2RH8A

Structure of apo anthocyanidin reductase from vitis vinifera
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
328
structure length
312
Chain Sequence
b'KKTACVVGGTGFVASLLVKLLLQKGYAVNTTVRDPDNQKKVSHLLELQELGDLKIFRADLTDELSFEAPIAGCDFVFHVATPVHFIKPAIQGVVNVMKACTRAKSVKRVILTSSAAAVTINQLDGTGLVVDEKNWTDIPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPTLMAGSSLTSDVPSSIGLAMSLITGNEFLINGMKGMQMLSGSVSIAHVEDVCRAHIFVAEKESASGRYICCAANTSVPELAKFLSKRYPQYKVPTDFGDFPPKSKLIISSEKLVKEGFSFKYGIEEIYDESVEYFKAKGLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthocyanidin reductase
molecule tags Oxidoreductase
source organism Vitis vinifera
publication title Structure and epimerase activity of anthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
total genus 112
structure length 312
sequence length 328
ec nomenclature ec 1.3.1.112: Anthocyanidin reductase ((2S)-flavan-3-ol-forming).
pdb deposition date 2007-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rh8A00
4URFA 2X0IA 5DBIA 2DBZA 2ZB4A 1I2ZA 1R4MB 3IAHA 1ISGA 2Q1SA 3DHYA 2DAPA 3STHA 4IDAA 3A1NA 3AW9A 1DOHA 1B14A 5TQVA 3FBTA 5A9SA 1EBFA 1W0CA 4HBGA 3RUDA 2OOSA 6ADHA 3PHIA 4J1NA 4XQ9A 1IPFA 3BZUA 4GH5A 5JY6A 2J5QA 2O3JA 1J49A 1WAMA 1R0KA 1HYEA 3OHSX 5DBFA 2ZTLA 4NFYA 1O5IA 4A10A 2OL4A 2O3UA 4CMAA 1PGJA 4FC7A 1XA0A 3NT5A 3TFOA 1UP6A 2FP4A 1PJCA 3G1TA 3SLKA 2NWQA 2VHWA 3E9MA 4KDEA 4QSMA 5F3RA 5AVOA 3TL2A 3O26A 5CAEA 1OAAA 2ZJ0A 3L4SO 1SMKA 2VT2A 4DRYA 1PZEA 5BSGA 1YE3A 2CNBA 3WQQA 1YOVA 2YDXA 1HDOA 3E9NA 2OP1A 1FDTA 3W8FA 3WYBA 1E1LA 4XGIA 4WGGA 2VRCA 3G79A 2EHDA 4ND1A 3VVBA 3W8EA 3WLEA 3RSHA 1MC4A 1DBVO 4QO8A 5HA5A 2WYUA 1PU2A 4XA8A 4XIYA 3ZHBA 1YL6A 4BNIA 1U3TA 1A5ZA 1O9BA 2Q3EA 4NZ9A 4AJ1A 1DHTA 1LLQA 1YB5A 1DRWA 1OC4A 3RUEA 1I2CA 1U7HA 4GWGA 1Y8QA 3DHNA 3KB6A 2FPPA 5JAQA 5G0VA 1PL6A 3ZWXA 3HWRA 4OKNA 4CV3A 3KSUA 3AI3A 1HDGO 3QWHA 5EMHA 3AM5A 3VC7A 4DQVA 4H15A 3K2BA 4OXKA 4GVXA 4TROA 4CUJA 4GVLA 4CL8A 5FI3A 1YH3A 1I10A 4AG3A 1F8FA 4IDEA 4YAIA 2WTBA 2XAAA 4IZHA 1XIVA 4NFHA 3HJAA 5A02A 2VT3A 5LC1A 5JDIA 2NTVA 4OSPA 2CFCA 3H65A 3ST7A 1HXHA 1WVGA 3PQEA 1SB9A 3VH2A 3C24A 2IXAA 3ON5A 3DTYA 2PGDA 4ALKA 3PIDA 5F1KA 3RUHA 1H2HA 5JNLA 3ULKA 3SEFA 5K0ZA 5BT9A 1PGPA 3KZVA 4XRGA 4P4NA 4XWYA 3FTPA 5U9CA 1WP4A 1EUCA 1BW9A 3L07A 4XEHA 5B1YA 1A7KA 1LTHR 3F5QA 3DZIA 2C7VA 1IHYA 3WJAA 3WJ7A 4X54A 4MDHA 4GKBA 3GG9A 3ASVA 1E7MA 1P45A 3GHHA 1PJQA 4KWIA 3RC7A 4J4BA 3HADA 1PGQA 4FD3A 1SEPA 3TL3A 5KWEA 4E12A 3TSCA 2BH9A 4XDYA 4E5KA 4IDGA 1MUUA 2FR8A 5ENDA 1UZMA 2ILTA 3KYCA 1MFPA 1IULA 3OIDA 1PJ2A 3OQ1A 4N18A 3I9JA 4ZVVA 4IMRA 3IP1A 1SPXA 2Y1DA 4FSHA 4II3A 3TRIA 4ZHSA 2D1YA 3F6YA 1HYGA 5KVSA 4BNJA 1GQ2A 4CQLA 4MKZA 4IDDA 4K26A 4L8VA 4DIBA 4E13A 1YO6A 3FPLA 5KIAA 1LC0A 1ZXBA 3Q0EA 4DYDA 5KVQA 3I1JA 3KV3O 4R1NA 4MIOA 2B69A 2VQ3A 3JQ7A 3E5RA 3INGA 2EKPA 1Y9EA 5TIIA 2FZEA 3ZU4A 1RYDA 3PFWO 4FDAA 2RIRA 2X9GA 5DN9A 3ZWCA 1GYRA 2X0NA 3BYZA 1GPJA 2DKNA 4R1TA 4R69A 2RHCA 4D0RA 3BMNA 4CLOA 1V9LA 1NR1A 3RWBA 1V35A 2EKLA 1U2GA 1R16A 3AUUA 1VM6A 2JAHA 1LU9A 3D4OA 2PD3A 3UOGA 3AUTA 3I9OA 2FOIA 4CLRB 4J0FA 2DQ4A 1DRVA 4R3NA 4F3YA 3JYLA 5TGDA 3FN4A 3WSWA 2DPGA 4XDZA 3VOSA 4AICA 3R0IA 3WB9A 4IBOA 1HETA 2JFGA 4XX0A 5AXBA 4RVGA 4UUOA 3UICA 1UR5A 1GTMA 1E77A 4JLWA 1F8GA 