2RH8A

Structure of apo anthocyanidin reductase from vitis vinifera
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
328
structure length
312
Chain Sequence
KKTACVVGGTGFVASLLVKLLLQKGYAVNTTVRDPDNQKKVSHLLELQELGDLKIFRADLTDELSFEAPIAGCDFVFHVATPVHFIKPAIQGVVNVMKACTRAKSVKRVILTSSAAAVTINQLDGTGLVVDEKNWTDIPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPTLMAGSSLTSDVPSSIGLAMSLITGNEFLINGMKGMQMLSGSVSIAHVEDVCRAHIFVAEKESASGRYICCAANTSVPELAKFLSKRYPQYKVPTDFGDFPPKSKLIISSEKLVKEGFSFKYGIEEIYDESVEYFKAKGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthocyanidin reductase
publication title Structure and epimerase activity of anthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
total genus 112
structure length 312
sequence length 328
ec nomenclature ec 1.3.1.112: Anthocyanidin reductase ((2S)-flavan-3-ol-forming).
pdb deposition date 2007-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rh8A00
1ZK0A 5L53A 1I36A 1KIFA 1NWHA 2Q49A 4R5MA 1DLIA 2OHXA 3PK0A 2BGLA 4RQUA 1G0NA 4BO1A 1R16A 4DMMA 2ZQYA 5JCXA 1E3EA 4KUEA 3E9QA 5L7YA 4EI2A 2VYND 3OIFA 1OFGA 5EPOA 3ROMA 3VDRA 2EG9A 4I5FA 5HA5A 3H9GA 4LW8A 4WLVA 1WMBA 2YY7A 3ADOA 2VHWA 1C0KA 1YE3A 2GO1A 2J8ZA 3WMWA 2A94A 4BNZA 5IN5A 2B5VA 1XEAA 1Y9AA 3VPXA 3W4JA 1B7GO 4IBOA 1ENOA 3GNSA 3RUHA 1PWZA 4LVUA 3SEFA 1B8PA 3MZ0A 2E49A 1ADCA 4OKNA 5JAMA 5KVVA 2G0TA 4CMBA 4R1SA 2ZYAA 5KVCA 1I3NA 3LSYA 1HLPA 3GNQA 2NVUA 4UUNA 5JMWA 4K26A 5GZ3A 2W90A 4OM8A 2AEMA 5DT9A 1I8TA 1ZSVA 5ENVA 2C54A 5KKCA 4I5GA 1Y9EA 1HDZA 4XIYA 5DDIP 3WJAA 5GZ6A 4BO6A 1LDGA 2HLPA 1OI7A 3JD0A 4W6ZA 5G0TA 1YB5A 1T1RA 1ZK1A 2C0CA 2P91A 2PY6A 2PGJA 3QVOA 3EUWA 3RC7A 1XELA 2FP4A 5KJCA 4WEOA 1Q0LA 3RVDA 1SOWA 2Y99A 2CDCA 5EL0A 1GQ2A 3WGYA 4G5HA 1XGKA 3GNTA 1ML3A 4ITUA 2EF1A 2P4HX 3RQSA 2TMDA 3O8QA 2GN4A 4Z0PA 2W8ZA 2I9PA 1EMDA 3ROKA 5JC8A 5L40A 3BHMA 5ITWA 1BTOA 1I2BA 1LDEA 1P3DA 2OOSA 2NVWA 1DAOA 2O3UA 3ZHXA 2GNAA 3DWFA 3RUEA 1VPDA 1NQAO 1UDBA 3GVIA 3ZZNA 4ALJA 3DZFA 1FF9A 4RZIA 2VN8A 1HDOA 1JDJA 3DTYA 1P1IA 3C7DB 1EE2A 1XIVA 3IP3A 1GL3A 2NV6A 3JQAD 4QTZA 2O4UX 4GX2A 1U9JA 4BUCA 1JTVA 4CR7A 1N5DA 2UDPA 4XD2A 3WWYA 4WECA 2H6EA 2CVZA 4NG5A 4MVJG 3C1AA 2WSBA 4OJNA 1Y1PA 3WTBA 1KETA 3WX0A 3PIIA 4N5NA 4EUFA 4W4TA 4IUYA 1UR5A 4IGFA 5AXAA 3E9NA 9LDTA 1DIBA 5A5EA 2I65A 1KC1A 1PTJA 4YAEA 3D5QA 4NHEA 3RJ5A 1LLUA 3IKTA 3RIHA 5B4TA 1P74A 4J2HA 1PSDA 3S1LA 1B8UA 4KZPA 2YHIB 5JAQA 4UVGA 3VC7A 5T8KC 4LRSB 1SBYA 4BQRA 4II3A 4J3FA 1VL8A 5F3RA 2BFOA 5I7EA 5K9ZA 1U2DA 1MG5A 2GD1O 5C7LO 3KYDA 4E2WA 2VRBA 3ITDA 3K96A 4RF4A 2NACA 4Z6KA 1IE3A 3D0OA 4TZTA 3VTFA 5IDXA 4ZQEA 2YUTA 3OECA 4F3YA 4FC7A 3JQFC 1R66A 1XHLA 4MVJF 3C1OA 2VNSA 2FSVA 4FS3A 5JDIC 2EP5A 2P9CA 3K6JA 3VZQA 1PGNA 1JQBA 1GV1A 4E13A 2C7GA 2JAHA 2JHGA 3WYBA 4AL4A 3EAGA 1IULA 3GEGA 1E3JA 5KTKA 3HB4X 3D1LA 3DAPA 3LC1O 3WNVA 4FJ1A 1JKFA 1FDUA 4IY1A 1KC3A 1KEVA 1GEEA 2YDYA 2X8LA 2D59A 2WMDA 4HWKA 4AJHA 3UH1A 1NVGA 4CLDA 3ZWMA 3JD3A 3AOEA 1LDNA 1VKNA 2EW2A 5A9SA 2NADA 5EESA 1O89A 3IKVA 3FSRA 1TI7A 4IJVA 2E37A 4DREA 5T8KA 4YBZA 1WVGA 2NTVA 3IUPA 1ZIDA 2BLLA 3JYPA 2PGLA 3NYWA 3V1UA 3ZNNA 3GZNA 4WE3A 1DRUA 5HBRA 3Q1LA 2Y1OA 3RI3A 5IDWA 3RBZA 1UUFA 4MIYA 2YV3A 4PZEA 5COAA 3T4EA 4BMNA 3GRPA 3OMLA 2Y67A 1RWBA 4LCEA 5C3MA 4PIVA 2H1SA 3HB5X 5ES3A 2I3AA 3RU7A 4Y6SA 1NHWA 4C7KA 5I8ZA 4B79A 4A5OA 3OEYA 3PDUA 3CUKA 3WB9A 2RHRA 1JWAB 3JQFA 4KQWA 1NVTA 5ILOA 3T7EA 4BNFA 4RVSA 3ENNA 3PPIA 1LU9A 4TVOA 4CM4A 4EJ0A 5A3VA 3DBHB 4P8RA 4ND2A 3W8EA 2PK3A 4DIBA 3Q11A 4L76A 2Q1TA 1GZ3A 2DBQA 4FBGA 3F4LA 2FZWA 1R6DA 4RV9A 4P4LA 4XDZA 3RKUA 4B3HA 3IC5A 3IJRA 2BF7A 2JCYA 4J91A 4MDHA 3KM0A 1MFPA 1Q2XA 4Y6RA 4YRBA 4RL6A 2ZQZA 3I9OA 2EIHA 1PJ3A 3D7LA 4NPCA 2FR1A 4BVAA 2O48X 3R3JA 3AUSA 3PTZA 4ZGWA 1N9GB 3WFIA 1E7WA 5A4DA 3NRCA 1PJ4A 1B2LA 1HSZA 1ZUD1 3TFQA 4XB1A 4CMEC 4FFMA 2O3TA 3T4XA 3QJ5A 2X6TA 2DBRA 1DBVO 4M49A 3NJ8A 1Y5RA 5MDHA 3RKRA 4FOOA 3I4FA 3I4CA 3W6UA 1UZLA 3NX4A 3BTUA 3JYQA 3WGQA 1A5ZA 4R5HA 2VT2A 1CJCA 3DZBA 3GFBA 4XYMA 9LDBA 4QQRA 2JKVA 2IYOA 2DT5A 4DQXA 1E5LA 1YRLA 5F1OA 3G1TA 4MIEA 4NR0A 3BMCA 4O1MA 4K9DA 3V2UA 4JK3A 4YAJA 3HADA 1E7MA 3CKYA 4EUEA 3PWSA 2GZ1A 1R4NB 3TOXA 3L07A 4YDRA 3B70A 5KVQA 4FB5A 4HFRA 1DHTA 3JCZA 4BKRA 4UVDA 4YQYA 4DGSA 3ONDA 1Z82A 1X14A 1QKIA 3ST7A 1HDYA 2JCVA 4D0SA 1GUFA 1DIRA 3ANMA 4XB2A 3FBTA 3CPSA 5CFZA 5C37A 3KV3O 2JFGA 4HFNA 4RVDA 4DYDA 2Q2WA 4CMEA 4HX5A 3S55A 3NDJA 1PQUA 5DOVA 4YCAA 3ZWAA 3KSUA 4RORA 1C0IA 3ETGA 1IPEA 1Y8RB 1BXKA 3OJOA 3ZHYA 4IZIA 5L45A 1UZMA 3WICA 1WP4A 3VDQA 1E5QA 3DOOA 1J0XO 2TMGA 4OH1A 3UCEA 1HYHA 3G3EA 3EYWA 1HZZA 2JD1A 3JQ7B 3MJSA 2PA3A 4YJFA 4CMKA 1W8DA 5CPBA 1I32A 4GX1A 3LC7O 4JXKA 1AUPA 1A27A 3H65A 1NVMB 3WGZA 3A14A 1EDOA 4BV8A 2OUIA 2DU8A 3JQGB 4Q3CA 4RDIA 1HT0A 3PHGA 5JXWA 1AGNA 1TT5B 1QR6A 3GLQA 2VYNA 4RF5A 5BT9A 2V6BA 5JMPA 4B7UA 3PIDA 3DOJA 4H16A 3SLKA 1KYQA 4EYEA 1IUKA 4IS2A 1NWCA 2WD7B 3NEPX 4Q3EA 1X0VA 5CAEA 3INGA 4C4OA 4IJUA 1CQIA 4R16A 3OM9A 4QT0A 3P5SA 2RAFA 1A4IA 3PYXA 3DBLA 3DBRA 1OZAA 2BMAA 1FDTA 3IQDB 6ADHA 3VOSA 2YHUA 4G2NA 3DL2A 3BTOA 3HNPA 4BNHA 4CMIA 4D41A 2OL4A 3AWDA 4IIUA 4OMUA 5EERA 