUE 4NFCA 1XF5A 3L5HA 1A5FL 3OKLA 4QHMA 3VXSD 1U3NA 1XIWD 5DD1H 2ZAIA 1CXFA 2R1WB 1KT2A 3M6DA 4GSDH 4ZS6C 3U30B 5CZXD 1QO3A 2WAHA 3GXMA 5DD0L 3VSVA 1BZ7A 3RBXA 1BVNP 3SDYH 2LVCA 4GBXA 1AKJB 1A7NH 4AGNA 3CX5I 2VLRB 4LNRA 1AO7E 1DN0B 1QLEB 5IVXE 1ANUA 4HIJA 2A73B 4P07A 5MERB 3O41A 2VIRB 5I6LA 3N2JA 4G9FE 1NCOA 3W57A 1TETH 4MJID 4ODVL 3OKDB 3D39A 2WN2A 3TBVA 5FYLD 2H1PL 3ZL4H 4PRHA 3O2VL 4M93B 1UD8A 5J9PA 4K7PH 4IDLA 1U42A 3CN4A 5DLMH 4KTGA 2Q1KA 4PWHA 3OAYK 2WCSA 2YUZA 4HKJA 5IMOA 3L16A 3BWZA 4BE6A 3C8VA 5K9OB 1K8IB 2YXQB 5DMJB 4ABVA 4H88L 4NKOB 2NY6D 1TO5A 4F1SA 5FOBB 5I17A 2GSIA 5TGBA 1TPXB 2ROXA 1NSNL 3TZVA 3Q2LA 4S1SL 2GTZA 1BQUA 4QT5B 1SYSA 3RTQA 4A68A 4OZHE 1XMEB 4PREB 2YPVH 4PLJC 4P59L 4DH2A 1J8KA 2OJEB 1HSAA 2IWGA 4X7FC 5KJ7E 1DQLH 4O2CB 1VFAA 1IC0A 2VAAB 2WTRB 2YOAA 4MDJA 5GRUL 1XV8A 4KY1L 4TTDD 2NLJA 1KYDA 1RFDH 4ENED 5IHBA 1D5XA 2NY4C 4Z7UA 5T1KD 3F05A 4JJ5A 2DAVA 2AEJA 1I4FB 1DVZA 1BPLB 3HR5B 3TBTA 4AJVA 1KEGH 2F53D 5APXA 1R0AL 3LKRA 4N2IA 2EZ0D 1L0NJ 1YAZA 5AOIA 5AZUA 4IBZA 1BCCD 1LP9B 3WHXA 5DZOA 2QHLA 1C1EL 3EIFA 3NUKA 3RPIA 1Z5HA 3HRNA 5DJUB 2AK4E 5CMAA 4K4KA 2EXTA 2FBRA 3ARGA 3H9SD 3FB8B 1T1WB 5HJDA 1SEQH 4N2FA 4NRXA 4WV1C 4WFHD 2P7JA 3OAZH 5AL8A 4EZKA 5IF0A 3V79C 1TKWB 3FU7B 1ONQB 2AGJL 1U3ZA 4XMPH 4LSRH 5JLZA 2WPRA 1ZHLB 4R4FL 4CL7A 2A1WL 1A1NB 2IBZX 4F9LC 5C6PB 3HBGA 5DUML 1FPTH 3O6LL 4JRFA 3FO9B 2VO5A 3QJOA 1VQOP 1IBBA 2ZIDA 1HS6A 4OGXL 25C8H 4QY8A 4QRRD 4ODUA 1XSOA 3ARBA 4P2CG 4RLDA 5IVZB 1LJ2A 3C2AL 3APNA 5DT1L 2Z8WC 4GIAA 3VFUB 2IPUG 3WL9B 3MRHB 4Z8FH 4MJ2A 5TD4A 2IAMC 2WSFH 5BUAA 2E9BA 2W07B 3VACA 3NJVA 5JQ6L 3BMVA 4JG1H 3SJVE 1TCMA 2WXFA 3QJRB 4F2EA 1KCBA 1ZK9A 2GBUA 2B16A 3F62A 4UQIM 1SQQE 3OMIB 4PG2A 4CBPA 1ASOA 2PW2A 2XFXA 1LD9B 2X0UA 3B5ND 5I8OL 3G4SP 4IU2A 3B2VL 5IBTH 1OTTD 1TEYA 1MZ9A 2NZIA 2NCEA 5DJAA 1JE6A 2AXWA 3KLAA 1GOHA 3P3TA 3TBYA 1VL2A 3VCLB 4NAJA 1F4WL 2H1XA 5LQBH 2NY2C 4EIJA 1CK0H 1A8JH 2R0ZH 2XPGB 4GG6F 1DYZA 2QFPA 2VQ1B 1NCWH 2W60B 2OM5A 4GW5B 2Q6WA 1MCDA 1ZA3B 3OHXA 1LGHB 2JMRA 4NIYE 1KB5A 5E7FA 2FXOA 3FTYA 3OHMB 3C08L 4JHBA 5BZDA 1FZEA 4OIFA 1BQHA 2DQCL 3WFCL 1BXUA 1Z5YD 3BVNA 1S7RA 3CCHB 3PWPD 4J3OF 3LV3B 3RB5A 3HPJA 1CI3M 1WTLA 2P5EE 3NIDF 2P43B 2WJ7A 