2YYYA 1MA0A 3KEQA 4PG6A 3UF0A 3RCBA 4MVJG 1GR0A 3KYDA 3WLFA 4B3HA 4RJTA 3PJFA 1M2WA 3B20A 4D7AA 4JP3A 4YRAA 4AJ2A 1OZAA 1DIBA 4E32A 1EUDA 1Y8RA 2PZJA 3HHPA 3DDNA 3V2GA 5B4VA 3SC6A 5H83A 4HADA 4LK3A 4C7JA 2D2IA 1Z45A 1LJ8A 3MTJA 4J9VA 3RASA 3NKLA 3OP4A 2X1HA 4Q9NA 1L1FA 1E7YA 1PWXA 1DLJA 3WGOA 3HDYA 1T2FA 3FNEA 3GFBA 1HE3A 3KYCB 5A4DA 1AHIA 3DC2A 3NDIA 2JCYA 2JFHA 2VYNA 3E9QA 4MVJE 1KIFA 4RPJA 3RU9A 1U8XX 2X7HA 3GA0A 3PDUA 3IS3A 2PZLA 1EK5A 2GZ1A 3GUCA 1Q2XA 3PHGA 3DZGA 3RIHA 4IGEA 3HFSA 3HZZA 1I3LA 1YQGA 3A14A 4IS2A 1Y5MA 2B4RO 2CVOA 4IPTA 3F47A 5CEEA 4PZCA 2O3TA 3GQVA 3QVOA 1KVTA 4FOSA 3OEYA 4XYEA 4AJPA 4EDFA 1Y8QB 3AOEC 3ETDA 3JQAB 1ISJA 4MKXA 1YS4A 2YQ5A 4CM4A 2PD6A 4YWJA 2PGJA 4YB8A 3FD8A 4AJJA 2BD0A 1HKUA 2FN7A 2D0IA 5KJEA 1HE4A 4YJFB 3TJRA 4AJNA 4RDIA 4AVYA 1R4NA 4LN1A 4NH4A 1WZIA 4YJHB 3NTOA 4FS3A 1PTJA 5ENVA 1RJWA 2O48X 2W90A 1CQIA 1H93A 1QLJA 2DTXA 2H63A 3BMOA 3ZI0A 3ZZNA 3KYDB 2D5CA 4WE3A 4CR7A 4YJGA 4NBVA 1PQUA 4EUHA 3TPCA 2P5UA 1R12A 3AM4A 5I9LA 4YJFA 4AJKA 2D59A 4FBGA 2OORA 3MOGA 4YPOA 2C54A 2QYSA 1GV0A 4KDFA 3L6DA 4I5DA 2YHIB 1E7WA 3G49A 4GL4A 4PGFA 2OFPA 1E5QA 3KTDA 5TNXA 1YXMA 1P74A 3DAPA 1UXGA 4XZ3A 4RGBA 1YGYA 3WIEA 1HL3A 4CLRA 3JQGB 3JYPA 3AM3A 1B3BA 1V6AA 1PL8A 1K6IA 1HWYA 4Z9YA 4BO8A 1UJMA 1X15A 1HSOA 2HRBA 1C0LA 3HB4X 3TZKA 4RZIA 2QZZA 1Z74A 4OIMA 3RFVA 1VC2A 1DFGA 1QG6A 2OBNA 4PN3A 1G6KA 4TWRA 3MJ4A 3F9IA 5T57A 1ZJYA 3F5SA 1NP3A 3DOJA 4CV1A 5JY1A 3MZ0A 3ITKA 4XRRA 4CM4B 5L4LA 5AOVA 4TVOA 2VTDA 2A94A 4JJFA 1CIVA 4PG7A 4Z9XA 1NR7A 1SOWA 2DM6A 1WDKA 4HFRA 3W4JA 4J3FA 4MIEA 1X0XA 2JHFA 2NU8A 3WQRA 1ZMTA 3IIEA 4S1VA 3A28A 2HRZA 2B4TO 1BVUA 4I9NA 4R16A 1ZMOA 5CFZA 1EFKA 4Q3EA 3AU9A 4W4TA 3DQPA 2BGKA 4NMHA 2UUOA 3HDQA 1UP7A 1EUZA 4MJLA 1KEPA 4XYBA 1E3JA 4Q3CA 5L45A 1RWBA 4B4VA 4BV9A 2CVQA 4NIMA 1PEDA 1NXQA 1VJ0A 4E5NA 4N5LA 5MDHA 2YUTA 3DWFA 4WLEA 4ZGWA 1BVRA 2ZIZA 5I9NA 3QVTA 3U0BA 4JROA 4MVJP 3B1JA 3WGQA 2CMDA 4HNHA 3GH3A 4A73A 4LRTB 1E1NA 3AWDA 4QXMA 1IPEA 1BG6A 2NVWA 3I6IA 4YACA 5G0UA 3EY4A 3OETA 4BNZA 3AUSA 4DVJA 3F3SA 1DC3A 2W2LD 1KVRA 4J7UA 3HG7A 4OOEA 5CHEA 2WYVA 5F1PA 1HLDA 1GQYA 2B5WA 5HS6A 4DXHA 2ZTMA 4YJGB 5DF1A 1WWKA 1YBVA 3KUXA 1C1DB 2PH3A 2X5OA 3JYQA 4BKPA 3G0OA 4JBHA 5DDIP 1XELA 5DCWA 4GLLA 4A2CA 3FWNA 4W7IA 3WS7A 1JQBA 1EBUA 2VYVD 3WFIA 6LDHA 5LCXA 4NI5A 4Z9FA 4NDNE 1NX6A 1X7GA 3S2EA 2NU9A 2NVUB 5EPOA 4L74A 3GVHA 4BO6A 3VPXA 2BFPA 3A4VA 3V2HA 2QX7A 2O2YA 3TQHA 1TLTA 3QHAA 4PIVA 2Q4BA 5TC4A 3VKUA 2VWQA 4UEOA 5FWNA 4J4TA 2RH8A 1GEEA 3DBRB 3FWZA 4WKGA 3S8MA 4BO4A 4CM5A 4FJ0A 4CLDA 4EYEA 4L4RA 4ALIA 4BNMA 3U09A 3GG2A 1NVGA 3GN2A 2AG5A 5GZ3A 4HUJA 5DOZA 1IZ9A 1DIGA 1U2DA 2VZ9A 3ANNA 4WLVA 1UDBA 1ZSYA 3L77A 1SAYA 2ZYGA 4A26A 1A4IA 4O59O 3UUWA 4Q3AA 3OF2A 4DC1A 2VOJA 3H9UA 2B37A 3ZDFA 1K2WA 4BO7A 3UVEA 1HEUA 4YT2A 1AGNA 2GCGA 4J1QA 5KKAA 4CM3A 1FDUA 5COBA 1BWSA 1E6EA 3TOXA 3DFUA 4HFMA 4LCEA 1F14A 4J49A 2Q2QA 4DLLA 2DPHA 3PJGA 4TSKA 4HWKA 2WWRA 3DMTA 3P2OA 3RROA 1B2LA 2OBYA 1LDMA 4BGUA 5C3MA 1UP4A 3N7UA 3OJLA 3DZJA 4BO0A 2X4GA 2W4QA 1V0JA 2GZ3A 4CMIA 5DULA 4PLZA 5JFOA 5T5QA 1NVMB 1YQXA 4J16A 4BNNA 2H9IA 3WGTA 1IB6A 3ENNA 4QTZA 2V7PA 1P33A 4A27A 4L4SA 4ZQHA 3SBOA 4B7UA 2JCVA 5L53A 2GO1A 3I4CA 1BGVA 5JMWA 3BHIA 5B12A 3UCEA 1S6YA 2AEFA 2E37A 