4BKUA 1IPFA 4AJ4A 2A4KA 2I5PO 2PWZA 1PJSA 3PYMA 5L9AA 2QW8A 3QWAA 1QYVA 3LLSA 1P77A 3GG2A 1ISMA 3NGXA 1XA0A 4CQLA 1YO6A 2EJVA 4Z0TA 3ONEA 2IE0A 3GVHA 1ONOA 4UUMA 3U9LA 5FYDA 2R00A 1O8CA 3VPGA 3F46A 1U8FO 1MX3A 3DFZA 3EVNA 5G4LA 1F06A 3WS7A 2GZ2A 2EWMA 1GYPA 4CM6A 2CY0A 3U62A 3COSA 4B7CA 4WCDA 1YQXA 3AY7A 5EINA 4BO9A 1NQTA 1QORA 3RUCA 4IQ0A 1N7GA 2ZIZA 2G1UA 3PEFA 1RM3A 3NJ4A 1PJ2A 4NZ9A 4PFJA 3FCOA 3QQPA 4FDAA 5FI3A 3K2BA 5DBIA 1DAPA 1N2SA 2QRJA 5ICMA 3FTPA 3IJPA 4FD3A 1Q0HA 3GHHA 1P1HA 3UICA 4MKZA 3K9QO 2FR0A 3KYCA 4E5NA 1NNUA 5JDCC 1GYQA 1A7KA 5A05A 5KNLA 4A26A 1WZEA 4OYRA 1S6YA 1YDWA 3R3SA 3JQAA 2C20A 2H63A 1EUZA 1ZBQA 8ADHA 1E1NA 3DZJA 4BIIA 4XRRA 3C24A 5CEEA 1ZSYA 2PD3A 2JD2A 2O3RA 3NUGA 1LSOA 2Y0DA 3BIOA 4E6PA 2DTXA 2YW9A 3JTMA 2O7QA 1MXFA 1LRLA 5JSFA 4BMVA 3ETEA 1ORRA 2OBYA 3VHRA 4M1QA 3AUUA 2EHDA 2Q2VA 3TZKA 5K0ZA 1PX0A 3EZYA 5DP1A 2SCUA 4DPMA 1LSSA 5K6AC 2NQTA 2JAPA 3WGGA 3QVXA 3WTCA 3KZVA 4BNIA 3BHIA 5GY7A 1XDWA 1ARZA 1Z7EA 2AE1A 4FGWA 1LDYA 4WLFA 2ILTA 1HSOA 2BFAA 1PZGA 1R4MB 4IMPA 5AOVA 3FD8A 4N5MA 4DPKA 3S2GA 1K2WA 1GFSA 3MOGA 4FIZA 3GY0A 4IPTA 3DMTC 2YQ5A 3VZRA 2ZTMA 2YYYA 2DKNA 3VTZA 5KJ6A 3QIVA 1CETA 2NU6A 1GDHA 4E32A 2POQX 5JDCA 1LEHA 4MVJI 3GN1A 3NAQA 3MJCA 5TT1A 5KJ1A 2O2YA 2V7PA 4Y9DA 1EFLA 1HEUA 2J5RA 1H6BA 4O6VA 2EP7A 1V0JA 3G49A 3GVCA 2DFVA 2YZ7A 4RVHA 3WFJA 1D8AA 2JL1A 5A3JA 1JLLA 3QHAA 3EC7A 1RPNA 3I9JA 2J3JA 4GKVA 3PFFA 1TXGA 4A7PA 1XU7A 1V35A 2GLXA 2ZYDA 3VPHA 4PLVA 3EHEA 1IZ9A 5HWSA 1EUDA 4DWVA 3JQ6A 3F9IA 4EGFA 1E3SA 4JBIA 5K6AA 3VH1A 5IG2A 1DFIA 3ZDFA 1GUYA 4XCVA 4YJHA 4RVFA 4PLTA 2UUOA 4LN1A 5DBFA 4TKMA 2HK9A 5ILGA 2PTGA 2PH5A 2HK7A 5B4UA 5IAAA 3BMNA 2C5AA 5LDGA 2E4AA 5GZ1A 1JKJA 3DTTA 2GR9A 2O4CA 1E3IA 2GSDA 4BNNA 1LDBA 3PZRA 4HP8A 3RWBA 4RCVA 4RO0A 5JCJD 2GF2A 4UULA 4UVHA 3JQEA 2ZCVA 5T57A 1T2DA 4I5EA 4CPDA 3SJ7A 1GEGA 1W73A 1XG5A 3NV9A 4TZKA 4JNKA 1OAAA 3CH6A 1RJWA 4ALKA 2WDZA 3I1JA 4CV1A 1I3LA 3A9WA 4A73A 2X0JA 4UVEA 4ALIA 5TT0A 2CUKA 2ZB7A 4KUHA 4ZA2A 4BNVA 5KWEA 1P31A 2J6IA 5TS3A 4D43A 3FPLA 2IXAA 2GN8A 2PKQP 1J6UA 4FSHA 4J9UE 4ND3A 5G2OA 2PV7A 3FR7A 2FPPA 3GQVA 4NFHA 2G82A 1PGQA 3H6KA 3R1IA 3RFTA 4EEXA 3PXXA 4WLNA 1PZHA 2VHZA 1VE9A 3TZQA 4BO0A 3D3WA 2AW5A 1T24A 3RC9A 3H7AA 4FFNA 1ULUA 1Q7GA 1B15A 2E82A 2GN9A 4B4WA 3VPSA 1C1DA 1WXDA 1MC5A 3WMXA 3HG7A 3I9KA 5IN4A 4EDFA 4NI5A 2Q46A 1CIVA 3U4CA 4YT8A 4CQMB 3HN2A 1XQ1A 1C14A 2X9NA 2IZ1A 3GR6A 3UGKA 3FN4A 4TRJA 5B37A 1T4DA 3EMKA 5TGDA 4LSMA 4M89A 3BTVA 4WPGA 2W4QA 4CR6A 1PIWA 3ASVA 4CM8A 3PP8A 1ULSA 3DC2A 3PZBA 3STHA 4ESOA 1W4ZA 3A28A 5U9CA 4OGWA 4P4GA 4RQTA 2VUSA 4I5DA 4R41A 3WQSB 4NH4A 2QHXA 4KDFA 1GD1O 5JPIA 2XF8A 1D1SA 5A06A 4RPKA 3OJ0A 2V6FA 1MUUA 3GAFA 4CLOB 5BSHA 1PQWA 1RM0A 3Q9UA 4E2YA 1NR1A 1Y8QB 4J9VA 4WUVA 1U3TA 1T1SA 4K6FA 4CUZA 1F8FA 3C8MA 4U8GA 4WK6A 3RC2A 1HKUA 4XEHA 4Q9NA 1U4SA 4B4OA 4CMCA 4E4YA 5ICSA 5HRUA 3JD2A 3JQ9C 3GZ4A 1KERA 4AJPA 3E9MA 3OIGA 3WIEA 5CDGA 2AEFA 3LT0A 2Z1NA 1BSVA 1I10A 4EUHA 3RSHA 3CMCO 2GRAA 2X4GA 2D3TA 3U5TA 4CM9D 3FR8A 3HJAA 2X22A 4WCFB 3ZWNA 3TWOA 4HY3A 1EQ2A 2NTNA 3GMSA 3GGPA 4HKTA 4XZ3A 2YFQA 5BNFA 4DBVO 4M86A 2W2LD 2PKQO 2X0IA 1OMOA 3KYBA 4PRLA 1E0DA 2IEDA 4ILKA 5I9NA 5A04A 3V1TC 2XXJA 2AQ8A 4K28A 1NX6A 4WOKA 1PS0A 1EFKA 4IJWA 1GZ4A 3ZWVA 4L9RA 1O5IA 1MP0A 1CDOA 4HBGA 3P19A 2GYYA 1M6WA 4EITA 2GN6A 3ZGYA 3B1FA 4AJJA 3GK3A 5HM8A 1UJMA 3A1NA 3JSAA 4AJKA 3TDKA 3WIDA 2BD0A 3NGLA 2V6GA 3HN7A 2X0NA 5JO9A 1RYDA 4MVJD 4S3MA 1Z74A 1B0AA 1UP7A 1IHXA 2I3GA 3AI1A 2NQ8A 1GQYA 1S7CA 5G0VA 3JQ9A 1E1KA 2BHLA 3OP4A 3PLNA 3RC1A 2I6TA 4U0JA 4YEDA 3QWFA 1P1JA 1SPXA 4YQZA 5IFLA 1DRVA 4FJ0A 3MJEA 4DMLA 3PFWO 1E7RA 3L6OO 4GMFA 3EK2A 1ADGA 3AW9A 1E1LA 1EK6A 1VL6A 1ZJYA 2PR2A 1ZK2A 1PS8A 4ONEA 4AICA 4LISA 2HQ1A 3ZWPA 1X7DA 4BNMA 5CDSA 3OIDA 4PGFA 2HDHA 2Q3EA 3F6YA 4H7PA 3QV1A 3GDOA 4Z0HO 2B37A 1T4BA 3FNFA 3KYDB 5J23A 4GVXA 2I67A 4OXKA 5TQVA 1O6ZA 4ZJUA 4C7JA 1N7HA 3H5AA 4ROSA 1BXGA 4CMJA 3OH8A 3GAZA 2OP0A 3DAGA 1I30A 2FWMX 4IGEA 1A71A 2DUWA 3ANLA 4DUPA 3V2GA 2R2GA 5JE8A 1HDXA 3AOEC 3RU9A 4MP8A 1A9YA 3C7CB 3N7UA 2JCXA 2DQ4A 1O94A 3OA2A 3TSCA 4OQYA 3H4VA 3MOIA 1PWXA 4YT5A 4XYLA 5IZCA 1QV7A 1UH5A 1F8GA 1R0SA 3IMFA 4GAEA 1HDRA 2Y1GA 3EGOA 4LSWA 1UDAA 1M66A 3N74A 4BO2A 1LSJA 3MJ4A 3RAJA 1GZ6A 2ZJ0A 3W4IA 5L7TA 1K3TA 5A9TA 1X0XA 3H9JA 5KKAA 1CWUA 1MLDA 2O3QA 3O4RA 5CPFA 4R68A 4WLOA 4YVFA 1WMAA 2X9GA 3HUDA 4LRTB 5ADHA 1NBOA 3ADPA 1C1XB 4RZHA 1NFQA 1LSUA 2P68A 3JQDA 5FEUA 1MG0A 4UEJA 4Q3BA 1TLTA 2NNLD 5A9RA 4BNLA 1BG6A 3WYEA 2C82A 1I3MA 1QXSA 3GMDA 1E1MA 2WTBA 3L6DA 2ZB3A 4PLYA 4ZVVA 5CDYA 4YA6A 1DXYA 2GUGA 4J43A 4W9NA 4CLRB 1ZEJA 2YHIA 3SX2A 1VL0A 5G0SA 1KY5A 1DPGA 3O9ZA 3E48A 2DFDA 2NTJA 5DCUA 2FN7A 4BHTA 2IDZA 2HRBA 1DIGA 2VZ0A 3WDSA 2CDBA 3GT0A 1UAYA 4J7CA 1HWYA 4BB6A 1LLCA 4MIOA 4G81A 4J7UA 4QFDA 2GERA 2WJPA 2WYVA 1XWFA 2QRLA 3GEDA 4Z3DA 2Y1EA 3TZ6A 3UAGA 3GG9A 4PLFA 3ZWCA 4I9HA 2CF6A 3PGXA 4E12A 2JFFA 1DC4A 1K6JA 3RUDA 3PI7A 4E5PA 1LI4A 3BMOB 5MGBA 4E0BA 4DRYA 5COQA 1TVEA 5A1TA 1IHYA 4XYBA 2QQ5A 4Z9FA 1SCUA 2DM6A 2Y93A 3UKOA 4BOYA 4GVLA 3P2OA 4L4RA 5H83A 4AJOA 1D1TA 4BQPA 