4CN4A 2DKMA 1U3JA 2A0LD 4Q74A 2GUVA 3PQYB 2SEBA 1MRDL 4XPGH 2VLKB 4N28A 1R6VA 1UASA 4X80H 5CGTA 4X6EA 3HG1B 4W9CC 2C9AA 1JPEA 3WS6A 2NNAA 5KTBA 5DUJA 3OR7B 3B3IA 2H47C 2QVKA 4Y5XB 3ZZLA 1A64A 1ZWIB 1FOSF 2DIEA 3CCQP 3NRPA 3ULSA 3ZYIA 3SSGA 4Z0XA 4E41D 1MAMH 4B53A 4C57C 3V5BA 2GB2A 2VZSA 3RKDD 2HVJA 2RJMA 3FCTB 4F7PB 1TJHL 1ZN5A 1MLCA 4DCKA 1BG1A 2WIIA 3SCMD 2W0PA 1N5AA 5IEHB 5C07B 2AZUA 1TLMA 4PG9B 4I18C 2EAEA 4ODSH 3MIWA 4N2BA 2Y06H 3IGAB 3MLUH 3CZSA 4LLYA 4GP5B 3C6LB 2G8YA 3UTTD 5BO0D 4PJFB 3QW9A 4R7VA 3K1DA 2G5BB 2DI7A 1L0NE 3ML8A 5I71C 1U8PA 4LCWB 1JD7A 3VU1A 2FLBT 3PHQA 2FIKA 2Q76B 4ETQA 5IHWA 3BIKA 1BMGA 5AOMA 3BHBB 3K2UH 3T2NL 3B6SB 3BH8A 4OU3A 4B9YA 1U8IA 1G7PA 4XTRC 4AMXA 3NAAH 4L3AA 4IGBC 2NX5B 4Y5YC 1WSST 1DQQB 4Y9FA 4G8FA 3GTTA 1XEUA 5C97A 3CFDA 3DX3A 1S78D 1AQMA 3L9RA 1DL7L 4NQXB 3IBOA 3K7UA 3MAWA 2Y6SD 1DEEG 3TBBA 4JR9L 1W2EA 3VXRD 3OPZH 1QBLL 4AKOA 3FT0A 2RMZA 4LARL 3WDIA 1L5GA 4TLSA 3VD1A 1D6EB 4M3JA 1UKSA 3LRGA 2EDXA 3DUSA 4Y2OA 5E5MA 3GBML 4FNQA 4YDJA 4KKAC 4N0FB 4ZUUB 4ZDHA 3S36X 5KVDE 1JAEA 3F7PC 3CVHH 2AJUL 5E5RB 2DJSA 3EZ8A 5IIEB 2XG4A 4ZQKB 4JM2A 5IB2A 4MKMA 1AZUA 3BDXA 1B6UA 2CLRA 2DEYX 2AQPA 5DK0A 3X13B 4U05A 1VQ4P 2EEAA 5DYOA 1ZLUK 5C71A 5EBWA 1T2KD 2PGDA 3IKCA 1Q0YL 4G1EA 2FECI 4KXZI 4M9PA 5B21A 3SFEC 5E6ID 1FORH 3BCCJ 4HK3N 1T0MB 3QEQB 4UOQA 4FN0A 5F1NA 1IIKA 3B56A 4PHXA 3UYPB 4FERA 1CD0A 1MCCA 2MMXA 3HAEA 3QISA 4QXGL 3HW7A 3TBWA 1MJ8L 1G94A 3V2RA 2FYUG 2H0PA 3MCKA 1QFHA 5AW1B 5F3HB 1A4KB 4JLRB 4LOVA 3CWBJ 4LSUH 2V2TA 3T0WA 5KLIB 4TOYL 1MIMH 5K9JL 3B9VA 2R0KL 5ICZA 5D1ZA 5FFLA 3SPVB 2GKIA 4UDTB 1NC4A 2DKUA 3H7LA 3FF7A 4K3JL 1NJIQ 5B8CC 2R51A 2X4QB 3CFKA 3IRZA 1QRNB 3FU9A 2HMID 1KLUA 3QG7H 3EYUH 1VZHA 1XR8B 4F8TA 3HD7C 2HXAA 1DUZB 4HWBL 3WLBA 1X9UA 5E5LA 2HPTA 1U57A 3MRIA 1CLYH 5DJCB 3Q3GB 1JCKA 1IGTB 2A83B 4MNQE 2YGPA 1NKNA 5G4NA 5HYEA 3FQWA 2WV3A 1NTKG 2CO3A 2W9EH 4GKSB 2FYNC 3VFVA 1DJZA 3QI9A 2EC8A 4R0LB 4GAYA 3QUZA 2IX7C 4H1LG 5DZLA 2Q2LA 1RURL 5K39A 1Y6MR 3P3SA 3P9MA 5JDSA 2FRGP 1OSEA 2PCFB 1XBRA 2VJXA 3U4EA 2ED9A 4JVUA 1NOFA 1RIUH 2DF3A 4AZ8A 3VG9B 4Y4FA 3OJVC 1P1ZB 4NP9A 4XWOC 3LIEA 3OXRA 1JYWA 1KCKA 4L8DA 5CCGD 4C4BA 1LL1A 1Q94A 4TXVB 1S9XA 3NCJH 1ZANL 5G4MA 3OQ3B 