3C7AA 2C7GA 5TLSA 4PVCA 5MGBA 1U9JA 1YWGO 5I8ZA 5TRTA 3WGGA 1OC2A 4FN4A 5L51A 5F5NA 3ZH2A 4XQGA 4CM6A 2QRLA 1D7OA 5JMPA 4GX2A 3H3JA 5I7EA 2WSBA 3WSVA 3TFQA 4ZD6A 5ILGA 1LI4A 1LUAA 2YHUA 3C3XA 3EMKA 1GV1A 4NFSA 3GN1A 3GZNA 4IQGA 5TF4A 3VH3A 2DVMA 1X13A 1XQ1A 3IKTA 1E7SA 3RBXA 1ADGA 1QP8A 2IYOA 2Y0CA 5I7SA 1JA9A 1PGOA 2Q99A 3VPGA 3ZV5A 4CMJA 2NUAA 4ND5A 1GY8A 2G17A 3IJPA 4XJTA 3I52A 3PP8A 4WECA 3RUCA 4KMSA 5A9TA 2HDHA 3K30A 4Y6PA 1RPNA 5DT9A 5I8WA 4RVHA 3ONFA 1RM5A 3CE6A 4RVDA 4KWHA 3L9XA 3ZHZA 5ITVA 1FDSA 3JQCA 3Q3CA 3UKOA 3ZWOA 5ICMA 3K8ZA 4HP8A 4JJIA 1P1KA 4E2ZA 1SB8A 1BXGB 3I23A 1PL7A 4KQXA 1UUFA 2CDAA 3DBVO 4U0JA 4DPLA 2ZCVA 3Q11A 2DUWA 1MXFA 1WZEA 3JQDA 4FW8A 1XSEA 1EE9A 1QXSA 4W82A 4EJ0A 2HSDA 2POQX 3ZU2A 2YY7A 4E30A 1AUPA 1SNYA 3RVDA 3O03A 2VTEA 3V2UA 4CR8A 4QO7A 3P2YA 4IJWA 1CF2O 3HE3A 2CDBA 5DP1A 5JC1A 5JXWA 4XB2A 2W98A 2DTDA 9LDBA 3GNSA 3H9GA 4UEKA 3GGGA 3IUSA 4BNUA 2PV7A 2PKQP 3NYWA 2A92A 4Y6RA 2EF1A 4FC6A 4YBZA 4RF5A 4UAGA 3PWSA 4OSOA 4R9RA 1EQUA 1DJQA 4JN6B 1DC6A 2DC1A 3IQDB 4YVFA 1C1XA 4RZHA 5T6BA 3TZCA 1V3UA 4ZRMA 3UH1A 3BTVA 1H6AA 3OH8A 4IMPA 1P77A 3RFXA 3WXBA 4FFLA 2PD4A 4RF3A 2NV6A 4P38A 1SEVA 4LW8A 3DBRA 1M6HA 3I4FA 2GUGA 4C7KA 1J5PA 3WGZA 5JCJD 3RUIA 1NFRA 4QQRA 1PS0A 2X9NA 2NQTA 3W6ZA 5F5LA 3ZU3A 5IZCC 5HM8A 1N5DA 3QSGA 4B8WA 3K2EA 4CM7A 5JO9A 4P8RA 3H9EO 3JQBA 1DC5A 3JQAA 1F0YA 1P31A 4R4JA 4WUVA 1J0XO 1VKOA 3B6ZA 1ENZA 1GFSA 2V6GA 4PG4A 2X9VA 3ROQA 1C14A 3LDHA 2X22A 3K9QO 4FB5A 3DBHA 2FWMX 4BNKA 3DOCA 1G0OA 3LT1A 5JS6A 2I5PO 3F4LA 1U5CA 3IDSA 4U5QA 4XR4A 1A71A 1HT0A 2DBRA 1O6ZA 3CSDA 1Q0HA 3IKVA 1UZNA 3FR8A 3K5PA 4BNWA 2EW2A 2EERA 1Q7CA 1DRUA 3DL2A 4I9HA 4R1SA 4GSLA 1U1IA 2HMUA 3L9WA 2PR2A 5JCJA 4ND4A 3TF5A 2BFOA 3QWFA 4UVEA 3DMYA 4TMFA 1K5HA 2SCUA 1N9GB 1XKQA 3JCZA 1H6BA 2B0JA 2YV3A 4IDCA 1E3IA 4CMEA 3RJ9A 4ESOA 1KERA 1LEHA 2AE1A 2IEDA 2I9PA 1MB4A 1M6WA 4XYLA 3FTNA 4IS3A 3VAZA 5GY7A 3H9QA 1DSSG 3K96A 3LT2A 3PYXA 1NPYA 2OXIA 5KNLA 1GL3A 2WEKA 4O5OA 3GVIA 3WMWA 3FHLA 2OMEA 4JK3A 1U3WA 3O9ZA 2B83A 2OO5A 4DLAA 3PIIA 2PA3A 1QYXA 1YDWA 2YFQA 1ZXLA 4AJHA 1ONNA 4BB5A 3K31A 3DTTA 1ISHA 3OFSA 3ROPA 5EESA 1ZIDA 5DCYA 1R6DA 2YV1A 3AK4A 1AN9A 1GYPA 2I76A 1OOEA 2O4UX 5LDHA 1QV7A 3T7CA 4J7XA 3TN7A 4D44A 4IDFA 4BNXA 1VRWA 2CD9A 3H4VA 1D1SA 2D3TA 2PZMA 1VI2A 4I1IA 4JXKA 3PGXA 1EVZA 3CPSA 3C1AA 4D3FA 3PXXA 2X86A 3ZV6A 3EDMA 1NM5A 4DPMA 3DHEA 3GDFA 4KTVE 4E2WA 4D45A 3ZHYA 5T8KC 1E1KA 2EJWA 2GSDA 1HE2A 4F45A 4QUKA 3KO8A 2X0RA 2BGMA 2X6TA 4BGVA 1N7HA 3PQFA 4PVDA 2JKVA 4DQUA 2BRUA 2BLLA 3LT4A 3UCXA 2FY8A 3I83A 3U4HA 1JTVA 2ET6A 2WM3A 3QJ5A 1OMOA 1XWFA 3KLMX 4JQCA 4K1LA 3UN1A 3VH1A 1H2BA 3GDOA 5TSDA 1PZGA 2VHVA 5B4UA 2C2XA 2JD0A 3BIOA 1TB4A 4NU5A 2IZ1A 2NLOA 1FMCA 4FFPA 4J1SA 2X5JO 2WJPA 3U4CA 2PTGA 4CM9A 1GU7A 4R41A 4U0KA 5ITWA 2NQ8A 2FPGA 2VWPA 3MOIA 4GMFA 2VYND 4BNVA 1R0SA 4QX6A 4BO9A 1R37A 2Y99A 2AQ8A 1P3DA 3KLPX 2F1KA 1HSZA 3QY9A 4AJOA 4IY1A 1CYDA 5EL0A 4XJSA 1MC5A 5DOVA 1YBAA 1WNTA 2IE0A 2TMGA 5FI5A 5KJFA 3D0OA 1B16A 4GX0A 2UYYA 1Y1PA 1Y5RA 2X0JA 4ONEA 4YAEA 4ZA2A 4BNHA 1H9BA 2RAFA 1JDJA 1X1EA 2GN8A 3VVCA 2PH5A 3GMDA 3DZKA 1R4NB 1E1MA 4L73A 5CEJA 3HN7A 1ONOA 3AY3A 1GCUA 1YOVB 3CMCO 2R00C 5BNFA 1YJ8A 4PG5A 4OKIA 2GF2A 5G2OA 5L9AA 3AI1A 5IAAA 2GDZA 4Y9DA 5JBIA 4MP6A 