3E5RA 1U5CA 2DVMA 1P33A 5ER9A 4CJXA 2VYVD 3OQBA 1AE1A 2Q2QA 4LK3A 3AU9A 3MTGA 5AVOA 3SC6A 3PQFA 5A02A 2I99A 2W98A 1X1EA 4UEOA 4BO8A 1U7HA 1E3WB 3S8MA 3ZWBA 1FMCA 1K6IA 4WJZA 4A27A 1XYGA 1PJCA 4XGIA 1WW8A 1GV0A 4RJTA 1UXHA 1NXQA 1YOVB 3JYLA 4MKXA 3M6IA 1FXSA 5JCJA 3E18A 1AXEA 3B20A 3ITKA 4GLLA 1HXHA 2NWQA 3QVSA 3UCXA 3V8BA 3WGOA 5HTOA 4DIFA 5A03A 4YT2A 2AXQA 4PZDA 4R3WA 2VTEA 1Q7CA 1ZMTA 4IMRA 1QP8A 1K6XA 3VH2A 2Y1CA 1B16A 1KVRA 3NTRA 4RPLA 1ISGA 4QO7A 5EIOA 1YQDA 2J3HA 5L7WA 3DONA 3GN2A 2VZ8A 5F5LA 3DBHA 3M1LA 4FCCA 1QMGA 4LCJA 1DJQA 2EERA 4PLPA 3A06A 1XLTA 3ZW9A 5L4NA 3AOGA 2B83A 3QVWA 1ENYA 3OF2A 1VRWA 4HXYA 1CRWG 4L8VA 4ND5A 4PVDA 3UHAA 1X13A 4WASA 4IDAA 3QW2A 2VWGA 1RM4A 3GRKA 4JBGA 4MJLA 4A10A 2ZKLA 4JJGA 4BNJA 4MOWA 1EUCA 4RPGA 5H81A 3TOZA 5DCWA 4HFMA 2P5YA 2V65A 1P1KA 5DULA 1ZFNA 1N9GA 3H9QA 3JD4A 5IF3A 4GGOA 3VAZA 3ETDA 2HK8A 2X1HA 4R3NA 1JKIA 4CQMD 2EV9A 2Q1WA 2EW8A 2ZK7A 1YDEA 4AVYA 2EKQA 1U4OA 2AMFA 2BFPA 2PLAA 1YJQA 1U3VA 1C0PA 5A5FA 3RUAA 3AM4A 5BR7A 2IODA 3GHYA 4XJTA 2WE8A 5U4QA 3F1LA 1VJTA 3RUIA 2ZATA 3GPIA 1QG6A 4L4SA 3PJGA 2PFGA 4D3DA 2OFPA 2HAEA 5TLSA 1VC2A 3ZI0A 2X0RA 2R00C 4BS9A 3ULKA 2R6JA 3HDJA 1GYRA 1R15A 2PH3A 4P22A 2Q1SA 5FF9A 3DBLB 1H94A 4PG4A 1B14A 1WPQA 2G17A 1CEQA 4Y6PA 1R4NA 3SC4A 3EY4A 4D0RA 4GH5A 5CEFA 3FPCA 2BKAA 1UAGA 2XAAA 1GCUA 2Y68A 1PR3A 1OOEA 3GUCA 5LDHA 4F45A 2AQIA 5LC1A 4CQLB 2UUPA 1LX6A 1VKOA 2VCYA 4MP6A 5C5IA 3ZV5A 1OC2A 2ET6A 2OMEA 4FN4A 3LYLA 4CL8A 5JY1A 3MEQA 1BMDA 4P38A 4JLWA 4MPDA 1NTOA 5L4SA 1GR0A 3IOYA 1LC0A 5TNXA 4GSKA 3CTMA 2FRDA 4W7HA 3SBOA 4Q3DA 1XKQA 3ZN2A 2B69A 5DF1A 4CM9A 1Y81A 3JQBC 3INTA 1QYCA 3RJ9A 4EZBA 4GX0A 4CMAA 4PG7A 1F12A 3WYCA 1PU2A 2BGKA 1IZ0A 1VJ1A 2O23A 2WM3A 4M87A 5KJEA 1U2GA 4DL9A 5AXBA 3V2HA 2XOXA 4ALMA 4OXNA 3CSDA 1J5PA 1GQQA 4AJEA 4PG6A 1SZJG 2ZCUA 3ZWYA 4XX0A 3OSUA 1V6AA 3IL2A 1N92A 1U7TA 3K31A 3JQ7A 3RCBA 1NPYA 3GFGA 4R9SA 3LT2A 5BSFA 3L77A 3NDRA 1P0CA 4N54A 4EW6A 3DHEA 2HUNA 3JQGA 4RLHA 1H9AA 5JYEA 4XGKA 4YR9A 4IJKA 1TT5A 5C7IO 4Z3KA 2PZKA 2C59A 4NNJA 3PHHA 1MV8A 4E3ZA 1ZEMA 2UV8A 4K6CA 3S2IA 1TA4A 4QSMA 4J49A 1BVRA 3WGHA 2PNFA 2DBZA 3PJEA 3ZHZA 1A4UA 1N1GA 1V9LA 3AM3A 4Q39A 1BHSA 1D3AA 2IZZA 3AFMA 3ZU4A 5JAZA 3TFOA 4HFJA 2J5QA 3FWZA 1T26A 4TROA 4JGBA 3NDIA 3PDJA 3GEMA 3VVBA 3R6DA 4ZHSA 2IEBA 4JQCA 3JQBA 1I0ZA 4KTTE 1XU9A 2GGSA 3L9XA 4A03A 1DB3A 4NBRA 4XR4A 4BNYA 3KLPX 5I9MA 1NASA 3C1TA 1DC6A 2B0JA 5EN4A 4B8ZA 2HJSA 3ASUA 4JROA 4F6LA 4FW8A 4JIGA 1DHRA 2NLOA 1ZXBA 3QWHA 1T25A 2OXIA 1GY8A 5HS6A 3Q2IA 1PJLA 4O5OA 4YJGB 4RDHA 1CQJA 4XIJA 1JU9A 5FI5A 5JNLA 4WKGA 4IDBA 1NYTA 2VOJA 3W1VA 4KDEA 3PLRA 3D64A 4IINA 2QG4A 3S2FA 2X23A 4YWJA 1DLJA 5F1PA 1H5QA 5H82A 3CMMA 1NP3A 3IP1A 3GC6A 5G4KB 1HDCA 1GTMA 1YH3A 2C7VA 3VPFA 3ZNQA 4PLHA 2Q50A 3MWDB 1L1FA 1Y5MA 1E92A 4EJ6A 4J2OA 3KXDA 4A0SA 4OSPA 3GDFA 3KOUA 3LK7A 3DB2A 1LDMA 2HJRA 1UP6A 3E5MA 1P1FA 1Z75A 5DP2A 3PJDA 4CMGA 2ZB8A 4OKIA 4JP2A 2W2KA 2Z95A 1P44A 4NJMA 2DPHA 2HMUA 3NKLA 4UVIA 4DTIA 4YJHB 2RCYA 1YB1A 1WDKA 3K2EA 1Z6ZA 3BA1A 3P2YA 3UF0A 4YAGA 1HE4A 1ENPA 1DFGA 4PG5A 2JFHA 1SAYA 1UXJA 1IL0A 2Q1UA 2CFCA 2HCTA 1E7YA 2DUUA 4MVJP 3UUWA 1JA9A 2YV1A 3AM5A 1HE2A 1YL5A 1RYEA 3G1UA 4CLXA 3GGGA 2PZMA 3HWRA 2HU2A 2Y1DA 1JAXA 5KCZA 6LDHA 8LDHA 4IDEA 1QRRA 1ZZEA 3DZHA 3PVZA 1QLJA 3U4DA 2FSSA 3HHPA 3E6AA 3NTQA 4QFCA 4ND1A 2IXBA 3BMQB 3WG9A 4QUKA 1BW9A 2RHCA 1AXGA 1G0OA 2GZ3A 1O0SA 1R4MA 4TSKA 4R9RA 3P7MA 2WEKA 3WOHA 4BO5A 1YONA 2A35A 1YS4A 3UXYA 1OBFO 4DPLA 3C3XA 3H9UA 3PQDA 4JP3A 3WR5A 3GOHA 3ROPA 1K0UA 3ICPA 3G17A 5T64A 2Z1MA 1LUAA 1XQ6A 1P45A 2BFMA 4Z9XA 2IRWA 3QRWA 3KB6A 4XWYA 4CUKA 3LT1A 4R54A 4IM7A 4ZU3A 1NQ5A 3WBFA 4B3IA 2ZTVA 1WAMA 1LQTA 1HETA 1Y6JA 1PJBA 4BNXA 2NSDA 2JHFA 1KVTA 1H2BA 1HRDA 1VSVA 3KLMX 3AUAA 1VSUA 3RD5A 1N1EA 1KS9A 5KOIA 3HE3A 1ZW1A 4CM7A 2NU7A 3OHSX 1P0FA 4DXHA 3AK4A 2YFHA 4E2ZA 4NFYA 4BNWA 5JS6A 1K5HA 3DHNA 1YQGA 2VWPA 1R0LA 3QP9A 2X9VA 1B8VA 3NT2A 3L4BC 2RH4A 1K89A 5HS4A 3U4HA 3CZRA 4TWRA 2FY8A 1ZMOA 2X5JO 2VUUA 4MINA 3MTJA 1LTHR 4FFRA 3KEOA 4GL4A 1F0YA 5FWNA 2AA3A 3UVEA 1H6AA 5EQDA 4D45A 2P9EA 3I9LA 1I01A 1P1RA 2VTDA 3TZCA 1LA2A 4L0QA 3H3JA 4OO3A 3PHLA 2AG5A 2I66A 3DO5A 3PHJA 1GCOA 2OORA 3O38A 4NK4A 4I9NA 3JQ8A 3CINA 4KOAA 4YAIA 3KSZO 4E5KA 4J4TA 5JLAA 2DPGA 4W7IA 3UFXA 1VJ0A 2D5AA 4NU6A 4KUGA 4RF2A 4DBZA 5DCYA 2V6MA 4L74A 3KUXA 2HSDA 4CV2A 4NJOA 5KJFA 3DDNA 4N18A 2DTDA 4R01A 2AEJA 1A7AA 1T2AA 5JAIA 2WYUA 4URFA 3WNQA 4O59O 3TL2A 4AFNA 3PJFA 3OETA 4TRMA 2NVUB 1TB4A 3RFXA 1X1TA 4E5MA 3DR3A 1ZK4A 4JCOA 4OL9A 5TX7A 1TEHA 5JBIA 1YBAA 2JD0A 4ZQHA 1T2CA 3RROA 3L4BA 4LMPA 4CL3A 1E7QA 1DO8A 3DQPA 5JYDA 1WZIA 2F00A 4P4NA 3B1KA 4BGEA 3K92A 4LVCA 1ID1A 3LT4A 4E33A 4EJMA 4IDGA 3U49A 4CQMA 2BI7A 2D4AA 1G6KA 4Q3AA 1WDLA 4WCFC 1ONNA 4H15A 3BAZA 2Y0EA 4PLCA 5TC4A 3E03A 1EQUA 3CE6A 4MKRA 4JN6B 1AHHA 1FDWA 1M75A 4Q3NA 4R69A 5FFFA 4DLBA 3O8QB 4F46A 3HFSA 2G5CA 3VZSA 1NPTO 2O3JA 2D5CA 4I08A 3W4KA 1GUZA 3ZWXA 4GGPA 4EEZA 3ZU2A 3G79A 1DOHA 4J4HA 4PZCA 2E48A 1IB6A 2ZB4A 1KEUA 4WLEA 1HF3A 1MA0A 1W6UA 3H5NA 4XRGA 4OHUA 4RF3A 4ZICA 5I7FA 5DOZA 4ZD6A 4XYGA 4YXFA 3B6ZA 