4DN4L 5M95B 5EOTA 1UXSB 1KJ2H 4TLTA 4K8RC 1MRCH 5L6YL 4FMFA 3AXIA 1RZKC 4N0CC 5I73C 5JHDB 3GM8A 3LQZB 2HTLD 3HNSH 3U1AA 2Y1AA 5L2KA 1B0IA 4A7VA 1H15B 1CFQB 2D7NA 4BCXA 4JPVL 1LTTC 5HHOB 3H32A 1R1CA 4JPZB 5DMIL 3D0VA 3LH2L 3HVNA 4YHNB 4E0RB 2OMXB 1YBKA 1JPST 2ATKA 3GMRA 3PGFL 1JB0J 1AXSA 1H6UA 1L4AC 3PIQB 4WTZA 1N8ZB 1N0XH 4X99B 4XMLL 3EOTH 2XWZA 1S9YA 3ZT7A 3L74G 3ERXA 4MS6A 4G6AD 3WNJA 2Y7NA 5H2BB 1E65A 5HYQB 2V6HA 5EUKB 1OCWL 1PNDA 3NPZB 2WYTA 1VIWA 4MQXC 5H94B 1J1EB 2XVKA 3NVQA 5KJRL 1MAKA 2IGFH 4HPYL 4LT7A 2J1YA 1Z3RA 2F8OA 1FFOB 4Y2DA 2CRZA 3CIQA 1OVVA 1E6OH 3HR6A 3GMMB 4KPHL 4RRPA 2P5WA 4H0HB 4H26B 1K2DA 1A02J 2DL2A 1UKQA 3TCLA 4W9GC 1WZMA 1EO8L 4TVPD 4LLUA 2W6JH 5GJSL 2CO7A 1FIGL 1MFZA 2GI7A 4QRUB 3RK3E 1G6RA 2FX7L 1OB1A 2B2XH 1E9PB 3KHOA 5MEND 1H8NA 2XV2A 4GH7B 5FPIA 3EF7A 5AVWB 4Q58C 1G0YR 1GGYA 2DYPD 3PJSB 4WSGA 5CZXC 3KPRE 3OXSA 2E27H 4GAGH 1H0DB 4NUGL 4TPRL 4F8OA 3L70J 3O2WH 1GYWA 3HOGA 4LVNC 1FAIH 2ZPKH 3BCCE 1JGEA 3D51A 3S2CA 3L72G 1I3UA 1YPZB 5FDYA 5IOKA 4XMTA 4K23L 4WY4A 1ADQH 1NAMH 3F5WB 3MZTA 4QRTB 1OV8A 3MV7B 4OD2B 3FFCA 5CNHA 4EIUA 1NLDL 3X1EA 3IE4A 4B7LA 3A3YB 3D08A 3OD3A 1BIHA 1ZY9A 2IXQB 1XSJA 2J56A 2DW3A 1XSKA 5ESAB 1MFVA 4W9DC 3CWBE 1O7VA 4NAQA 1ZHKA 4H8WH 1MHCB 5DJ6B 3CSYA 1FNSH 2IYOA 3POHA 1P7KB 3RFRA 1K4CA 1OAYL 5CCHD 4MB1A 4HMDA 4O58H 4QTIH 3FU8A 4JFEE 3C9NA 1CICA 1DVFD 4XMWA 3UYOD 1FU1A 5HHPA 3H1IJ 1MVUA 2CK0H 3QQ9D 4YXKL 3BEVA 4OZIB 1RUML 3F7VB 1KWGA 4TUOB 3PL6B 3Q8EA 4YSEA 4X4MA 2FYYB 1I8IA 5C7ZA 2C8NA 5DGQA 1C5BL 1I8LC 1TITA 5T5NG 3REWB 5AG8A 4P05A 2EYTB 1EGJA 2UWJE 2FAUA 4XNXL 1MVFA 3EW3B 4XN8A 3RNQB 5DVPA 3MXVL 3VWKA 2VDLB 4LAQH 4DW2L 4Y16B 3MJ9A 5F9JA 2NTFB 2UXVA 1K4DA 1XGQB 1CD1A 2GQHA 2NW3A 4GIFA 4MRBA 4OFQA 2AK4B 2EC9T 1QATA 2BHFA 3WO3B 2DJUA 2R1XA 3CVIL 4CNIA 3J07A 3MFGB 1TJIH 1IAIH 2OSLA 3G6AA 3RVTD 4IHOA 4OB5L 1LE5B 4KRNA 3S37L 2L5GB 3AGVA 1BHGA 3CCRP 1T89A 2VAJA 1AS6A 1Z0MA 43CAA 3MCLL 3HS9A 3TH3T 3ZDXF 5FF6A 5PAZA 3FTGB 5H37H 3DVNB 4X98A 2GBVA 1KXHA 5SX5K 2L0DA 4N2CA 2WINB 1A0QL 1LTJC 1BIIA 2W1NA 2Q7AA 3H1HD 1XCQA 3DXAA 3INUL 2FWUA 3GMLB 3OZ9L 1QSEE 9CGTA 4IMKC 3DGGA 1UC6A 1RHZB 2YEVB 2Z35B 4YBLB 3FTVA 3FQXA 4XVUD 3FT3A 4BBWA 1NANI 3FQTB 4K9JA 1ZR2A 2Z93A 