2UV8A 2CF6A 1P1JA 4IJUA 4K6CA 5I9MA 3RJ5A 4F6CA 5IZCA 2VHZA 2GERA 3P7MA 3C7DB 4WCDA 3RC2A 4CR6A 3EVTA 1VPDA 1E7QA 3ONEA 4G5HA 2Y93A 3SXPA 5TT0A 4GQAA 4D79A 1VSUA 4A0SA 3GMSA 3VPSA 4TVBA 4NJOA 1LA2A 3H9JA 4PLVA 1ZVMA 2H5LA 1Z6ZA 2GN9A 3RU7A 4BNLA 3LQFA 1QYDA 2HMWA 2NADA 4EGFA 4EI2A 3U4DA 3ICPA 4RCVA 8ADHA 1Q1NA 4CQMB 1ULSA 2UAGA 1NPDA 1TXGA 2VNSA 4FPXA 4DLBA 1HDXA 1C1DA 2EJVA 2VCYA 5EQDA 4CMKA 1R0LA 4RLHA 2O7SA 4TRNA 4MO2A 4P22A 5A9RA 2NM0A 4AFNA 1C1XB 1SBYA 1EVYA 2Z1MA 4KUHA 2FR1A 1E3WB 2BI8A 3DBLB 5IF3A 1BXZA 5JAZA 2VZ8A 3INRA 4OMUA 2ZQZA 3LSYA 4HFNA 5JO0A 5A3JA 3ASUA 3MJSA 4BMNA 2QRJA 1DFHA 2Z1NA 1I5RA 5G4LA 1NWCA 1C0KA 4E33A 1QYVA 1UAGA 1GZ6A 3OJFA 1W8DA 4AJEA 4DA9A 1LSJA 3SC4A 2H6EA 3GVCA 3PJEA 3W6UA 4A5OA 1XYGA 1NNUA 4E0BA 3ZV4A 1EK6A 1LDNA 4B4UA 4DBZA 2Y66A 3OQBA 4RLSA 2OP0A 5KKCA 1YB1A 3AY7A 3WICA 4CPDA 1DEHA 4E2YA 1QYCA 1KBZA 1E3SA 3KOUA 1E92A 1GDHA 3ADPA 2O23A 1DO8A 1PJ4A 2R6JA 4YRBA 4JJGA 4NHEA 1YJQA 3BXXA 2PLAA 1D4FA 4GGOA 1I33A 4KP7A 3PQDA 2AE2A 3RUAA 3E48A 5KVVA 1GYQA 2VHXA 3I9NA 1E6WA 4IZIA 3CZMA 1QR6A 4JNKA 1GPDG 3QA9A 3JQ9A 4Y6SA 4YDRA 2J5RA 3AI2A 2GN6A 5JAMA 3OMLA 3EVNA 2RBEA 3KEOA 3PTZA 3WG9A 4YAKA 2UDPA 5FEUA 1P0CA 4CUKA 4WLNA 4PFJA 3WOHA 2ZYDA 3D3WA 3D4NA 2BELA 3U49A 3SLGA 3BAZA 4Q3BA 3TZ6A 4LSMA 3GNQA 4GWKA 1W6UA 4DBVO 4KQWA 1WDMA 4U8GA 1WDLA 4XIJA 1LSUA 1DJNA 2YDYA 1HDCA 3GFGA 3GRKA 4M55A 1JWBB 2HMTA 2NVUA 1Y81A 3E6AA 4CJXA 1YVEI 1JKJA 3D64A 4RVUA 3TDKA 2DU8A 4CMEC 4II2A 1O95A 3FRJA 3WGHA 1U3UA 1KC3A 1PJ3A 1PQWA 1LC3A 3IJRA 5IDYA 5L7WA 1GUZA 3ICCA 4EW6A 4N54A 3HDHA 2CZCA 1N7GA 5AQ1A 2C0CA 1T2AA 1JW9B 4XGNA 3WIDA 5DBGA 3JTMA 3DAGA 1OI7A 4PLWA 4L4XA 2I67A 4LSWA 4BMSA 4RQTA 3BMCB 1EVJA 4LRSB 3JD4A 4XB1A 3NRCA 1PS8A 1DIAA 2NU7A 4HY3A 1FK8A 5ICSA 1ZUD1 3I6QA 1R15A 4MP3A 3GC6A 2VWGA 4W6ZA 2C2YA 5K9ZA 2BKAA 2AHRA 4B4WA 1M75A 2I3AA 4OO3A 5T8KA 1GQQA 4C4OA 2VNAA 3D1LA 4W9NC 2R2GA 4I08A 2P91A 3PWZA 3WTCA 4WEOA 2IZZA 2PKQO 2AA3A 1O8CA 4UVDA 3PLNA 5F1OA 4BMVA 2HAEA 4CL3A 3GVPA 3EHEA 1ADBA 4Q3DA 2PNFA 5CDGA 4WASA 2AW5A 2HLPA 3AJRA 3MEQA 3GT0A 4PLGA 4OXYA 4J43A 3VDRA 1IZ0A 9LDTA 4BNFA 2WD8A 1H6DA 5AXAA 1XQ6A 3BMQA 1UZLA 4ND2A 2I6TA 3WNQA 1UDAA 5EJ2A 5L40A 3E03A 4EBFA 3W4KA 3DMTC 4O1MA 4D41A 3W1VA 3JD1A 3WX0A 4L9RA 4E21A 5L3ZA 3ZW8A 3ZWPA 1Y9AA 2P5YA 3S55A 3FSRA 1ZBQA 1KS9A 3JQGA 2V6BA 1GZ4A 1VL6A 2G0TA 2NVBA 1ISMA 3OA2A 1LX6A 1LRJA 4KUEA 5JC8A 4OQZA 5IDXA 1KC1A 1DC4A 4WCFB 3TOZA 1Y8RB 3NTRA 4J4HA 2WE8A 1NPTO 1DHRA 5JE8A 3ITDA 4IIUA 2CUKA 3NV9A 4N7RA 1BSVA 3FCOA 1LDEA 4OAQA 4W99A 4DYVA 4YRDA 5BSHA 3Q1LA 2XXBA 3ZWVA 5H81A 3UXYA 3BMCA 1GEGA 3D5QA 3OICA 1JVBA 2HK9A 4YQZA 1IYZA 1YDEA 3DR3A 4GX1A 1N92A 3PFFA 4NR0A 4CQMA 2V65A 4M8SA 1ZO8A 3GEMA 1ISFA 3LLVA 3VZRA 4YXFA 1JKFA 1LLDA 4FGSA 5CDUA 3VZQA 3PLRA 3LZ6A 5EN4A 4LCJA 4DQXA 5JPIA 4U7WA 3VDQA 3H7AA 2Q1UA 1O89A 2Q46A 4AJIA 3ADOA 4WLOA 1JVSA 1UXHA 2B36A 2JD1A 3E5MA 3FF4A 1A27A 2YHIA 3BTSA 1B7GO 2P4HX 3D5TA 3HFGA 3QP9A 4BV8A 1ZW1A 2G5CA 3PYLA 2Y1GA 1Q7BA 5AXDA 4D43A 2CSUA 1H0KA 1G0NA 3PWKA 1E3LA 4ALMA 3B70A 1T25A 3RKUA 3D4PA 4OXNA 3GRPA 3KBOA 1DAOA 1N8KA 3Q2IA 4LGVA 4OL9A 4S3MA 2E49A 2DT5A 3OJOA 4YR9A 3H2ZA 4BO1A 1T4BA 1ZEMA 1Z82A 2EWMA 3GGOA 3U4IA 5A03A 3D3WB 5CEFA 2IEBA 3VZPA 2UUPA 1NYTA 4IXWA 3NDRA 4I9UA 2Y1FA 2Q49A 