2H9IA 4DYVA 1EVJA 3C85A 5GMOA 3TQHA 4AJ2A 4CLOA 4GBJA 4NIMA 1BDMA 1DIHA 4M8SA 1Y8QA 1AHIA 1DC5A 3ROQA 1I2CA 4UUPA 1E6WA 5TSDA 3ENKA 4NDNE 2B36A 2YQ4A 5IZCC 4G65A 3GDGA 3U4IA 1VI2A 2ZTUA 1Q7BA 3RFVA 4AJIA 4BNTA 5AXDA 1X15A 2HRZA 1NPDA 1BXGB 3K8ZA 1EBFA 4HNHA 5EQFA 5IDYA 2QZ9A 1SO8A 3E8XA 3OFSA 5JO0A 3TJRA 4IQ8A 1I5RA 4M55A 4D3FA 1DJNA 1PGOA 4WCFA 1JWBB 3HDHA 4UREA 1M67A 3H3FA 4ALLA 3AI3A 3HQ4O 2QX7A 2RH8A 2VZ9A 4KQXA 1U1IA 2LDBA 3JV7A 3K5PA 4E31A 1C3VA 5BSEA 2E6UX 2AQKA 3GA0A 4CLEA 1WNTA 2AG8A 4NU5A 5TRTA 4DVJA 2PZJA 1QYWA 4FC6A 3HDQA 4BO7A 4YPOA 4CM1A 1YJ8A 4XKJA 1ZKMA 4PCVA 1ADFA 4W9NC 4E5YA 4MP3A 4XDYA 3M2TA 4ND4A 1Y7TA 3FNGA 1D4FA 3WQQA 4NMHA 2G76A 5JFOA 4ZRNA 1VLLA 1BVUA 2B5WA 2VWQA 4IS3A 2ZYGA 2CZCA 2UYYA 3L4SO 3VVCA 1ZVMA 2I76A 2FMUA 3I6QA 1XSEA 1PR9A 3HZZA 1TT7A 1ZSNA 2F1KA 3ZW8A 4IIVA 4Y98A 4OXYA 7ADHA 4PVCA 1ZXLA 1YVEI 4YRDA 1U8XX 2YV2A 1ZJZA 3QWIA 3Q9NA 1BRMA 5DNAA 1LBEA 1MC4A 3F47A 1MXHA 1ADBA 1IY8A 4L75A 4J90A 5A9SB 1PJQA 3X2FA 3JD1A 1PQPA 4MO2A 3F3SA 1HE5A 2XPCA 4DQUA 3FRJA 1MGOA 3GZNB 4IDDA 1ZH8A 1B3BA 2Q45A 2VUTA 2YDXA 1PGPA 3IAHA 3CZMA 3ZH2A 3VKUA 1ISHA 4FOSA 3Q3CA 4QO8A 4N7RA 4CM3A 4TRNA 4NFSA 4YYZA 2CF5A 4E30A 1OC4A 4GMGA 1A9ZA 2PD4A 4CV3A 4LGVA 4RPHA 3E1KA 1JN0A 3U09A 2OZPA 4CM4B 2P9GA 3DZIA 3O26A 4R51A 3M1AA 1LJ8A 1ISIA 2AE2A 3WBBA 4ALNA 3EDMA 2RBEA 2Y1FA 3KETA 2DTEA 3WWZA 3BHJA 3FNHA 3IDSA 2FOIA 1X7HA 4BMSA 4AJLA 1BGVA 5L51A 2P2SA 1QSGA 4OOFA 4U6QA 2WD8A 4D79A 4FJ2A 2XXBA 3AUTA 1RM5A 2EKLA 3FWNA 3FHLA 1C1XA 4XJSA 5ENDA 4OSOA 3MJTA 5CG1A 4U6SA 4BO3A 2VHXA 1HLDA 1NAIA 1YBVA 2B4RO 5IJZA 3HDYA 1V3VA 1YL6A 3AJRA 2AHRA 3C7AA 2X5KO 3GF4A 4Y8VA 5THKA 3U3XA 3WGTA 4AJ1A 1AN9A 3AI2A 3I6IA 1KY4A 5CP8A 5I7SA 4NBWA 5TJHA 1R37A 3R0IA 3PWZA 4ZQBA 4JX8A 5ER6A 1LLQA 1Q1NA 4I8XA 5L4LA 1EE9A 2EKPA 3GH3A 4PRKA 5EJ2A 3UN1A 4TMFA 3RUFA 2B4QA 3M2PA 2DC1A 4CLRA 1NR7A 2OGUA 5JDIA 1JW9B 1L7DA 3BMCB 4J1QA 1IYZA 2A92A 3CIFA 3I83A 3ZNPA 5BNTA 1PL7A 1DFHA 5KVSA 4CV0A 1CF2O 1J49A 4ZQFA 4EBFA 1KVUA 2B4TO 2HMTA 4TQGA 4UEKA 1H6CA 1FDVA 1EVIA 1PS9A 1XR3A 1GU7A 1P9LA 1YKFA 2CVQA 3QLJA 4GLOA 1HL3A 2WE7A 4KTVE 1PZEA 4BNKA 3PYLA 4N5LA 5G0UA 4JJIA 4OQZA 3D5TA 5T6BA 4YRAA 4BKPA 2QYSA 2Y66A 3LQFA 3CEAA 3LDHA 5T5QA 2FR8A 4HV4A 3BMOA 4R1TA 3RBXA 1J4AA 1WWKA 3H2ZA 3PWKA 3AY6A 4GI2A 1W0CA 3KEQA 4CM5A 1KVQA 4L4XA 4F6CA 5IXYA 4WEQA 5CHEA 2OBNA 3LVFO 2Z5LA 4ZN6A 5JY6A 1LNQA 2D1YA 3F5QA 3I3OA 4IDFA 2VRCD 5U1PA 3TZHA 4WOJA 2NU8A 4XGNA 4D44A 1QLHA 1HTBA 1LC3A 4IDCA 2H5LA 3QY9A 1FK8A 1C0LA 4YB8A 4UUOA 2HO5A 4BNUA 4E21A 1LRJA 1L7EA 3KBOA 5CG2A 3NTOA 2VHYA 1Z45A 2CNBA 3L6EA 3ON5A 4M54A 4YJFB 3PGJA 5AQ1A 3D4PA 1Z7BA 2UAGA 1E3WA 3B1JA 4K1LA 4FQ8A 2NM0A 1ZCJA 4O63O 3KO8A 3ZV3A 5DZSA 4GWKA 1YOVA 2Y0CA 3BTSA 3S2EA 5C7OO 5L3ZA 4D7AA 2BH9A 4JJFA 2NUAA 3QSGA 3RBVA 1ZNQO 1SEVA 4W82A 1H9BA 2Q4EA 2Q4BA 4OIMA 3I9NA 2IYPA 2DBVO 1U5AA 1CERA 4BKOA 1NFFA 2QYTA 1PEDA 1R12A 2GASA 3KHUA 4INAA 5F5NA 1BWSA 2FPGA 3HFGA 4BB5A 2EJWA 3LZ6A 1FJHA 3OQ6A 4YT4A 4J1SA 3UOGA 5I8WA 3DBRB 4B3JA 1IOLA 3DMYA 3FI9A 2X58A 4XYEA 1LRKA 3DXFA 4AJNA 4B8WA 5TIIA 1M76A 4CMIB 1M6HA 3TPCA 3F1KA 4PLZA 4S1VA 5LCXA 3KRTA 3F5SA 5AYVA 1EBUA 1Q0QA 3DAFA 2VOEA 3JQCA 4QX6A 1F17A 4NBVA 1YL7A 3ANNA 4DIOA 4X54A 4HNGA 5JC1A 3AFNA 2VQ3A 4NBTA 4PN3A 5B12A 1PJTA 2VT3A 3HSKA 4WNCA 3AU8A 1T2FA 3OBBA 3K30A 1E3LA 2VWHA 4QEDA 1UXKA 3OJLA 2IZ0A 2YJZA 3ABIA 4XQGA 3O03A 3LLVA 1SNYA 3EZLA 4DQVA 4WLUA 2BRUA 3WGIA 1Y8RA 5JW6A 2C2XA 2W2LA 4DA9A 4UAGA 1QYXA 5L95A 3QVTA 3OJFA 1WDMA 3I23A 4CODB 2P4QA 3WXBA 1KEPA 4L73A 3BZUA 3Q2KA 2B35A 1ZO8A 4MVJM 3KYCB 1ISFA 2GPTA 4J16A 2RIRA 4RVGA 3Q6IA 1HZJA 1EK5A 1U3UA 1PL8A 4GPD1 1DSSG 2QIOA 1HDGO 2AQHA 4CR8A 3JQAB 1SMKA 1E6EA 3DBVO 1HE3A 4J0FA 3MJVA 4XQ9A 4RPJA 4MVJA 1PL6A 4J6FA 2PD6A 4IZHA 2WD7A 3JYOA 5B4VA 1GADO 1JVBA 1YWGO 1U3WA 3NT5A 2GDZA 5DBGA 1JVSA 4J4BA 4R1UA 1EEHA 1NM5A 1F14A 3DFUA 4PLGA 1QV6A 1RKXA 3WLFA 5IXSA 3V1YA 5I7VA 1DDOA 3D4OA 4CLHA 1XCBA 1V3UA 4HUJA 1JAYA 4E2XA 3LF2A 3WJ7A 2C07A 3SVTA 2PGDA 5BQFA 3SJUA 2O7SA 3W8DA 5CEJA 4BV9A 3LU1A 4J7XA 2DAPA 1V3TA 2OP1A 3EVTA 4U7WA 3TNLA 4GWGA 1M2WA 1O9BA 2P5UA 1LQUA 4BKQA 2EEZA 3A4VA 5KIAA 1GPJA 2X7HA 4XR9A 2CSUA 3TF5A 4I9UA 3ICCA 3H8VA 2VNAA 1O95A 2D8AA 4Y67A 5T67A 3ZV6A 4RVUA 1H2HA 4A2CA 4R1NA 3OQ1A 2EXXA 4HADA 3DEYX 4H3VA 1LXCA 2J5KA 1I3KA 3LF1A 4B4VA 3QWBA 4I1IA 1DIAA 2CVOA 2O50A 2W2KB 3GGOA 4R4JA 1ZK3A 3PQEA 4OAQA 4BGIA 4NJMB 4YAKA 2WWRA 4CMHA 4U5QA 3V5NA 1SOVA 2CD9A 4TVBA 1BXZA 4FR5A 7MDHA 2D0IA 3U0BA 4Z9YA 3ZWOA 1YGYA 2LDXA 3IS3A 1H6DA 3AY3A 2ZTLA 3Q0EA 1H0KA 2QRKA 3UCFA 3W6ZA 4IXWA 1I24A 4D3SA 2C5EA 4KMSA 3OA0A 4DC0A 3GUYA 3ZNOA 4DLAA 4RLSA 1PGJA 3KVOA 4JBHA 1SC6A 4J1TA 3ZHBA 4OOEA 4GX5A 1E7SA 3UW3A 1NHGA 4PLWA 1GPDG 3TL3A 3QA9A 5I9LA 5IZ4A 1B3RA 1ENZA 1BW9B 5DN9A 4FFLA 1SB8A 2J3KA 1KOLA 2EGGA 3BMNB 3FTNA 5TJ9A 4WNIA 4ZQGA 3L9WA 2NU9A 1E6UA 2EGHA 4FFOA 3GVPA 2Y05A 3NT4A 4IQGA 3TN7A 2QZZA 1DC3A 4YJGA 1HYEA 1UDCA 3PRJA 1N8KA 3PHIA 3SLGA 2CMDA 4QXMA 2PKRA 1EVYA 2NVBA 2A9FA 1YBMA 1UP4A 4KWHA 1CYDA 4XA8A 3ZU3A 3D3EA 2PZLA 2FHSA 3F4BA 4GSLA 3ZV4A 4NK5A 5G4KA 4B7XA 4J1NA 3H2SA 1H93A 