4P57B 3BP7A 5D2LB 1JGLL 1PGJA 4F2FA 1YHQP 5CJQH 1BREA 2FBJH 4JDEB 5EF3A 4JFTA 4FZEL 4F7TB 4YIQB 4L3EE 4N5UA 1WFTA 2X4RB 4OIAA 5E8EA 5GIRA 4K0OA 2M8RA 3S98A 3K6SB 2ESVE 3P77B 1LK2B 3VXUB 4JE0A 4LIQE 5JMRA 4MJHA 3RK2B 1RJCA 1XD0A 5K9QG 3L4XA 1FO0A 3DA0A 3QZWG 2P80D 2QPSA 3WUWA 4WW2A 4LSVL 1JZGA 4Z3TA 4WJKB 5F0JB 2BIIA 2XZCH 4AENA 3GUTB 1KB5L 4I18A 4X4XA 4JRYB 3RAJL 5IJVA 1BZ8A 4R4ND 4DKAA 4MB3A 4NNPH 3B5NC 5A2CA 3MNVA 3HTKB 4BCZA 2HVKB 3AUWB 1OTTC 3WXWL 4HFWA 1N73A 1OAZH 1UM4H 2AQ2A 3H55A 1V05A 2H9GA 4P49A 5F21B 1F13A 4ZUTB 3VFMB 5BS0B 3CCLP 3L3DA 2E4FA 1AP2B 2X9XA 4TQPA 3WY2A 5KG9A 1JUFA 1I85A 1KMIZ 4FYTA 4MAUH 3ROOA 4ZI8A 3S96B 2CAKA 2HX9A 1U8OB 2FJHB 2KPNA 2CBMA 3LZQA 4IS6B 4OCYL 3RVXD 2JXMB 1PZ5A 2G30A 1R3KB 3D25A 3L70E 3Q1MA 4F7CA 2VDML 4N9GB 3RNKB 5HY9B 4HT1L 2WVTA 4JCLA 2FY8A 4KK8C 1UZ6E 5M1BA 1YEFL 4JM2F 2DQUL 2Y7MA 2EDBA 1DE4B 5K5GB 1QSFE 4L4VE 5C08E 5LWYH 1HXMA 3BATA 3DURB 4E9TA 4PRID 3BRFA 5TH2A 1M7UA 3GLZA 1NCTA 1OP9A 3B2UD 2SPZA 4I0KA 4PP1C 5C0AE 5E00B 1I3VA 4N2KA 4HCRA 2WAQA 1AS8A 5DMYA 4NC1C 5DD6B 3KYMA 2VWEC 1JZEA 5KAQG 5L9DL 3P30L 4HIPA 3RDTC 3GNML 2CMRL 1UENA 2QTVA 1EHLL 5E9DD 3JCUE 1UWGL 4GSQA 4KMLB 4C56E 4PB0L 1M71B 1KXTB 1ETB1 1O7DC 4X7TB 3MRLB 3H1IE 4MA7H 3R7QA 2VLJB 3LQAL 1JGDB 4I7ZC 4FFTA 1CT8A 4EXPX 1K3IA 1PLBA 3FUEA 1D5ZA 3QDJE 3DX4A 4LCUB 4XBPB 4U1KA 1D3CA 4G8IB 5B39A 1FYTB 4ZAKC 5I0DA 4C4UA 2FT8A 3T2QA 3JV6B 4UB8H 1U58A 1RP8A 4PYGA 2X1QA 4OLZL 2RGSA 3Q0HA 3JTSB 3DOHA 4WTQA 4R26L 4UTAA 3LAFA 3RPKA 5LHDA 4HJ1A 1PL3A 1HEZB 3ZE0F 2X0VA 1HH6A 4FNUA 4NJ9H 1FBIL 3GSUB 3TT3H 1YEDA 5EU6D 4NT6A 2NY7H 1A21A 1DQIA 2YHGA 3LMJL 3BQVA 4G42B 3L2MA 4TQIA 3RBGA 3FO2B 2B15A 5IESH 2D2OA 2E75D 2XICA 3WY1A 3RWJA 3QQNA 5HI5C 4NNYA 4HB1A 4FG6D 2DEXX 5DVOA 1MEXH 1F90L 5CP7B 1RZGA 4I88A 5CLZA 3FH7A 3X3GL 1A6TB 3IFLH 4H13B 4JO4H 4GOEA 1EEZB 1JNMA 3RIAF 4AH2A 1FL5A 3ULVD 1EV2E 4UILH 4F20A 4O9HH 2HCZX 3B7SA 2Y9YA 3MLZH 5A3IC 4UAOB 3K6IA 4MMZC 3QFDB 4DERA 2VRAA 4ASWA 1BE3J 1HH9A 2VOTA 1VQKP 2NY3B 3DLQR 2BY2A 3B43A 3BYYA 3D2UB 2F5BH 3KNBB 1WAEA 3WGVB 4FD0A 5JXED 2BSTA 4LCIH 3CHSA 1KJMB 3PP4L 4H8UA 4OCXL 5C0DA 1X3DA 3PWLB 4D8OA 1VJSA 3FRPA 1GGIL 3HZYA 5BRPA 3VMXA 1D2PA 2FSDA 4KROD 35C8L 4GQPH 2JIXD 4N8VB 