1ADFA 2Q2WA 1JLLA 1UXJA 1GADO 3MJCA 3IOYA 3KM0A 1HDYA 3QWIA 2AXQA 2CDCA 3JQEA 2DBVO 4U6SA 4BO5A 3H5RA 3CINA 4MKRA 3HQ4O 3HB5X 1XCBA 1LDBA 4JX8A 4RPKA 7ADHA 5U1PA 1D3AA 1KVSA 2FMUA 1NHGA 4Y8VA 4UREA 4YJDA 2NACA 1ZK0A 1V3VA 4RL6A 1CJCA 1Z7EA 5G0TA 3KYBA 3LLSA 4TQGA 4BNYA 5L95A 1LQTA 4PZDA 1U7TA 3W4IA 4JGBA 2HCTA 1YQDA 4OYRA 1I01A 1WMBA 3ANMA 3H6KA 2XPCA 2VYVA 5THKA 1I24A 2WE7A 1NQOA 2LDBA 3JQ7B 1IHXA 2FPIA 1HF3A 2Y67A 3CZRA 2GPTA 1T24A 3B1KA 3D7LA 4R3WA 4B4OA 3NT2A 3RQSA 3WWZA 4TRMA 3JQ9C 4BQPA 2ZTUA 1TI7A 1KEWA 4CM9D 3VZSA 3OIGA 3AOGA 4HXYA 1Y6JA 3UW3A 3K92A 2WDZA 4P4LA 2D4AA 5JDCA 2BFMA 3GR6A 4L76A 1PR9A 1NQAO 2P9EA 3MTGA 1A9ZA 1U3VA 3GPIA 5AYVA 3BMQB 3PPIA 4XQCA 2Q50A 5FFFA 3QVXA 4IQ0A 4ZQEA 2Y0EA 4DMMA 2W2KB 4WK6A 1T2CA 3ZV3A 5KCZA 5L7YA 1CDOA 1HRDA 4NG5A 5HWSA 1PX0A 3QW2A 4FFOA 4NBTA 2B5VA 2Y1OA 1F17A 1PJSA 3FPCA 1DFIA 3GOHA 3LF2A 3KXDA 4WCFA 2B4QA 4TRRA 4GI2A 2VOEA 3FNGA 3H8VA 4YA6A 3GY0A 1BDBA 2NTJA 2P4QA 1YL7A 1I8TA 5I7VA 2AMFA 4Q3NA 1A72A 4GKVA 5T67A 3LU1A 1U5AA 4N5NA 4RPGA 2HK8A 5THQA 3GNTA 1ZEJA 3DBLA 4JBIA 1XHLA 4LISA 4CMCA 1JU9A 4DGSA 1ZH8A 2X58A 4CQMD 2O2SA 4GPD1 5BNIA 2EW8A 2I66A 1E0DA 2RHRA 4OGWA 4FQ8A 2C29D 2VUTA 3EGOA 4BHTA 1NQ5A 2BHLA 3SJUA 2V6FA 1VE9A 1YONA 3EZLA 3WYCA 2QRKA 3D3EA 2Y68A 4NBUA 4E6PA 1SCUA 4WPGA 5KJ1A 1N1GA 2JFFA 2DUUA 4TZTA 3LC2O 3I9LA 4XR9A 1Z7BA 2FZWA 3OBBA 1NASA 1TEHA 2DFVA 1GZ3A 3L6EA 2ZYAA 5A9SB 4WLUA 2JL1A 2BGLA 2O3SA 1VJ1A 4CM1A 3O8QA 1PQPA 3L4BA 4DWVA 1YKFA 1XG5A 5G4KB 1K6JA 2C5AA 4KUGA 2GASA 3C7CB 4DTIA 4QECA 1EE2A 3B1FA 4WCFC 4WJZA 1U28A 4Z6KA 2HO5A 5B37A 5HRUA 4JCOA 2HU2A 3U62A 3TNLA 5A05A 2BI7A 3H3FA 1FXSA 1T4DA 2FHSA 4RVFA 1LLUA 1MXHA 3C8MA 1RM3A 3L4BC 1NAIA 1MGOA 3ONDA 4L75A 1B3RA 4GAEA 1WXDA 1OBFO 1PGNA 2ZKLA 4IINA 3RKRA 4DL9A 1ZKMA 4MVJA 2YV2A 4BS9A 4Z0PA 4CQLB 2CF5A 4RF2A 2A9FA 1YBMA 2Y0DA 2Q4EA 3HSKA 1BW9B 2C59A 4UUNA 3JQ8B 4HX5A 3H2SA 2RCYA 2QQ5A 3PHJA 3NJ4A 4CV0A 1C0IA 2Q1TA 2QHXA 3ORFA 2J3KA 4K9DA 5GZ1A 1RM4A 1XU7A 1LSOA 1XEAA 4BKQA 1E7RA 3AOEA 4WEQA 5K6AA 3VPFA 1GUYA 3WGYA 2B35A 2JHGA 5JAIA 1B26A 2E6UX 3FI9A 4M87A 4ZQFA 1K0UA 3WNVA 3G17A 3EC7A 4O63O 4UVGA 2F00A 3M1AA 5C7IO 3VTFA 3GAFA 1ORRA 1U4SA 2NSDA 4LVCA 5FYDA 1KEUA 4OOFA 5C5IA 3A9WA 5G0SA 5L4NA 4H7PA 4EUFA 1HDRA 5C7OO 4U6QA 1MV8A 2IRWA 1BXKA 5JYDA 3C85A 2VUSA 4HNGA 4R5HA 1J6UA 2WYWA 3WMXA 3EAGA 1QLHA 4PLFA 2GZ2A 3JV7A 3KSDO 4E2XA 1NHWA 2JD2A 1XLTA 1M76A 3BMNB 4CLOB 1A9YA 1PIWA 2H1SA 4J90A 4M86A 4MOWA 4R51A 4I5FA 2DBQA 5KVCA 3NUGA 4PZEA 5CG2A 1JWAB 4R1UA 3KRTA 3CTMA 3L6OO 1ZFNA 5A3VA 2YZ7A 3MCVA 2YW9A 1DPGA 3QVSA 1QYWA 2P2SA 3F4BA 4BKUA 1EZ4A 5C7LO 5BR7A 4QFCA 3PZBA 3V1TC 1X14A 4OH1A 5ILOA 1Q0QA 2R00A 2XOXA 5KJ6A 2OUIA 4E4YA 1T26A 1GAEO 1E3EA 1QV6A 2HUNA 5IXSA 5DNAA 2AG8A 5JSFA 2QZ9A 1WLYA 4A7PA 3OJEA 1X0VA 4R54A 3ZHXA 4GBJA 3Q9UA 4DMLA 1VLLA 4DREA 2PY6A 1P0FA 3DZHA 2GN4A 1LNQA 3BTUA 1ENPA 2C07A 1ZK4A 4FOOA 2W2LA 3DAFA 1KEVA 4JBGA 1K6XA 5GZ6A 3HUDA 1BHSA 4MVJI 2C20A 1D8AA 4AL4A 2IZ0A 1LRLA 2Q45A 4MP8A 1P1RA 4XCVA 1I0ZA 2AEJA 2Y1EA 4Z0HO 3DONA 1I2BA 4NK5A 3ZNPA 2VRCD 3X2EA 4WNIA 5IDWA 1UXKA 3H5NA 1PJBA 4L0QA 1F12A 3JD3A 4PCVA 4YT8A 1DIHA 3R3JA 4FJ2A 1GD1O 1QKIA 2IDZA 1KYQA 5A1TA 3V5NA 2EG9A 3O4RA 3Q6IA 4FFRA 3PYMA 3DXFA 3KETA 1LLCA 2HMSA 3LK7A 3WBBA 1JAXA 4CODB 