1I33A 3K73O 4NQZA 1NFRA 2OO5A 4LMRA 1DEHA 1NAHA 4MVJE 2FZEA 2C29D 5BNIA 1Z73A 1UXIA 4MVJH 5CDUA 3WQRA 3W8FA 4YACA 3CXRA 3FNEA 2O2SA 1R0KA 3BYZA 3MWEB 1YXMA 2HMSA 3D3WB 3ONFA 3VH4A 5G0WA 1UXGA 2ZJ1A 3VKVA 5ITVA 3I5MA 3ZU5A 2C2YA 3MCVA 4TKLA 3OICA 1C1DB 3IIEA 3H5RA 3X2EA 4KP7A 1E77A 4BGUA 4D42A 1EZ4A 2X86A 1T2EA 4D46A 2Q99A 1UZNA 1ONPA 3L0DA 4DC1A 3FF4A 4FGSA 3DMTA 4GQAA 3T7CA 1WLYA 2BI8A 5B1YA 1QYDA 1V8BA 2JJYA 3JQ8B 5THQA 1PZFA 1EDZA 5EMHA 3VZPA 3KTDA 5IDQA 3I9MA 3KSDO 4XQEA 1EVZA 2VHVA 3ZWWA 2VYVA 3G0OA 1GAEO 3OJEA 4BL5A 1LLDA 4WGGA 4CM8B 2FPIA 2CDAA 3TRIA 4KWIA 1VM6A 3DHYA 2BGMA 3BMQA 3DZKA 1ISJA 4U0KA 4W99A 2HMWA 2DLDA 3IUSA 4II2A 3QE3A 5COBA 1BDBA 1MFZA 3GVXA 3BXXA 3E82A 3GPDG 4ZRMA 5F1KA 2GCGA 2HKIA 2BELA 3D4NA 1X7GA 4XQCA 3DOCA 4TRRA 3VH3A 3WSVA 3H9EO 4CUJA 1YB4A 4QECA 3ZCXA 4BO4A 1SB9A 4J0EA 4PG8A 2WYWA 4NBUA 5TF4A 4DLLA 3ORFA 1B26A 3EW7A 4RGBA 1U28A 3RASA 1D7OA 2UVDA 3WLEA 4BGVA 4BNGA 4YJDA 5F21A 5CDTA 4YTEA 1A72A 2J3IA 1FDSA 3FBGA 2D2IA 3LC2O 1HYGA 3WSWA 3N58A 4O0LA 1NQOA 3OEWA 1KEWA 5AXCA 4B4UA 2VRCA 1DRWA 3INRA 1G1AA 3I52A 5BSGA 1I2ZA 3JYNA 4ID9A 1KBZA 3SXPA 4FPXA 1SEPA 4IXTA 1MB4A 4AG3A 2HMVA 4FFPA 3DZGA 4GKBA 2O3SA 2X5OA 1KVSA
chains in the Genus database with same CATH superfamily
4C20A 1ZK0A 5L53A 4HYYA 3HL0A 4F71A 1SHKA 2H92A 2ORYA 3B1VA 4CKZA 2ZM6B 2DWPA 1GNVA 1NWHA 5I6DA 4Y1EA 1DLIA 4DR4B 1EAYA 1UQRA 3L06A 3O1HB 2H2GA 5CLLA 5SYAA 1SUPA 1FSFA 1R16A 1YMQA 2ZQYA 5EZQA 3PXGA 4TVSA 1JMKC 2FJUA 3OIFA 2FGJA 1FU7A 1N1DA 2W6IA 2XUPA 4L7VA 3VDRA 5KU7A 5ABPA 1O6FA 3ZY6A 5HA5A 3EF1A 4WLVA 1P2SA 2IYZA 4UAUA 3ACBA 1HUQA 2H1FA 2C1EA 4CIVA 3RFUA 1IM2A 4RY2A 1PSWA 4KPFC 3W4JA 1EXDA 4GM1A 1RQGA 4D80A 4R05A 5B30A 4LF8B 4JB3A 1PEKE 1ENOA 3IULA 1PWZA 4LVUA 1FFYA 4MS1B 3IBYA 4OKNA 4OLJA 2HADA 2F1IA 3AETB 4L28A 4P80A 3GNQA 1T6XA 4OFBA 4RFVA 3COPA 4DNOA 4Y2RA 3OT5A 3WKAA 5DNYB 3PUVA 3QTBA 3G0CA 1AUOA 1JQ5A 4K9OA 1ZDMA 1ZSVA 5HCIA 3H8WA 3U3ZA 4CNBA 3C3EA 4I5GA 5K3OA 2AR0A 2HHJA 2REOA 1W34A 1HDZA 4R1OA 4XIYA 5DDIP 5EY5B 4A0QA 1F2UA 2EHJA 3A6GA 1PHPA 1U4NA 1LDGA 2VSOA 1XZEA 2IY8A 2IZ5A 3QI7A 4FCVA 2YBDA 4W6ZA 2RG1A 3ZVRA 4F6RB 5LNK1 2YXBA 2OXRA 1G9TA 1NG1A 2C0CA 2P91A 2OD2A 2PGJA 1R3DA 1TCCA 1MR3F 1W5BA 1L3BA 1LNSA 2CCGA 1XELA 2WV7A 1PW5A 1TECE 3FB4A 3LQQA 4DLPA 3ZBQA 1Y6GA 5EWJA 3UJ9A 4HZIA 1WX1A 5F78A 1KYVA 5CNMA 5BWLA 1QHSA 2HK6A 2C97A 3PJRA 1L7MA 1NVDA 1XGKA 4U7GA 3W8NA 3VR5H 3O92A 2OQIA 3GFTA 3RQSA 2TMDA 4BFVA 1J42A 2G8LA 1IXZA 4GW3A 2XDWA 2W8ZA 1EMDA 2D2EA 3LWNA 4LTNA 2CBXA 3GLFE 1TZKA 3O0TA 1UKBA 4TV9F 2Z3ZA 1XTZA 1LDEA 4RE6A 3D2AA 2NZVG 3TEJA 2LGJA 4DM4A 5IM5A 2OZLB 3FYCA 4WINA 1K7CA 4QZVA 1U8AA 4KE7A 2CJXA 4N5HX 2AOVA 2WSMA 1C0EA 5KYNA 4JOQA 2H08A 4JFAA 3RUEA 4C4XA 2DJ5A 1NQAO 2CB9A 4L8FA 3O73A 1RBMA 1S01A 1UDBA 2YW2A 5EPUA 3KZMA 2C31A 2DQKA 4JI7B 2A1TR 3H9BA 1DBRA 1GLGA 4KXMA 2FSVC 2ZSJA 3A6EA 4IFIA 4PPGA 1CJTC 3JQAD 4QTZA 4BUCA 1YR1A 4D9JA 2R0QC 3CISA 1VHWA 3CT6A 3LD9A 3PENA 4MEJA 4JI3B 1X8LA 4XD2A 4AO7A 3BJRA 4U2GA 2VAVA 1AS3A 1QDEA 4LPKA 5GJCA 3HUFA 5DM2A 2PKEA 2X3YA 2YOGA 1W75A 2UVPA 3PPWA 2DOKA 1UR5A 4IUYA 2GEDA 4XD7A 2B1JA 4C6RA 9LDTA 3MS2A 3FUCA 1QYRA 2FKNA 2W5UA 1LLUA 1RI4A 3IKTA 4EAAA 2OCBA 1JPJA 1P74A 2DWCA 3TH5A 5FH9A 4RMGA 1AUXA 3F96A 1H4VB 2P3LA 1PX2A 3ZEAA 3CVWA 2YHIB 5TMDA 5K8IA 3WGLA 1GVHA 2C2HA 3LL7A 2YX1A 5FIUA 3SYRA 2XODA 1LW7A 4EZIA 1P2DA 3KJGA 1R0WA 3L4EA 1NUTA 1VL8A 2BFOA 5DGHA 5C7LO 1DO0A 3KYDA 8GPBA 3TG2A 1FJXA 3F7MA 5BY2A 3Q72A 4S1OA 2PSHA 3GJYA 2NO7A 3CT4A 1WXEA 3D0OA 4TZTA 5IDXA 3C6MA 5HIIA 2O9JA 2R86A 2YUTA 3OECA 3PL5A 3PVSA 4Q4LA 2OBLA 5GWXA 3AVWA 4UZSA 5LMCA 1HMPA 3OQIB 4FBMA 3VHQA 3V1LA 4IEEA 3BWYA 1C81A 2ZP1A 1I1HA 2EBWA 5KYYB 1JQBA 1GV1A 2FE4A 1GT91 1GNRA 2C7GA 2JAHA 3B2NA 4QDTA 3WMRA 3LV8A 2O1WA 3RS3A 4L0DA 2ZFUA 2WU1A 5I7OA 2XCLA 4QHYA 4MR8A 2I4IA 3T7DA 4BBJA 5KCMA 3HB4X 1A96A 5JSZA 1KZGB 1AQNA 4LTDA 3WNVA 1SOAA 3BRSA 2QTVB 3C3DA 4J29A 2YVLA 3TLAA 3TQIA 2F59A 3R4VA 4QBFA 4EENA 1FDUA 4IY1A 1VBNA 1KC3A 3UZUA 2XVYA 2BM0A 1RZVA 4I9FA 4YRKA 3S2UA 1GKLA 2GBCA 4GYWA 4F21A 1TGYA 2CLMB 2EFYA 3BE8A 3ZWMA 3DEFA 1CUSA 3AOEA 1ES9A 3NOOA 2EW2A 2NADA 2WF6A 3IKVA 4IJVA 5EESA 3DMNA 5T8KA 4ZI3A 5C4IA 3FPGA 2PL5A 4BUZA 3LPNA 2ZWVA 3ZNNA 4I66A 5JRZA 1DRUA 4HHEA 3OC6A 5HBRA 4IMIB 1NE7A 1UJ2A 1REQB 2VBGA 3CLVA 4URWR 3RI3A 2FN4A 1C7IA 5E4YA 1EM8B 1PVVA 4L4ZA 1A0OA 3FCSB 4MAFA 2HDNB 1KJWA 5A4MS 1Y8ZA 2RG7A 5KMGB 4L4UA 4I46A 4B79A 4ER0A 4ZJPA 3IR6A 3PDUA 3R5KA 4BRZA 3WB9A 3TDMA 3JQFA 1ZL2A 4KQWA 3DJFA 4Z51A 4MLPA 1L2TA 4OLHA 1WETA 5ILOA 1R74A 2IVFA 2YINC 3D6FA 2V7QA 1AG9A 3IDZA 3N70A 4FU0A 4RVSA 1P4RA 5DB4A 5A0VA 4LHXA 3IP6A 5TVKA 3R7WA 4B3SB 4P8RA 1QUFA 3OQVA 4V1CB 1P8AA 2Q1TA 1GZ3A 4HEQA 3A6ZA 2DBQA 2QQEA 2IYSA 2HU7A 2JKZA 1ORWA 4N82A 3RKUA 3EQZA 3QVMA 2GT1A 4U7JA 1U81A 4D9NA 4DCCA 2JCYA 4J91A 5A1JA 2JJQA 3EG9B 3FVWA 4Y6RA 5F64A 3ZK8A 2HEIA 1TC2A 4G24A 3AGPA 4OUDA 1WW3A 5F4ZA 3HJNA 2OAGA 1FFCA 4RL6A 4EX6A 3IO5A 1XTIA 3I9OA 2XD4A 3JALA 2RHHA 3D7LA 4HYEA 4NBNA 4NPCA 3V1NA 2O48X 2FXVA 1JYSA 2R87A 4RFLA 3A1VA 4IOMA 2ADOA 1AKRA 2P2NA 3LY9A 3ETLA 3BD8A 1E7WA 5A4DA 