2B1OA 2IH1B 4GRLC 1G9NC 2IBZD 3NCFB 4CSTA 2AQTA 3BKMH 1A25A 2XWBA 1VFMA 3G5ZA 4PJ8C 5JIMA 1AQKH 5E8PA 4M6OH 3GXFA 2KS1B 1PU0A 1IU1A 4DO6A 5HHVL 4DJGA 4L05A 2V9UA 3MKKA 3RTLA 4UQCA 2Y7QA 3NA4A 3SKJH 3L3HA 2DQDH 3FB6A 3OB0K 4JKMA 4XB8A 1M1JC 1Q90D 3B9DA 4X6BB 2LLNA 3RZCD 3QXDA 4N8UA 1N7SD 3CXDL 4AM0A 4H8HA 2EYSA 2BVQB 3N42B 1HXKA 3A0BE 4KJPC 4DGUA 2WVUA 1MHHA 4QRPB 2NTSP 1FH5L 2X6UA 3D09A 2HKAA 4M7JH 3QUXD 1BXAA 3NCWA 1SQBK 4CC4A 1BM3L 2EEDA 2CJUH 2CBOA 1X0TA 2E47A 4NQDB 1E90A 2EH7L 4Z7OF 5T3ZD 4XNDA 4UTCA 5HTSA 2G9KA 1ZCRA 1NM9A 1VGEH 4Y0GA 3RGVB 1PLGL 1INDH 1TCRA 4JB9H 4X5RA 3UG5A 1MQKL 2HMIC 3VM5A 3J2PA 4P5TA 4L3FA 5FW6A 3AXLB 2YEZA 3BDYH 4JAMA 4MXQD 5JIKA 4ZNCD 2WVSA 1CJYA 1MI5B 3GRWA 1YY9C 5FYKH 5KSBA 4PJDA 4ZMPA 1GW3A 2B4CL 3IDIA 4HWZA 2YKPA 4H44D 1A7RL 3VJ6A 3BT2L 4HSAC 1R3IL 3RVVD 3MYJA 2YARA 4EYYQ 5EV7A 3T0EC 3NZ8A 4K5PA 2CJTA 1N5YH 1KEML 5I1EL 3MBED 1XIWA 1UT9A 4P3CH 1V3KA 5B3SB 5LCVA 4TNFA 1GPOH 1UURA 2IPUK 3HHSB 4OCSH 1JN6B 3QJQB 4ZMTA 4WFGD 1BZEA 4Q14A 2ADJB 3AMKA 3UZVB 1G1CA 4S1QH 2J5WA 1XCTB 3GHBH 5C0BB 1U8MB 1RK0A 2O6EA 1B0GB 1ZVSA 3LPOA 3ZUCA 1JTTA 3PWVA 1JDAA 5B4MC 5CEXB 2FX8H 1ZLVH 2WXNA 3U59A 2NNFA 4FYRA 4L9LC 1Q9OB 1ZVHA 4KT0J 1ZAGA 2HTLC 4MJIA 4XR8C 4MHHG 4JREC 4AITA 1DQKA 1MXGA 4KX8A 3VRLE 2K9FB 4C83B 4ZUWB 4L29A 4WWNA 2A6KA 4F57L 3SPHA 5KKZB 3ATEA 2Q86B 3L4YA 5I0XA 2EEXA 2BP0A 3PHAA 4KO6A 2Q7YA 1ROCA 4F91B 3CVBA 5C8JB 4LSSH 12E8H 5T1DH 3D2TA 1HE7A 1MDTA 1CI6A 4NO2A 4Y28J 4KC3B 2R44A 2YPLB 3ARUA 1JTOA 2R15A 4RA3A 1CXEA 2OMBA 1SMDA 1PKOA 5A6MA 3HS8A 2ITEA 4KKLD 3EAKA 2YUWA 3B9KD 5J12C 2VMJA 1G6RL 1HILA 4JQ0D 3HA0A 5TDNB 4AY0A 4LEEA 4BFBD 1SJEA 3MHVA 3MO1B 5D96B 5ID0B 3A22A 1HL4A 2MEJB 1C9SA 2YMKA 5E2WH 2OTLP 1U2CA 5IY5B 4IRSD 3L9EA 5EU7E 2YC1B 1H5BC 4YK4B 4Z3FA 3VWJD 3D0LB 3TA4D 4J5VA 5EA0L 1KTJA 2IQAB 2EINB 2AJSH 2WXHA 3HS0A 5T1KA 1MWAA 4GAFB 2QELA 2OYLA 3ATBA 2X3AA 1S7XB 3B4SA 1JGVL 3MXWH 1E4WL 3GJFH 3UGEA 4B86A 5BXFA 4BRYB 5I0YA 1PYWA 2BVOA 3VFPA 3I75A 1WS7A 1NUFA 2IWEA 4ICXA 1RH5B 2OTWA 3G08A 1VEMA 5DK2B 4L4JA 3H9SA 4B9ZA 5DCCA 3UEQA 4ZX4A 1A6VL 1VF5B 4R9HA 4WK2B 1UXWB 9PCYA 1JY2P 1YJ9P 5GGRA 4KKCC 2YPKB 1YQVL 2AAVA 2PYED 4JYCA 1G1YA 1WBXB 1HSBB 3NACL 1P84H 3PWJB 2H5UA 