1R4MA 2D8AA 1PJLA 3H5AA 3M6IA 1SZJG 1WPQA 4BKOA 3BMOB 1H5QA 2AQIA 3F46A 3PGJA 2P9GA 1B8PA 3DBHB 4FFNA 4EJMA 1DIRA 2C82A 3K6JA 1WMAA 4E5PA 4NU6A 1I3MA 3CXRA 1F06A 4PG8A 2P68A 3ETGA 3NX4A 4DPKA 3ZGYA 1VSVA 4B7CA 2W2KA 3PEFA 1B15A 3C1OA 1YRLA 4INAA 3CMMA 5EERA 4RQUA 3JD2A 1MP0A 5JDCC 3VH4A 5FF9A 5G4KA 1PSDA 5TT1A 3UAGA 3ZCXA 1B8VA 4E5YA 2XXJA 1KETA 1ZK3A 1TT5A 1TA4A 3OJ0A 2W8ZA 3VKVA 3ZNOA 1PJTA 1EFLA 3L0DA 5CDTA 4ID9A 5BQFA 5U4QA 2GRAA 3A06A 4YEDA 4BVAA 4OJNA 2I65A 1RYEA 4OM8A 1ONPA 3S1LA 1AXGA 5A5EA 3MWEB 1FJHA 1EVIA 3MJVA 3AUAA 3LC7O 5BSFA 3JYNA 1I32A 3BHJA 3IMFA 3PK0A 5HBRA 1MFZA 3RFTA 1XR3A 3NT4A 3GUYA 2G82A 3GPDG 4G2NA 4F46A 2VWHA 4IJKA 2YFHA 2I99A 4CM8A 5CG1A 4WOJA 1IL0A 3QV1A 3VPHA 5KOIA 4MVJM 2O4CA 3G3EA 3NEPX 3DZBA 4IGFA 4J7CA 3F1LA 3PZRA 3JYOA 4ZRNA 5DCUA 1MG0A 4BOYA 4UVHA 3ZWAA 2PK3A 2JJYA 3N74A 4YCAA 1XDWA 1W73A 4TKLA 2QIOA 5JCXA 4BUCA 1IUKA 3PHHA 4O0LA 4J1TA 1JAYA 3S2GA 1ZZEA 4PLHA 4HV4A 4Y67A 1EDZA 1X7DA 3QWBA 3GGPA 3ETEA 2ZTVA 1I30A 1QSGA 4MINA 1T2EA 3GF4A 3TZQA 4EJ6A 4XGKA 1GUFA 3NJ8A 4F6LA 2O3RA 3ZN2A 1XGKA 5H82A 5DP2A 2EIHA 4NPCA 4E5MA 4UVIA 4I5EA 4ROSA 1Z73A 1BXGA 1SC6A 1XU9A 2LDXA 4CLHA 1DLIA 4NQZA 3T7EA 4ITUA 4A03A 4WNCA 3I9KA 2I3GA 3NDJA 5EIOA 5JYEA 1VJTA 4B79A 4R5MA 4TZKA 4ALLA 4R68A 5IN5A 4YT5A 2J3IA 4PLPA 2HK7A 5J23A 2OZPA 4H3VA 4I5GA 4RPLA 1KVQA 1ZJZA 3INTA 4CMIB 4CMHA 3EW7A 3F1KA 4OQYA 3KSZO 4B3JA 1CEQA 1KY5A 1KVUA 3GDGA 4IXTA 4BGIA 2FRDA 4UUMA 3SJ7A 2PWZA 3W8DA 4M49A 3ENKA 1Q7GA 2EGHA 2ZJ1A 4EUEA 4ND3A 1EMDA 1L7EA 4UUPA 4BKRA 1R66A 3ZU5A 3PVZA 5K6AC 4D46A 4XYMA 3SVTA 2QG4A 3BTOA 2TMDA 3OA0A 1SOVA 3DZFA 1E5LA 5C37A 3UFXA 4NBWA 3TWOA 1ZK1A 1CETA 2HJRA 3S2FA 1G1AA 3ROMA 3UHAA 3M2TA 5BSEA 1SO8A 2ZK7A 2D5AA 2NTNA 3ZNQA 1CRWG 2Y1CA 2PKRA 5CPFA 3V1YA 1KY4A 2EGGA 3WYEA 4EEZA 4DIFA 3RD5A 3T4XA 3ZW9A 1ISIA 2ZQYA 3O8QB 1FDWA 1LBEA 3T4EA 3U5TA 2IXBA 3RAJA 5LDGA 4J6FA 5HS4A 1QRRA 1H6CA 4CMBA 4GLOA 3NTQA 2Y05A 4NK4A 4ALJA 1U8FO 2J8ZA 1UAYA 4FR5A 2GYYA 1HE5A 4KZPA 4PLCA 5A06A 1DDOA 4R9SA 4B8ZA 4M1QA 1GCOA 3WWYA 4RDHA 4RPHA 3K73O 4RO0A 1Z75A 3GAZA 2IODA 1NAHA 3PRJA 1V3TA 5CDYA 5HTOA 1FF9A 4ZQBA 5KJCA 1HLPA 3QQPA 3HDJA 4KOAA 1B8UA 2C5EA 3U9LA 3VHRA 1BMDA 1T1RA 2PZKA 4YYZA 1H94A 3EYWA 4KTTE 4R01A 3MWDB 3CH6A 1U4OA 4Z0TA 1CQJA 3ZWMA 1PZFA 2ZB8A 4Z3KA 2GD1O 3ANLA 4NJMA 3DO5A 3GHYA 4IUYA 4MPDA 3OQ6A 4CV2A 4CM8B 1HZZA 4FIZA 1NTOA 3QE3A 4LVUA 1N2SA 1NFFA 1TT5B 4PRLA 3P19A 4UEJA 4M54A 3MJTA 4BQRA 3NGXA 3ZWBA 3V8BA 4FCCA 5IZ4A 4N5MA 4BGEA 1ENYA 2DLDA 3DFZA 2J3HA 3DEYX 2Q2VA 3OEWA 2VN8A 2IYPA 1BTOA 4MVJF 4YAJA 1A7AA 5L7TA 2G1UA 3QWAA 1KOLA 5JW6A 5ER6A 4YT4A 3ZWNA 1Y7TA 3GVXA 2HJSA 3E1KA 3GZNB 3OIFA 3PI7A 3RC9A 3DB2A 1VL0A 4EITA 4YQYA 4I8XA 2PFGA 2ZB3A 5COQA 2GNAA 2ZB7A 3GEDA 3I5MA 5CDSA 4J2HA 2FR0A 2Z95A 5IN4A 1VL8A 3GZ4A 1I3KA 2VRBA 3RUFA 1MX3A 2V6MA 4LMPA 4HKTA 3C1TA 3GEGA 3RBZA 1P1HA 4WOKA 2AQKA 4BNTA 4TKMA 2O7QA 3R1IA 2YQ4A 2P9CA 3WQSB 2QW8A 4H16A 4WLFA 2O50A 1C3VA 3CIFA 4CUZA 4IIVA 1J4AA 2EP7A 4CLEA 3LC1O 4JIGA 5ER9A 1A4UA 4W9NA 1ID1A 1MLDA 3LT0A 3OECA 5CPBA 1FDVA 2VHYA 1ZK2A 1V8BA 4Q39A 4Y98A 4NJMB 3VTZA 3ABIA 4RVSA 3IP3A 3I9MA 3JQ8A 1M67A 3LF1A 4BL5A 1HDZA 1CERA 1LXCA 2NNLD 4G65A 4B3IA 3I3OA 4BO2A 4J91A 1ADCA 2BF7A 3FNHA 3QRWA 3RBVA 3BHMA 3QIVA 5IDQA 5ES3A 2WMDA 