2P40A 2Z0MA 3NRCA 3WQHA 3QX9A 3TFQA 1ZUD1 1JU4A 4CMEC 2XGOA 1FP1D 4FFMA 3HDTA 2O3TA 2GK7A 1T6ZA 3F8TA 2FN8A 3N6VA 1W30A 4MV8A 3KOOA 2UYGA 2X6TA 3R9XA 1QG2A 4G0YA 1GU1A 1W4LA 3NJ8A 3OCUA 2CLIB 3OAAD 3M6FA 3LXUX 3STUA 2J7KA 2R85A 3I4CA 1FPQA 3Q88A 3NX4A 1FFGA 2CK3A 3EYAA 3ER9A 3THWB 1A5ZA 4LE2A 1SVOA 3CR3C 2X8WA 3GFBA 3GV0A 5FB3A 9LDBA 1Z0IA 1KP3A 4RK0A 1LPAB 3OZ7A 4EB0A 3T5BA 4O1MA 5C46F 3CTPA 4D96A 1M1YA 4I1PA 1JEJA 1G1MA 3HADA 3QLEA 2WKWA 1DTWA 1MNAA 1VP3A 2FW6A 4HH3C 5IARA 3UWDA 4KLCA 5DSXA 5E6RA 1EH5A 2QL7A 4YP7A 5KVQA 5I7RA 4FB5A 3NB0A 3LXRA 1EXWA 4OYYA 2XQIA 2FMFA 1J2EA 4DMCA 1Q12A 1BKYA 4INZA 3QBEA 5CK4A 3RJZA 2Q8NA 1NF8A 3TM4A 4YXWD 1NDHA 3V34A 3ER8A 3ADCA 1XYYA 2YJNA 3N05A 1HNNA 3ANMA 2XZOA 2GHTA 3HJRA 3CPSA 3E7DA 3Q1KA 5EAIA 1E18A 3ZD7A 5TQ2B 1RCTE 4CTNA 1D9ZA 3M6XA 2JFGA 4RVDA 4DYDA 1O97D 2Q2WA 3SHTA 1KA9H 3G59A 1GG2A 4HX5A 4LRYA 2J6CA 5DOVA 3REGA 3SEQA 3JAWB 3KSUA 4RORA 1TEVA 3KOMA 4LNUB 1IPEA 4KQHA 3VO8A 3B53X 3HKDB 5M29A 4WBSA 2R84A 1NBIA 2OM2A 1U0JA 3O93A 4IZIA 5L45A 5E38A 3DPIA 2MHCA 4NZNA 4I4IA 3DOOA 3VAYA 3ZPXA 1SHZA 2XE8A 1MOSA 4H4CA 5BYJA 1QF9A 2VHEA 3AUKA 1HYHA 1WDWB 4FILA 2AUMA 3EYWA 2PA3A 3CLTC 2GXUA 1FP4A 4BNUA 1RQRA 1J0BA 1AUPA 1TA9A 3ECAA 1S8OA 3OX3A 1ZH6A 2NUPA 4KRXA 3H65A 1EGVB 4PSKA 2JH9A 2P0YA 4QU5A 5AUPB 3T0IA 2A78A 4XARA 4D5GA 4RDIA 1ZAKA 4DV0B 5WRFA 4RVCA 2KM1A 1WHSA 3RG8A 2R97A 3A3OA 4KLNA 1DZ3A 2C99A 1TT5B 4M9ZA 3GLQA 4RF5A 1LJUA 5BT9A 1I6MA 1TCAA 1XMSA 2A3NA 3QU7A 5KYTA 3A37A 3IGFA 2V6BA 4DNPA 1XD8A 3R7NA 5KYXB 3SLKA 1F9AA 1KYQA 4DSTA 2UYOA 1NWCA 3NEPX 5K6RA 4GUAA 1X0VA 1QHIA 1W5EA 2DFPA 2RHDA 3E3LA 1CQIA 4IJUA 4RHEA 5HCNA 3E81A 5LLTA 1I3OA 1H2WA 5K3FA 2GN2A 3OM9A 1KKLA 4AMYA 3VYWA 1ACLA 2R4QA 4EKYA 5IBCA 7REQB 3LCCA 4DAEA 2XJ9A 5BRAA 2AJCA 1RFLA 3DBRA 2BMAA 3FPKA 1DOZA 4AULA 1FE8A 4IXMA 5TEVA 2YZKA 4GPTA 1OLUB 2RKWA 3VDMA 4IHAA 2NYUA 1G21B 1NJ8A 5H02A 4MX8A 5IMSA 3AWDA 5FX2A 4BKUA 3GRUA 1IPFA 2I5PO 4DA8A 4G1VA 4MQLA 2V74B 3RARA 5H4GA 2FLWA 5C0OE 1GTG1 3KSAC 1NKTA 5DHQA 1YJCA 3DMPA 4TV8F 2NT4A 2X5XA 2IE0A 2P6UA 4LJ4A 1O8CA 5D7NA 2XD9A 1S2GA 3Q2OA 5C5CA 5JSUA 3TQQA 1SUCA 3UAVA 4DIUA 2GZ2A 1EZ1A 1IH8A 3N8NA 4IMJB 3OOJA 4FDLA 3FDZA 5K0FA 2H18A 3HJFA 3G2IA 3K8QA 1ONBA 1CQJB 3L18A 3DNMA 2FF7A 4Y2UA 1CE8B 2VF5X 4NYMQ 3WWCA 1AY0A 2IZOA 1YS2X 1JPUA 1QORA 2CNOA 2E55A 3MCWA 4IQ0A 3ZYCA 3H87A 2OCYC 4YO8A 1T0HB 4MGYR 1XI2A 4F3RA 1Z5VA 1RM3A 3NJ4A 2VFAA 3B85A 2HWYA 1LV7A 3P9ZA 1QHNA 3HDGA 3QMVA 3IV7A 3QOXA 1E1YA 2C2MA 1MJ5A 1U2ZA 3I28A 1HNWB 3P9IA 1QHXA 3DV9A 4ZPXA 3G5MA 2VF8A 2DT8A 2WJJA 5BN5B 3TE6A 1P1HA 4A6XA 1JHXA 4JELA 1GARA 3UICA 1ESNA 1WUYA 3KYCA 1NNUA 4ABYA 4E5NA 3E2PA 3KXKA 5BSTA 2I2DA 3S5UA 1GYQA 3EMVA 1PF7E 3LKBA 5KNLA 4REMA 1K92A 3UUFA 4OYRA 4MGZR 4DZRA 1M7GA 3M82A 1UT6A 5DHTA 1OASA 1G5QA 3SDZA 1YRYE 3JQAA 1JTEA 3G0DA 2ZSKA 4D9BA 3VBCA 1FY2A 1E1NA 4ML3A 3DZJA 2QUJA 4NL4H 2ZRPA 4YAUA 5LFAA 5CEEA 2PD3A 2Q9CA 2JD2A 5CVCA 4QNNA 3M4ZA 5EIBD 2G8NA 3T5MA 4JB0A 2R48A 3DE3X 3N2ZB 2QTTA 2XTZA 3K16A 1AGYA 1MXFA 3N59A 2ETVA 3MOSA 1G41A 4BBZA 4ES6A 5JSFA 4QDUA 1ORRA 2OBYA 2PPLA 4QRIA 2H16A 4HYTA 5GM1A 4FLMA 3TRJA 1OAKA 2PRYA 3IELA 1GL9B 1LK5A 4LHEA 3RVNA 3UAWA 3THYA 1SWVA 2XITA 3KQMA 5F51A 3PWTA 3VSEA 2WJYA 1PX0A 3JWIA 1AQYA 1EWVA 5JMOA 2NQTA 1IEVA 2JAPA 3QVXA 4M88A 2PMDA 4BNIA 2OR3A 3BHIA 2O1SA 5GY7A 1IZ8A 1OIXA 3MS4A 1XVVA 1NIPA 1R7RA 1K98A 2AE1A 4FGWA 4DA6A 3E22B 5K8TA 1HSOA 2FZ5A 1PZGA 1U0OC 2QRUA 5LJIA 3ZVKA 4JL5A 1JHYA 3FD8A 3ABZA 3PNQA 4N5MA 4IOLA 4Y6GB 1QS0A 2C94A 4OHBA 4EMSA 4KAAA 2Z43A 4ZXPA 1SKUA 1XDBA 1KDTA 3GY0A 4MS4A 3DMTC 1JIJA 1NULA 5KNCD 4NCNA 3VA7A 3G2MA 2ZRHA 3FSJX 3DHWC 3N2GB 3NKVA 5DWQA 3WBJA 3CCCA 3HRHA 1ILWA 2ZTMA 2YYYA 4G01B 4KPGA 4H31A 4U4AA 3IQXA 4UNPA 1O1YA 3ESDA 4DV3B 2VJYA 1JJFA 3FETA 4P1ZA 4YROA 3DZ8A 5ERXA 4E32A 1LEHA 2LVBA 5BSUA 3D1JA 3GN1A 4RD0A 3ZY2A 4BXOB 4NE2A 3AR9A 3EEYA 1NXXA 2GHIA 1WTCA 4KQMA 5TT1A 4LZWA 3T5TA 2O2YA 3OCXA 5IJ0B 2AKEA 3FCAA 2V7WA 3KDSE 4L50A 2RGNA 4MCJA 2QT1A 1Y3CE 3QLTA 1H6BA 4OI4A 4TXMA 5LLSA 3O8NA 3RS5A 3HCWA 2RGYA 2II6A 1RLMA 1V0JA 4Q3LA 3WYFA 3GU3A 4F84A 1QQTA 1GM5A 4YQEA 2DFVA 3AINA 1L9XA 4NBKA 4LV6A 4PGGA 4RVHA 3WFJA 2JL1A 5IYZA 1CJSA 2CXUA 1TEZA 3QHAA 1NMZA 1LY1A 2BVNA 2EWWA 3PX2A 4GKVA 4OGLA 3FSGA 3RVPA 1XMQB 3TECE 3E9EA 4O4JF 5M34A 3F5MA 4C6TB 721PA 1FZQA 3TI9A 4R2MA 1B0ZA 1FFXA 1PR5A 2DB3A 3GAMA 2H17A 3HU3A 4MWOA 3PDIB 3RLIA 4PLVA 3UY4A 1IZ9A 2IGTA 5AK4A 5HWSA 3S3TA 3I2IA 3BSWA 4YGYA 2Z8XA 3VH1A 1AS0A 2Z2JA 1TO1E 2W2OA 3K71B 3QX3A 3NBXX 2NYAA 3VI4B 2MSEB 2A67A 4RVFA 1KI8A 4RSMA 5ERYA 4C04A 3DT8A 2WB2A 1TQ4A 2DJIA 3CLRD 2JFOA 4GI7A 5C1BA 4XM0A 1KE1A 2PH5A 1NF2A 4IIJA 4NONA 4ENRA 5B4UA 3BCSA 3O3NB 6ABPA 5LDGA 3VI3B 1DBIA 1YR8A 3DA8A 4KQIA 4B75A 5ECDA 2Y1WA 1BN6A 2Y4NA 3FMOB 1E1CB 4H60A 4CKWB 4CEHA 1VP9A 1RVDA 1HE8B 1KKMA 4RCVA 3RWBA 1CQZA 1QE0A 1NL3A 2IPAB 3JQEA 4UULA 4UVHA 1QIEA 5ECYA 3UENA 2BSQA 4HO1X 1V6CA 3GLFB 1GEGA 1RYFA 1W73A 2EQAA 1PZMA 2XT6A 4JNKA 4TZKA 4EWLA 3U16A 3HGQA 1RJWA 1E3TA 3FOCA 4CV1A 1UBKS 3ZQKA 3EUFA 1SBNE 1G18A 2YMLA 1TU3A 2X0JA 3VNVA 1D5CA 3TVTA 3R6LA 3O2SB 1NA5A 1PFKA 