5H4YA 4EZMA 5I1HL 5K9QI 3TXAA 1DQTA 3I2CH 5F93C 4PGEA 3Q5SA 1S3RA 3STLB 4H0LC 1KB9K 1T0NA 3IU4H 3T4AB 1NL0H 2GW5A 1OE2A 3DO7A 4IOIB 3NIFF 3BKJH 5DEJA 1CE1L 4WW2F 2FYZA 3AJ7A 5BO1L 3WMM0 4QRRA 5ACLA 4AG4H 3IPFA 4F24A 2W65B 2ZCLH 5FB8A 3SZKC 3U1SL 5C0CA 4ZFFA 2V5MA 5BMFL 5J13C 3H3KA 4DSYA 4JFEB 3BE1L 4DOJA 5CCHC 4PGBA 1EGJL 3T6VA 4EUPA 5CBEA 1SF3A 3HKZA 1FZJB 4PRBA 1FJ1B 3MJ9L 4AL8C 5I8CB 2AJVL 3RBZA 1BF5A 2ZUQC 4TM9A 1HUCA 1YITP 2VKXA 1CGTA 2FO4A 3UPRA 3AQYA 3F7KA 3SFDC 1NM4A 2OMNA 2CKBH 5HHNA 4I0PD 4U1JA 1UWEH 3QNYA 1WZLA 2WZPD 3DHMA 1K6QH 2QSCH 4CW1A 4PGJA 3B5NA 3L5JA 3U9UB 2VSDA 5D1XE 4MMXC 5CKAA 3OLEA 1QPKA 3AG3B 3IDNB 3JTBA 2O1AA 5DD5L 5CLWA 4XCFH 2EABA 2J2ZA 3O11B 1SOSA 4ZTOH 1JHLH 1Z9SA 4XN7A 3T3MF 4AT6A 2R0LH 3P4LA 3QORB 3EJPA 2HKHH 3RY5A 2ZYRA 1T5WA 3NABL 1QHQA 4POYA 1PY4A 5EZJB 1YEKL 3S4SG 3SDDD 3U1CA 4MQ7A 4XAWH 5LN4A 1A65A 3HZVA 3P0YH 4A37A 3LVEA 1EEYA 3V2PA 1Y6NR 1T21A 2R29H 3MGTB 4GUPB 2UY6B 3LZPA 3HI6L 3MUJA 2O5XH 3NOIA 1KELL 4GG6B 3UMTA 4IL6X 1BBJA 2XI9A 2W5PA 3D69B 3RI5F 3NPSC 5D1QB 5IUSA 5EDSA 4M6NH 1JYNA 2A9AA 3DPBB 4Y19D 1ECZA 2N0MA 4FJYA 5LDUA 5TE4L 5I23A 4UB8E 1A47A 4UOJA 3GIZH 3PU7A 4JQVC 1E4KC 1PPJE 2FJFB 1ET7A 2K78A 5DI8B 4NO5A 4AQAA 2E43A 3EBIA 4MD0A 2G9HA 5CEZD 3SKNB 4GINA 3MJ7B 4CPGA 5DJ8A 3HBZA 3O4LD 3NSFA 3AQXA 2OL3A 4FLRA 3NIDB 3TJEL 4K94C 5KBLA 1I7UB 3O6MH 3KXFB 2ESVB 4OM1H 43C9B 4KZDH 4E41A 5F2FA 3WFEH 1E7VA 1ESOA 1J8RA 1HINH 2ICWI 4GUCA 1T7VA 5BZWA 3R06A 1BJ1J 2XC8A 3SCMA 4PJ7E 1ZV9A 5HHME 3T77B 4M3KB 3H54A 3D18A 2BNRD 1SLQA 2GHWB 3VGGA 5D7LD 1T20B 1SFHA 3QPXL 3VFSB 3UTTA 5DMKB 3T1WA 4ADIA 3BXNA 1W2BO 3L4ZA 3TBSA 3BUQA 4L2LA 5ID1A 1MJ7H 2Q8AL 4B9GA 1SPDA 1JWUA 3M9QA 2CD0A 4CGTA 2AV7B 4XO9A 1M57D 1DFBH 5JXAH 2CK3H 4GMSL 1TENA 1NTKK 2KLTA 5FM8A 4P2OD 5DEZA 5I16B 5IMKB 3P4MB 3WBDA 2PCPA 3ZIMA 5KLVG 1TQTA 2VN6A 4EN2A 4LFHD 5BVPH 4ZO8A 5EEXA 4UIKL 4DVRL 4WFED 4WEBL 5MEPA 3EYQD 4KGLA 4HCRL 4NN5C 3ZIYA 3MCYA 3G5XB 3MOBH 5KUMA 2C4FU 2JNZA 3L7EB 4NO3B 1D5IL 3GDCA 4JQXA 4MA1C 1TQCB 5FGSA 2XN0A 3UGXA 4F9PC 5IHZB 1KTMA 4G6FB 1HVXA 4X4KA 1N59B 5F6HJ 4CVUA 3EFDL 4NKIH 1HKLL 4I5BA 2AXGB 3ARZA 4U1GB 4UM9D 1P84J 3VXRA 3ZMNA 4AEIL 1NTMG 5DVLA 1FAVA 1FE8L 3WJMA 3X3FL 4DGIH 2HZHA 2RTTA 