3X2FA 1I36A 2EKQA 4P4GA 4ZQGA 4K28A 1UH5A 3WGIA 4XYGA 3AFNA 4ZN6A 4GSKA 2VZ0A 1PWZA 1YL5A 4Z3DA 4CLXA 1P44A 2EEZA 1H9AA 4IJVA 4ZU3A 1C0PA 4D0SA 5AXCA 3WTBA 5KTKA 1AXEA 2J5KA 2ZCUA 2UVDA 5IJZA 1T1SA 3ZWWA 1TVEA 4TRJA 3ZWYA 1HTBA 1UXIA 4FGWA 5GMOA 4EZBA 4AJLA 2Q1WA 2AEMA 1AHHA 1EQ2A 4IDBA 3ROKA 3M1LA 3LYLA 4J0EA 5IG2A 2O3QA 5IFLA 3QVWA 3OM9A 5CP8A 3WFJA 4BNGA 2A4KA 2EP5A 3FR7A 4DIOA 1PZHA 3UGKA 3GK3A 5JDIC 5COAA 3E8XA 1ULUA 3AU8A 1BDMA 1T2DA 4GMGA 1I3NA 2RH4A 2J3JA 3RC1A 1ENOA 4XD2A 2YJZA 1PR3A 2GR9A 3QLJA 5TJHA 2E48A 3BA1A 1HYHA 3LVFO 1O0SA 4E31A 5L4SA 5TX7A 4QFDA 4IQ8A 2EV9A 4ALNA 1L7DA 1O94A 4K6FA 5ADHA 2CVZA 1IY8A 3WBFA 3Q2KA 2AQHA 4D3SA 3WR5A 1VKNA 4GGPA 3UCFA 7MDHA 1P1FA 4ZICA 1CWUA 3CUKA 3JQFA 2HMVA 1HZJA 2GLXA 3JQAD 4PLYA 3R6DA 3NGLA 1NFQA 1Q0LA 4NBRA 4YTEA 1ML3A 3M2PA 3EK2A 3U3XA 1JN0A 2WD7B 2X8LA 3FBGA 4IM7A 1D1TA 2OGUA 3Q9NA 3EZYA 1LSSA 4HFJA 3PJDA 2J6IA 4CMGA 1LRKA 4W7HA 3JQBC 3E18A 1MG5A 3O38A 1B0AA 1LDYA 1K3TA 1OFGA 4ILKA 1IOLA 2NU6A 3NAQA 3PDJA 3S2IA 4AJ4A 4DC0A 1QMGA 1ZCJA 5IXYA 4BIIA 5EINA 3JD0A 1E3WA 3PHLA 4RORA 4RV9A 5B4TA 2GGSA 2WD7A 1EDOA 3JQ6A 5A04A 2FSVA 4LMRA 5EQFA 4E3ZA 1N1EA 1K89A 2PGLA 3CEAA 3GLQA 4UULA 3RI3A 5F21A 4D3DA 3AY6A 3OSUA 2BMAA 1QORA 4MVJD 2OHXA 4YJHA 1DB3A 1DXYA 4XQEA 4M89A 2X5KO 5T64A 1NBOA 3WDSA 4PRKA 3N58A 5JLAA 5I7FA 1P9LA 2A35A 1DAPA 3IUPA 1E6UA 3P5SA 5DZSA 4XKJA 3MJEA 4B7XA 4OHUA 1ZNQO 5G0WA 4D42A 2HKIA 1LDGA 2DFDA 2E4AA 3JQFC 1AE1A 1NVTA 2CY0A 4NNJA 3E82A 1EEHA 1NWHA 3EUWA 5BNTA 3COSA 1LQUA 2BFAA 5TS3A 5TJ9A 4MVJH 2JCXA 1UDCA 4BB6A 1WW8A 1X7HA 4RF4A 1N9GA 2JAPA 3R3SA 1NQTA 4YAGA 3AFMA 1YB4A 3CKYA 4ZJUA 2XF8A 2ZATA 4O6VA 4PLTA 3TZHA 1RKXA 4BO3A 2EXXA 3G1UA 2QYTA 4QEDA 5A5FA 1M66A 3KVOA 1ZSVA 8LDHA 3HN2A 3SX2A 1ZSNA 2Z5LA 1JKIA 3JSAA 4J9UE 4FFMA 4J2OA 4JP2A 2FSSA 4GX5A 3IC5A 2X23A 4G81A 1RM0A 3IL2A 4QT0A 1TT7A 1W4ZA 3FNFA 1BRMA 1X1TA 4EEXA 2VUUA 2DTEA 2HQ1A 4DUPA 1IE3A 3DOOA 1P1IA 1S7CA 3V1UA 4FJ1A 3HNPA 1PS9A 2G76A 1ARZA 2E82A 3ZNNA 3KHUA 4MIYA
chains in the Genus database with same CATH superfamily
1IBMB 4PZ0A 1CLUA 4URFA 2H1VA 3MAGA 1MOZA 1K66A 2DBZA 4IWNA 5DEIA 1PR4A 1SBTA 1K8ZB 4XX0B 1QJCA 1N33B 4AULA 2WJYA 3I72A 4ER0A 3OPYB 2UVPB 3STHA 1OFTA 1MBZA 2PRZA 3BRWA 4HZUA 4G5SA 2ZE5A 4TQUS 5AJYA 4ZEMA 2IH4A 4U7TB 4HBGA 1FDOA 3WADA 6ADHA 3PHIA 1TUEA 1GQRA 2CLSA 4XQ9A 5HQ3B 4GH5A 5IUNC 1I7PA 4ZPXA 4OU4A 4LCBA 4R98A 5DBFA 5AMXA 2ZTLA 4CMAA 1Z29A 4MB2A 1IBRA 4FCVA 4X41A 1H5UA 1O9HA 2BGIA 3N3AC 3SLKA 4B3JA 4QG3A 3LGSA 2J6CA 4BP1A 3O26A 2E3JA 5CAEA 3EVZA 4WZZA 2NOAA 2VZLA 5BSGA 4Q0MA 1YE3A 2PQ2A 3LKBA 3VUFA 2W0SA 3EZNA 3FDZA 2P40A 1IWPB 2OP1A 1KGSA 3C43A 3E9NA 1E1LA 3K9LA 4WGGA 4XGIA 5AKIA 3H2GA 4B8YA 2VRCA 3G5AA 3G79A 2P9TA 3I5XA 4QD3A 3VVBA 5BUSA 3T1TA 1N77A 4IILA 2VLIA 1DBVO 4QO8A 5DHUA 5HA5A 1H2RS 2X8BA 3O4JA 3PR2B 4G1EB 3U7QA 4B09A 2W93A 1ODJA 2QAGB 3DCNA 1IIRA 1ICIA 4Y0VA 1XD8A 1YL6A 4I4CA 5A5GA 4NZ9A 1LLQA 1AUOA 4KXYA 4ZWNA 5DIFA 3U17A 2ENWA 5EJ7A 1A8QA 1I2CA 1WCIB 1ZWKA 3P9QA 2HIAA 4FFBA 4GWGA 4Q7MB 1ZPDA 1N6RA 4MVWA 1VIMA 2RI0A 1PL6A 1WV1A 5G0VA 3ZWXA 2O2EA 4OKNA 3MLBA 3QWHA 4HQLA 5EMHA 2GCOA 5DI3A 5B53A 3K2BA 1BYUA 1WDTA 4HNSA 4O25A 2C5FA 3F6RA 1GNLA 4TROA 1DMSA 1JU4A 3ZXUB 4D56A 2QMZA 1COWD 3EQ2A 2GVNA 1DEXA 1YVDA 3U1TA 