4ZWNA 2C4KA 1K7SN 3HEBA 3GW8A 1CEEA 3FPLA 3GT7A 4JT2A 2GN8A 2CHEA 4MR9B 4X3OA 3FR7A 4NE9A 4RADA 1N2CA 3UHJA 4AMGA 2IYYA 2FJPA 4MKIA 4BIMA 2ORIA 3R1IA 1PGQA 1BMFD 1I1OA 4PYNA 4FFBB 1E4EB 2GN1A 1BO6A 2EU8A 4U9IS 4BVGA 2V1UA 3PNYA 4CKEA 4P35A 3T1OA 4BO0A 4DSNA 4ZVUA 3RC9A 3HV2A 4FFNA 4CF4A 4D25A 1ULUA 1W4AA 3E2IA 3R20A 1Q7GA 4PPQA 5J2UA 4H7KA 3VPSA 5KQSA 3K9NA 1C1DA 1VSBA 3A3YA 1MC5A 1NRWA 4Q18A 1YS1X 3I9KA 4NOKA 1QZTA 4NI5A 4NZYA 4RJIA 4Q4JA 2XKKA 2HMYB 3L7CA 4RQAA 5LOVF 1IPHA 4JLAA 1CIVA 3OZRA 2ZBEA 3OTQA 3U4CA 2JF0A 1JNXX 2PLRA 2ZXFA 3K7EA 4CQMB 1C14A 3T3GA 5JFGA 3FVTA 4MI3A 4W5JA 5DX1A 1YZYA 3UGKA 1R27A 2XMQA 3LG2A 4G0QA 1BH6A 2A30A 2J0EA 1VPWA 2JGDA 4B76A 3EZ6A 2FW8A 2VNHA 4QREA 5F73A 3RBAA 5AKYA 3OAAA 2D7JA 1AUQA 1LBSA 4LSMA 3T1VA 5C4MA 2X4IA 3EODA 1ZG3A 3QMPA 4D9KA 3UJCA 3RYCB 1RJDA 2W4QA 4M60A 5AOAA 1PIWA 2J45A 2UUAB 2B20A 2I33A 2X6RA 3ASVA 2VF4X 4PHCA 2UYQA 1GPWB 3MMXA 3T61A 3DC2A 3STHA 1HRKA 4RA9B 1SQSA 1CJMA 3A28A 3RNOA 2ZLBA 3MCAA 1T4MA 1U7DA 1WB9A 5K2OA 3OPXA 3MILA 3WNBA 5JPIA 2SKCA 1KXZA 1AXRA 1D1SA 1ZL0A 2XF8A 5HTKA 4FMDB 1L7QA 4C2AA 4AY2A 1FS4A 1MUUA 3EBLA 4CLOB 1PQWA 1E5XA 1PVDA 2BJWA 3L93A 3PUJA 4JJKA 5LP6C 4WUVA 1M7BA 1T1SA 1U3TA 2JLBA 1F8FA 5DGDA 4U8GA 2AF4C 3RC2A 1WD5A 5F3WB 2CL6X 4XEHA 1XZMA 3BFKA 4Q9NA 2WG2A 2YJ3A 4YXWA 4B4OA 2CVFA 2OM6A 2QL5A 4F2GA 1Y5IA 3G8AA 4UM7A 1IMJA 2GX6A 3JD2A 2VZEA 2BUBA 4M9CA 2BFDA 4I4TF 2YXEA 3E9MA 3HBNA 3OIGA 4OCZA 4B3XA 4W1RA 1CRQA 5FPHA 4EATA 1Y4AE 4KE8A 3ZDYB 3RVBA 2V0NA 1FUUA 2WU0A 3MJRA 5MHTA 3CMCO 1U8TA 2X4GA 2ZIXA 3NWBA 2HYIC 3OC0A 3K2IA 1VCOA 3CB4A 1A9SA 4NEQA 3FR8A 3MBKA 7YASA 3HJAA 5GOTA 2X22A 4NYJQ 4V0QA 3CLHA 1FVXA 3TWOA 4C0KA 2WIKA 3K4PA 4V0KA 3GMSA 3PE3A 3GGPA 1WL8A 2AXNA 4TLAA 4DBVO 1RYHA 5JVDA 1QVVA 5KDDA 2W2LD 4QXPA 2QVCA 2X0IA 5BVGA 5EJ4A 3I5YA 5IULC 2CV1A 2HA0A 5GJBA 1E0DA 2IEDA 3FYUC 4E22A 3E3NA 5B1HA 3FXAA 4AM8A 3QH4A 4JYAB 3TGWA 2WSSD 3MYYA 4A8PA 1Y4SA 4ACAA 2EVWX 5BUQA 1EFKA 1GZ4A 1SVSA 2W48A 3ND8A 4PZ9A 3MRTA 1RC8A 3SBDA 1MP0A 1R6AA 1SUIA 3FKJA 2C95A 2VP0A 5DH9A 4D0LB 3VSAA 1MX5A 2HGZA 3WIBA 1T6BY 2Q6LA 3S8YA 3GK3A 3A1NA 4AJKA 2MR5A 3VTAA 3IJ5A 3TDKA 5ARDA 4BCCA 2BD0A 5AI9A 3GJTA 4RJKA 2AOXA 4PNZA 2HBQA 4GDFA 1VJCA 3SN6A 1GPKA 1PEYA 1RYDA 4O2AF 3PC3A 1ND6A 2GEFA 4ARSA 4PFKA 3HXMA 4YPFA 2A3RA 1RQPA 1Z74A 2EX0A 2I7VA 3FWHA 3LBNA 5FQOA 3N2LA 1E1KA 4ZV4A 3OTIA 4YEDA 5EYPB 4ZTUB 2YNMC 3LGSA 3OU7A 4KGXA 4BZWA 4DMLA 5I51A 4MS1A 1E7RA 2BEVA 1PD0A 2OKCA 3L41A 3QLVC 4YRGA 4O4JB 4AK9A 1UBCA 3AETA 4OHVA 2IY7A 1L5NA 1CKEA 3AVTA 1ZJYA 2P9QA 2XAUA 2PR2A 2GAAA 5CJPA 5FUMA 2Z57A 1WSAA 2B1QA 2AWNA 1IQPA 2HQ1A 2HCFA 3ABOB 1FBNA 4UARA 1JNYA 3B3QA 4LXTA 2BEWB 3F6YA 4JVSB 5FL3A 3CNLA 4C7VA 2O2IA 3QV1A 1G8HA 1KOJA 1BJKA 4F6RA 5B6IA 4ZDWA 4ZOBA 2HDOA 1E2LA 3A9RA 1O95D 3G6KA 4GVXA 3EW9A 1EGQA 1P29A 1XTUA 4X45A 1NMEA 1G20B 1LPPA 2VK4A 3H0KA 3V32A 3IIJA 4ZJUA 3H7IA 3H5AA 2COKA 3C4JA 1RLUA 3EIQA 3NH9A 2GDJA 3O8LA 4NQRA 1LFAA 1OV4A 3GAZA 3BGOS 3SIXA 2OP0A 1D5WA 1OZ0A 2J0UB 2XI4A 2FWMX 3SOPA 1D2AA 4IGEA 4BVEA 3ELYA 3I2HA 3LIPA 1ZH0A 1PR1A 2CKMA 5FOTA 4DIDA 5CVUA 2BUCA 3KQLA 5A3SA 5JE8A 3AOEC 1VGRA 3AJ9A 2PANA 3UXMA 2P78A 1A9YA 3N7UA 3VHLB 2IPNA 4C1BA 2OQVA 1AU9A 3OA2A 4FYYA 2XGMA 4OQYA 1X9GA 4IFTA 2P77A 4OJKA 5ALFA 3OURA 1RAIA 3JWEA 3MOIA 1PWXA 2LUOA 1UBNA 3IDQA 3UAOA 1QV7A 3TR6A 4FBLA 2OZLA 4GAEA 3T34A 4M53A 1HDRA 1R8YA 1WMDA 2D0OB 4U3JB 2BMFA 1M66A 2YVKA 3R7LA 2PX2A 2XMRA 4REQB 5EMNA 4CIWA 4BLTA 3D31A 3E7XA 3W4IA 4XIGS 2QP9X 3DDOA 5L7TA 4XCXA 4N5IX 3D2CA 4EY7A 1X0XA 5K3SA 5KKAA 3D8UA 3O4RA 2FPXA 2O3QA 3IQIX 1MJNA 1WXWA 3K5WA 4GOND 2FLVA 4R68A 4UTXA 5CPFA 4YVFA 3SF0A 3T3IA 3VC2A 2Y76A 1WE2A 4D8VA 1UK6A 1ZW6A 3ADPA 3HB0A 1B6GA 2P68A 5E9QA 1VHLA 1IOVA 4LJKA 4Q3BA 3NVDA 1TLTA 1MZVA 3TRDA 2VHUA 5A9RA 1BG6A 3N0XA 1FFWA 2C77A 2KHZA 2ZT8A 5FOSA 3KFLA 4S0XA 3SXUB 4EPRA 5HOQA 1A8HA 2G88A 2G9QA 4JVLA 5MFZA 3L6DA 5EKXA 2JI6A 4ZVVA 5CDYA 1WNFA 4YA6A 2OBBA 5KTRA 4WNAA 1IBRA 1S0UA 1F0PA 1GCAA 3AHJA 4MKGA 2O0LA 4J43A 3CVOA 1C80A 1ZM7A 4A1FA 2YHIA 2ZIUB 2I87A 1C7QA 1E2PA 1KY5A 2HSZA 4YRLA 1DPGA 3O9ZA 5D3MA 3CZPA 1CVIA 3A27A 1KZ4A 1H66A 1GQRA 1K27A 3IBFA 3IDFA 2DFDA 3EGWA 2VDUE 4NAVA 4MV3A 4YI3A 3NBQA 5KNCA 1N2EA 3MPUA 2UXCB 3GT0A 3P0HA 3UPTA 1RW4A 2BMVA 3T3HA 3NUZA 3MERA 5HX7A 1E2UA 1V1MB 2NO4A 3KKKA 2F1JA 2VQ6A 1R6TA 2PRSA 1XK7A 1W88A 2XUHA 2L18A 5C1IA 3W8RA 3M7IA 1JXMA 4GXTA 2GERA 4IIBA 1P39A 2WD9A 1YOBA 3DB1A 2QAIA 1JEDA 2Y1EA 1EGHA 3OQIA 3PGMA 1V1JA 2EBFX 1EGAA 1SD5A 2VC2B 5EMLA 4WZAE 5CGQB 3PGXA 1Z6YA 4TTQA 5C3UA 5DM1A 5KYYA 2X2PA 2G08A 2AZDA 1OWMA 1D0SA 2YWHA 1CEXA 3G2KA 3MTDA 4G5XA 1L5HB 1NF3A 4HQFA 4JLMA 3T15A 5MGBA 4E0BA 3KUCA 4LF7B 5H3CA 3B2QA 1ZR2A 1WXXA 4XYBA 4C88A 2J3LA 1Q91A 2PQ0A 3NXKA 2IKQA 5FOQA 1P6UA 1NVWQ 2QTVA 2AVNA 4BOYA 4GVLA 1GFIA 4HDCA 2FQYA 1A3CA 1JJVA 3DLCA 3E5RA 1L6IA 3G02A 4YV0A 2XIQA 4GQIA 1P33A 1L0BA 4HPWA 3SJAA 2I2FA 3X1DA 2HIAA 1XE3A 4UNSA 4WT7A 1ZCFA 4MDYA 3S0JA 1JBEA 3V7NA 4YDHB 4G1UC 5AVOA 3ET4A 3SC6A 4EW1A 3NHMA 4QARA 4G67A 3UMRA 5E2BA 4UCXA 1RBYA 2CXXA 2I2AA 2IP1A 3F98A 4UFPA 1SURA 3ZWBA 3GFPA 4KN8A 1RR6A 