2XXGA 2O5YL 1VHPA 4NQCD 5TK4A 3T3PE 3U4BH 4DN3L 4WO4B 1IJ9A 3HRZB 3SE8H 2E7DA 4PHZA 3LD8C 4LSPL 5AW8B 1JY2N 2BZDA 1PX3A 1PG7X 1P4LB 2F54D 2DQJH 1FVDA 3MLRH 4W80A 4L1TA 4CN6A 3ECBB 1F8TH 2IDFA 4UTAL 1A02N 3QQ3B 4JG5A 5C1MB 5D70H 3RGUA 3AG1B 4AMKH 4J8QA 4Y99C 3FX0A 3NJFA 4W9HC 4RGND 2IBZI 2KK7A 1AQDA 3G6DL 2BSBA 5E6IA 4LF3A 4LLHA 2HYNA 4J39A 4J8RB 3BP4A 3GIVB 2VXSL 2DLFH 2EDKA 1KCLA 3DBXB 1CPUA 4IRZH 3VXOA 1KB3A 3MPCA 5FO2A 1IC5H 1KGCD 4G8GE 1LTGC 1BLNA 1WZAA 2CPUA 1MDAA 2NT0A 2YS4A 1M9WA 5E70A 2JJLA 1CFVH 4XOBA 4PJDF 5KVMC 3TNNA 4PJAE 3V4UH 4EN3C 4UZSA 2E7BA 4PV1C 1VGKB 2QHRH 4WUUD 1OTSC 2BVPA 4TSBH 1DVSA 5E4EB 3SY0A 4EOWL 2ITCA 4M6AA 5KUKA 4RMRA 1U9KA 1B4JH 1UYWH 4PD4D 3H7BB 1UJ3C 3OF6D 3WE1A 1IARB 3T2OA 5MEQB 4OI7A 1DSWA 1YEGL 4OJFH 3L54A 2DQEH 4JGNA 2WMMA 4PVBA 1L7TH 1OW8A 3P4NA 1T0OA 4M7ZC 1RZKH 1N26A 2HSIA 2XTJB 1URIA 3US9A 4IIZA 3VI3A 1UOWA 2UVEA 4KXBA 4NZFA 1NZRA 1Q0XH 4ZW3A 3BAWA 4G7RB 3AE2C 4LCCB 1XF5B 3C5ZD 3MYZA 4MHHI 1AC0A 3WIIH 2O6FA 4KROC 1IM3D 5FECA 1I8KA 3OKLB 3G6JE 4QHMB 5DHVA 3V8CA 2C7UB 4LKXA 1KT2B 5C0EA 3O6FD 3SBWC 4KDVA 4ZZKA 1QO3B 3FUKA 4WHTA 2CIIA 2MQCA 1BZ7B 4GQQA 1ZTXE 1GZQA 3HUSA 2KSEA 3O3EB 2OCFD 5CCGA 1EZLA 1QWHA 5CILH 3OW2O 3PLNA 1XD1A 4YZFF 3W81A 1J1PL 4WI2A 3SODB 2W94A 3Q7JA 5T3XH 2NXYD 3RZCC 5DJ0B 4YSOA 1N7SC 5J6GA 1ZGLA 3D39B 3TBVB 3PS6A 1XZ0A 4FLHA 4XB3A 4AYBA 1TU2B 3OTTA 2FWOA 5J9PB 3IJ7A 4AZUA 3IF1A 3TEYA 3FTZA 3QUXC 2FSEA 1EERB 1WZ1L 4ZZFA 3GRWL 1S9WB 4R83A 2NOYA 4OCWL 4KFMA 4QF1A 5KAFH 4JCMA 3V0WL 1AY1H 2XJKA 1EAPA 1ULVA 2JV6A 4JDZB 1QLED 4Y4KA 1NU1E 1QSVA 3FPYA 1YMHA 1Z7JA 4R3SB 3Q8CA 3TZVB 2XN9D 2D7QA 2GTZB 1SYSB 4PS7A 1RJLA 5ISZE 1ZGLM 2MOQA 5IW3A 4EI0A 4PJIE 5KYWB 4DGVL 2BNQA 3FB5B 3Q9QA 5GRZA 4DGYL 3ZRCC 2HKFH 4ZMAT 2V9QA 2WBXA 1VFAB 4MDJB 4RGMB 4Z1MH 1PNCA 5KEZA 1P84E 1BZ9A 4N86A 5LCVL 2BW5A 3UCQA 2X4OA 4NN7C 1D5XB 3RFZC 1J86A 2C3VB 3FB7A 1LXMA 5D7KD 4JJ5B 3TBTB 3HEIB 4NRZA 4HP5A 2RN0A 1IC4L 1M9SA 1UA6L 2YK1H 3EH1A 4OF5A 1L6PA 5IG7A 5CHXA 1WA2X 2X2JA 2EO9A 3WHXB 3N1GC 2CDGB 1JYVA 2D3JA 1EZVY 1P5VB 3RPIB 1CLOL 5CD3A 5CMAB 3CDFA 5MENA 1OAKL 2PKDA 5J1AA 1GMEA 2J21A 3WNIA 4JO8A 5FYLL 1YSOA 1DEDA 2DYPA 5I9QC 4HOXA 3ALPA 3QCUL 2H1PH 4N2OA 1SQQK 5HYJD 4XBGA 1JPTL 1M6OB 3QIUC 1JI2A 3BAIA 1SHMA 3UC0L 2HT3D 3PXHA 1TTBA 4JFHE 1KDJA 1SQBD 1Y8AA 2WUBL 2Q87A 1KULA 2WD0A 5D7JB 3BVVA 4BM7A 3PAYA 2W9DL 3QPQD 1L0LG 1NSNH 4HBQA 3U0TA 1UHVA 2I7OA 4ODUB 4ZOEA 3ARBB 1NFKA 3D6ZA 1MHEA 2YMOA 2B5IB 2JI3A 3VP9A 1RE4C 1Y0LA 5MEOB 4NZRL 1AR1B 3HG2A 2CJSA 4YDKL 4P59H 3SGEI 3N43F 4KXAA 1RV6X 5TFSL 5CCHA 1FFPA 3VFRA 2AQ3A 1E8XA 4YQXL 2AW2A 4ZNEE 1E2WA 1DVFA 1BX2A 1M1XB 4KY1H 4X50A 3PGCA 5GRUH 1MWAL 4P2RB 3U7WH 4BE5A 2IANE 2XETA 2R56L 1IBYA 1IRAY 3U46B 1YYLL 3DV4A 2OMVA 4BZ1H 3VD2A 2WTPA 3V4PA 4OV5A 2A4CA 1IEBA 1USDA 4PY8I 4UOW0 5K5YA 4IU2B 5KSVB 3G5VA 3DIDA 5DJAB 3IRCA 3KLAB 4F27A 5CGBA 3TBYB 1NDTA 4LK4A 3B2XA 2D9CA 4MMXA 2TSAA 4LGRB 4BZYA 3QXAA 1JBJA 1YYMH 1P7QD 1SFCD 1GU4A 4NRYA 5EC1A 2IG2H 4TLFA 2TAAA 2C0WA 4H2CA 3OHXB 3ABKB 1KB5B 1F1GA 2FZ3A 3KHQA 3CN1A 3RX5A 4XWGH 5BZDB 1IKNA 1TOXA 3A4EA 3OKYA 1A4BA 3MUDC 1E5ZA 4KX7A 1J0YA 2OSWA 4CSSA 1AXTL 3LNHA 1JWSA 3BCFA 1S7RB 3O6LH 2OXHA 3HCVA 3NRQA 4L8SA 3HPJB 1WRGA 1PZ3A 4OGXH 4IJTA 3L3KA 5F9WB 1XF3A 3BH9A 4B0MB 1IT9L 4OCMC 3FTSA 1RVFL 4WI3A 4ISVA 3ET9F 4GO6B 1JGIA 2ATPB 5DT1H 1SEBA 2QQNL 3DTDA 3VNZA 2SEBB 3OKKA 5F9DC 1J18A 1HE8A 1OZHA 2EYRA 4MZIA 4WWKD 2A9NL 3RU8L 5HVHB 5FYKU 5J4MA 3RBSA 3FUJA 4DP8X 2AI0L 1CDIA 3ZDXB 5GRVK 2VDPH 3KPOA 4RVBA 3POCA 3A0HH 3O6KH 1MCFA 5KW9L 4B7IA 1FGNL 4Z0XB 1O75A 1X5AA 5E1AB 3MV9D 1PIFA 3U83A 2AJXL 2JKTM 3L3IA 2HVJB 3ZHDA 3V6ZB 3TGXA 2BOCA 2PPDA 3O3BA 1W2KT 3QQ4B 1MLCB 3KWUA 4MJ6A 1TFHA 1NVOA 2WIIB 3UP1A 3BD4A 4QXUH 2PTTB 1N5AB 3PQYD 1F4WH 3ETSA 3GLAA 2P80A 4PWFA 1TVBA 4ABWA 1TJGL 2DTMH 1JS4A 2N1KA 4ELMA 2N1TB 4LLYB 1DDTA 1JPSH 5CR8A 3TWCH 1ZEAL 2CU9A 4OIBA 3C08H 4QHKJ 3J8F7 2O5NA 2I1KA 2DQCH 3OV6A 4WUKL 2JQAA 4YE4L 3D9AH 3D3VB 5AWNL 1U8PB 2DQHL 1X5YA 2FIKB 1YN7A 3BIKB 4APQD 1MRFL 2QQLH 1KIQB 4GRWH 2O26U 5LGYA 1UD6A 3V6IA 1U8IB 3E1IA 5C07D 2WNGA 3DX2A 4PCTA 1XTGB 1DSFL 1FNGB 2VUOA 4LVOB 4FA6A 5D6DC 4U7SA 2V17H 2E9JA 2M3BA 2ADGA 2A5UA 5JW3H 3CFDB 5FYJU 2OL3L 1FLTX 4I4WA 2NQ3A 3MSPA 4JG9A 4JO2H 2Z5IA 1PPIA 4F9PA 4GS7C 1BAFL 1H3PL 1YECL 2NXZD 1AR2A 4G3YH 1L5GB 2DWYA 1SM3L 4Y7MA 4GFTB 2YZ8A 1KCWA 3RY6C 3HI5H 4PRIA 4Y2OB 1TJHH 4FFVD 2ZF8A 4O2FA 4YDJB 4ZDHB 2QMJA 3WTXA 4HW6A 5E2JA 3WHE1 7PAZA 4YFLI 3D4CA 3HLAA