4WJZA 1UDWA 1A4XA 2AG0A 2W2PA 3X0DA 1GV0A 3RVQA 2X0KA 1YOVB 2QE7D 1REQA 4TS1A 3U4AA 4BVLA 4C4SA 3PX7A 4AMUA 1FXSA 5AVQA 1EM8A 4UEQA 5LR6A 3B20A 3EEQA 4GLLA 2OV3A 2PFKA 3HVUA 4O02B 4XM2A 2NUAB 1J24A 1GNQA 4FMCF 3HY6A 3CBQA 4PR0A 4ACBA 4YT2A 5KMGA 5T7BA 4N3AA 2QMUA 1ZMTA 1M1ZA 1KAEA 2BFCA 3WHPA 4GMDA 1FNDA 2Y1CA 1B16A 4WKCA 4AKEA 1GO2A 3D3KA 4O2AB 1KH2A 4RPLA 1DEOA 1XCLA 3IUMA 2PGNA 5LZ5A 5EIOA 3RJMA 1QGOA 1CUBA 2FPGB 1KPHA 2J3HA 2C0QA 1X74A 2XQKA 4WDQA 3DONA 2VZ8A 1Y33E 3PFNA 2RAPA 4LYEA 3K2QA 5LDDC 4V1CA 1QMGA 1GCGA 4LCJA 1DJQA 5FULA 1VXOA 4FEYA 1J0EA 4RIHA 2R8EA 3GFRA 4IO1A 5L4NA 3AOGA 1L4MA 3H8JA 2C42A 2QP4A 4KSYA 3K05A 3QVWA 2BFBB 2ZS9A 1XCJA 3GXOA 4O8ZA 5FXMA 1BMFA 1LWOA 3E9YA 3NHKA 5C5EA 2PX4A 2X4LA 3ZS9A 2I7TA 3L1IA 3DDHA 3EG9A 3O21A 4ND5A 3ZIDA 2O06A 3FZGA 2VWGA 1RM4A 2YXPX 1E63A 1NOJA 2P11A 1G6OA 2ZKLA 3A1UA 3BXOA 3D3QA 3GRKA 4G25A 3URMA 4A10A 2F3QA 1TMKA 3O90A 1I9CA 1J56A 1YJAA 2P79A 4WDRA 4KVFA 3TB4A 3TOZA 1YR9A 5J58A 3FX2A 4RWEA 5DCWA 5CURA 1VHQA 2V65A 1P1KA 2PQ2A 1YRHA 2XDAA 4J8PA 5JAHA 2IPXA 2ZRQA 3H9QA 4ZVQA 5JNUA 2C0PA 2PZGA 2QI9C 3ETDA 2HK8A 2GBFA 2OHGA 4K88A 1H69A 3UMGA 5B7QA 4B0PA 1JKIA 3ED1A 4CQMD 2EW8A 4YASA 1QANA 3JS5A 3R3VA 4RK7A 2WJ6A 3H2GA 4K0KB 3LBHA 4AVYA 2GCOB 1G55A 2AMFA 1HEIA 1OXSC 2BFPA 2GETA 2GZSA 5FBZA 1WQ4A 4HQRA 5FBHA 3AM4A 1PJZA 4G5RA 1AVTA 1QRDA 1ZNWA 5EP4A 3OQOA 5BR7A 1NU8A 3GHYA 4CKYA 4CGZA 2QV7A 2HWKA 2WE8A 4HX2A 4RXTA 1LQ2A 4ON9A 4YUAA 5CHYA 5JARA 2Y2UA 3THWA 2JEZA 2DQYA 2H9YA 5CH8A 3HRIA 5M04A 1C8KA 3PJGA 5CAEB 5B7PA 4D3DA 2J4CA 2JIPA 1D2RA 2OFPA 2JIRA 3EEBA 1HO3A 4PNPA 4EP1A 3K9GA 2C3OA 1VC2A 2X0RA 4J0KA 5TVGA 5IJWA 3P0JA 2QWXA 4BS9A 2QR2A 3HXLA 3ULKA 1EWRA 2A84A 3SZLA 2XLCA 3DNPA 4BZQA 2X1VA 1V11B 4LHYA 5IBQA 3RANA 2WHPB 4M1KA 2MYPA 4YGXB 1CEQA 1UMCB 3QIAA 2WICA 3SC4A 3F3MA 2P62A 4D0RA 4OXRA 2ZI5A 4ZVTA 4JVNA 3FOEC 2Q5LA 1UAGA 3DFKA 1ZY2A 2DXIA 1L4GA 3DOEA 2LW7A 3Q0TA 4MQBA 4PYKA 5LDHA 2HLNA 4QBGB 2GOYA 4UOZA 3HVRA 3NP9A 2QR3A 4RD4A 1H85A 5LC1A 3C5VA 2UUPA 2VCYA 1VKOA 3FTCA 1PQYA 1X2BA 1OC2A 2ZSFA 4JR0A 3SX0A 2HGSA 2CJPA 1VE7A 2QN9A 1B41A 1A69A 1HT2E 4CG1A 2BMWA 4P38A 3V4SA 3LXMA 4MPDA 5L4SA 2K7FA 3IKMB 5TQ2A 1DKPA 2BONA 1N5JA 1SVNA 2BGUA 1CCWA 3AV3A 1NUAA 3NM5A 2DF8A 3B9QA 1FYWA 4KE6A 3SBOA 1L4BA 2ISCA 4DCPA 2B69A 5DF1A 1LX7A 1QHYA 1NJ5A 2H52A 2YVUA 3INTA 3WGKA 1Z16A 4GX0A 5IDQA 4RTJA 3JAWA 3MUEA 5UKDA 3WYCA 1NN1A 4OL0A 2C03A 3HKDA 4DE5A 5C35A 1U2EA 1U2GA 1T0JB 1HG1A 4X61A 5KJEA 1BYUA 1BDIA 3T9AA 1YAHA 3VDNB 4ALMA 4V0NA 4KE9A 1J5PA 1Z29A 3D0KA 4C05A 1GKKA 4PG6A 4KFSA 2ZWMA 2ZCUA 3GBVA 3ZWYA 4C0QC 1TQDA 1X7XA 1DELA 1V6AA 1ZI8A 2XGGA 3RYFB 3VOBA 3K31A 4FUTA 3RCBA 3IL2A 1GPMA 1NPYA 1P2GA 3EGIA 2KS6A 1N1MA 1OKKD 1GLVA 2W43A 3L77A 4LZAA 4TXNA 3RSQA 3ZOKA 3QEJA 1VB3A 3NDRA 4ITRC 4CKXA 1P0CA 2D1TA 4N54A 4MB0A 3CF6R 3KC2A 2HUNA 1HM5A 3LUBA 3SVZA 2WC1A 2XT9A 5JYEA 4XGKA 3B9PA 3D7SA 1TT5A 3NIGB 5BVHB 2FWRA 4CVNA 3FVQA 4C3VA 2PZKA 2YOHA 4NNJA 2FFAA 4MUBA 1MV8A 2B6HA 3OE5A 4E3ZA 5KYXA 3EE6A 1XPRA 3Q98A 4K6CA 5M5BA 2GJAA 1WCXA 3WGHA 2PNFA 2ZRBA 2O0JA 3VMMA 1DQPA 2Y0PA 2H7XA 1ICEA 4HAXA 2VG8A 1DAGA 4L08A 4Q39A 4PO9A 3OKAA 4UU1A 3DF9A 5GJWC 2IZZA 5JAZA 3COYA 3TFOA 4OYLA 2V5UA 2OCDA 1EDBA 3EARA 3IAFA 4C7MA 1T26A 4BN0A 5F9FA 1CR1A 4JGBA 4BX0A 1RLOA 1QO0A 4HN9A 1EWQA 2ADFA 5BNZA 1MX1A 1OLUA 3OESA 3ZIUA 4JQCA 2HO4A 3ESCA 3JQBA 4KTTE 1G21A 3ZDEA 1XU9A 3L9XA 3MYRA 1ZRSA 4LHZA 4A03A 4C4PA 3V4VB 4M4SA 1NF9A 1W8IA 4ZO9A 4WN3A 1U31A 1P19A 4EMBA 2ZRKA 4HVLA 1BRTA 2B0JA 4X41A 3L7JA 1DV2A 1GUBA 2HJSA 3ASUA 1TZJA 1MIOB 1Q95A 3K1ZA 1VLHA 3KZKA 4Q9JA 4F6LA 3VTKA 4RKYA 3WK9A 2XX3A 3KKPA 4TMXA 1UWKA 2YMQA 2NU9B 1Q84A 1T8WA 1SZCA 3PGKA 4O2BB 1CP3A 4JI0B 2QU8A 2ZWIA 4L9SA 4O5OA 2CL0X 3CRZA 1JJBA 2VJLA 4RDHA 3EC2A 5ALYA 1CQJA 1VPTA 1Q22A 3CKKA 5ESXA 3RB8A 3TUIC 4S24A 3PXAA 3QJGA 4IDPA 3H05A 1L4LA 4IINA 3NAZA 3S2FA 5IUJC 1H1DA 1CR0A 1I3CA 1DLJA 5F1PA 1JLSA 5H82A 3ABQB 3NCTA 4BP9A 2VDNB 3IP1A 3PUXA 4EB3A 3H18A 1G60A 1XLWA 2COUA 2ODAA 4Q7EA 2IUUA 1JS1X 2D0PB 4IHJF 3ZNQA 3EZ2A 4PLHA 1EWTA 3MWDB 3C41J 3DQQA 2IYQA 3MWJA 5AK6A 4EKEA 1HKHA 5BN5A 3E0XA 3MTIA 5DLPA 3UOWA 1RRCA 4J2OA 1CUAA 2NG1A 2RK3A 2WR8A 3D6HA 1LDMA 2HJRA 4ZV7A 5IKXA 1MAVA 1VLZA 821PA 3PJDA 4CMGA 4OKIA 2W2KA 2I4RA 2O05A 3DW3X 3QMWA 3X44A 3V7UA 1QHGA 2A9JA 4NJMA 2DPHA 4DTIA 5JWHA 1X9IA 4ZVPA 5LZ7A 1WDKA 3K2EA 1Z6ZA 3P2YA 4YAGA 1HE4A 3U17A 4A0RA 4F60A 1QU3A 1DFGA 1SAYA 1QZXA 3Q7SA 1VDMA 3GNLA 1X9HA 1I7LA 4TMKA 1YC2A 2PG3A 5C7YA 2QRVA 2Q1UA 1X1CA 2JLSA 2RHBA 4LJSA 1FQWA 3QM1A 1JA9A 4ZOAA 1JALA 2ZIWB 1RYEA 2CLHB 3GGGA 2OGSA 3NEJA 1CY6A 2Y1DA 4FYIA 3BA6A 2XYRA 5HKBA 5KCZA 1KEKA 1K3FA 1QRRA 1ZZEA 3PVZA 4IJ6A 4PFQA 5HF9A 1ZONA 5LM3A 2YMMA 2FSUA 4FX2A 2X40A 3WL7A 3IA2A 2VPYA 3HHPA 4ABTA 2Z04A 1U7UA 4ND1A 1TQHA 2PX3A 3QMMA 1YZLA 3P9KA 1C9DB 4OHFA 3E22A 1I6WA 1VIMA 2GZ3A 5C5DA 2BCEA 1O0SA 1V39A 1CV2A 2ONZA 1HQKA 4R9RA 1H2FA 4NZPA 5D01A 4BO5A 5IUNC 2FETA 5AHKA 3KJXA 1XZPA 3C3XA 3PQDA 1VHDA 1KAHA 4IEIA 4JP3A 4PC6A 4RHTA 3WR5A 5BSKA 1MPTA 1SHUX 3C39A 1PYGA 2XB6A 2GAJA 3N2GA 2RJNA 3KTFA 3S29A 1Q0ZA 3SSOA 1QK3A 3P97A 5PNTA