1EPUA 1W0KD 2BC9A 3IUMA 4RD3A 4E94A 1TLFA 5FX2A 4FWBA 2O7NA 1YH3A 4URYR 3BD8A 4AG3A 5ICGA 2R97A 1C3OB 3MS4A 1TGVA 3B1XA 1RWQA 2GD6A 1TF7A 3PUKA 1GNVA 2QE7D 4NFHA 2GBIA 2OKGA 2QVLA 4WNYA 2FP4B 3P2MA 2BV3A 5F35A 1OGIA 3L5OA 4OSPA 5CUQA 2R3SA 2CFCA 5IM4F 3OBIA 4C87A 1H4TA 1JDBB 1UIMA 1DQZA 1QZXA 1XT6A 2BFEB 3C24A 2WV9A 3DTYA 3ON5A 4LGMA 3O91A 5F1KA 1H2HA 1WG8A 3JWGA 5IP5A 3RUHA 3SEFA 3ULKA 4EJSB 5BT9A 3KZVA 5K0ZA 4EB3A 2OUKA 4XRGA 1Y7HA 2GQ0A 3GEHA 1W96A 1JLHA 4DIKA 5DK4A 5B30A 1ZWLA 4YI3A 4UUAA 2VLBA 2C7VA 2XUDA 3WJAA 1ECLA 4X1IB 3WJ7A 3H97A 1TQHA 2HT1A 1GKIA 1XCLA 2M6KA 2WKWA 3GG9A 1CJSA 1M72A 2HF8A 5ENZA 5F9HA 2Q27A 4LXYA 5FPSA 3RARA 3GHHA 4KWIA 3LYHA 2WJVA 4J4BA 4UBLA 3OZAA 4E12A 4BP3A 5EUQB 1M7BA 4IDGA 3V3KA 5ENDA 5FTMA 1T5BA 3BE5A 2ZREA 4BC1A 4MIKA 3FLEA 3UANA 1TE2A 4L5YA 4GQBA 2ZDGA 3OIDA 1CR2A 2HL6A 3TVDA 4W1PA 3CKKA 1XAGA 3RV3A 2V7UA 3HNOA 1RMQA 4IMRA 4ML3A 4D5GA 1VCHA 4LXGA 4LFBB 1K8QA 2YWFA 3B38A 3QKIA 3BWCA 3I9V6 4TWZA 1APBA 4EHDA 5KYUB 1JIQA 4JX9A 1CUGA 3A1VA 1IK4A 3PC8A 5EXDA 4H6VA 3FOAA 4RY9A 1AMOA 2HTEA 1GQ2A 3BZWA 2ZTSA 3KQWA 4IDDA 5JYBA 2CXQA 2H3EA 3PDCA 4FX5A 1F8UA 1XZFA 2HLHA 2VPZA 3PSAA 4TX1A 4BYMA 5KIAA 2D7DA 3A04A 3L6CA 1K7YA 3DMGA 2I7XA 4O2AB 1YMVA 2ATXA 4LNUA 3BXPA 3E5RA 3INGA 1QIKA 3JATB 4GVPA 4C29A 1K7FB 1UANA 2ST1A 3PKIA 1QFJA 3EGDB 2E4WA 1RYDA 3OM0A 4N0MA 5FWDA 1N9KA 1RAIA 2QJOA 3IA2A 4O29A 4FDAA 2RIRA 1Q0TA 4PPNA 4U3JA 3BK7A 3G0DA 1CY1A 2X9GA 2Z83A 1NP6A 4I9GA 4M9UA 1O57A 1GYRA 5IC6A 2QTRA 3PNMA 4R1TA 1RAFA 4YROA 4MB0A 1NL3A 5KVAA 3RABA 3L84A 2RHCA 2RGXA 1SKYE 1VZ3A 4CLOA 2Q29A 2PLFA 4YJ2B 5A62A 5LQSA 1FS5A 2EBFX 3V8NA 1U2GA 3KOXA 2F1HA 3M6IA 3T41A 4UCXA 1TF2A 2JAHA 3NAGA 5A5DA 5JFGA 3WL6A 3AUTA 1L5YA 1ODSA 3DBOB 2FOIA 3I9OA 3K7EA 5J2TF 5C53B 2HO4A 1KZ6A 3PC2A 4BVLA 1DRVA 4GBMA 4DJAA 5JNUA 1T8TA 1XQWA 4F3YA 3JYLA 5TGDA 3MBOA 2PMDA 3AILA 4OB6A 4EFKA 2DPGA 4XDZA 1HG0A 4AICA 1E2FA 1ETUA 4DLRA 3EPLA 2HDNB 3JXEA 1HETA 4XX0A 5AXBA 4OYHA 4UUOA 1AB6A 2IHTA 2ZLBA 1UR5A 1GTMA 3VR3A 3G2IA 4O2AF 4BTVA 1S2NA 4UU7A 1PI3A 3QHQA 2WMYA 1I0IA 2YYYA 1WB9A 2OGTA 3Q3JB 1Z6GA 3HRHA 3CUYA 3ELUA 3HU3A 2G8NA 3QE0A 4E30A 4EYQA 2WT4A 3TXAA 1G21B 3CYFA 1M33A 3PJFA 4XVRA 2XZOA 2JHCA 3HYSA 4FS8A 1T5TA 2BBWA 4M9ZA 2FSFA 4NKRA 3RYHB 4YRAA 2PS1A 5E8RA 5SZKB 1LI7A 1OZAA 4RJKA 3VNUA 3OAAD 2AXPA 3VO1A 1NW4A 3TTUA 5LZ9A 4E32A 2KYRA 4XIIA 4P53A 4KN8A 2QU8A 3SC6A 4DMFA 1XZGA 2OBFA 2OAEA 3UWOA 2N42A 3V8QA 5DHSA 3RIMA 2MYTA 2V0NA 2QRVA 4ETWA 3U4MA 1TW3A 1X1QA 3MILA 4L4YA 1M2OB 4MV6A 3NKLA 2QLJA 2FX5A 2CUTA 4MV9A 4OFXA 4Q48A 4Q9NA 3RASA 3VU9B 2PUEA 4EGAA 1ZD9A 2NXCA 2SNIE 5DM1A 1PT6A 5ALGA 3ZBPA 2XBMA 4AJ9A 2XWSA 4Y0NA 1OH5A 1X1RA 3C7KA 3FNEA 3GFBA 2O8BA 1HE3A 4URUR 4ZAGA 3UH0A 3RU9A 1Y9DA 5EIBD 4UMVA 1Y5MA 1ZIXA 1YIOA 4ICIA 4OQLA 4OLAA 4YRGA 4FLMA 1XNHA 4FR0A 1NXXA 1T9ZA 4FOSA 4UU0A 5EJGA 2W6MA 3TG2A 4OYYA 4F2HA 2YN4A 3S7ZA 3JQAB 5HMLA 1ISJA 3RK4A 1VCNA 1XDBA 2PFKA 3T35A 4DLZA 1FNMA 4YB8A 2WQZA 4AJJA 4JT4A 2ANCA 1HKUA 2IYWA 2QROA 2QT9A 3QKSB 1IOWA 2P6UA 4ZYVA 2R6DA 1GCIA 5KJEA 4BAGA 1TKBA 4JI3B 2PG3A 3PTAA 3BA6A 3LWZA 1FLNA 4YJHB 2CJXA 1QHXA 2AL7A 4HXFB 4JYCA 4FS3A 1PTJA 2OORC 1RLMA 5ENVA 1X94A 1LB1B 1QLJA 1V4NA 2DTXA 5E4TA 1NUTA 2GUWA 1EVQA 2ZEJA 3NATA 4BRWA 4BX9A 4N6GA 9MHTA 4CR7A 3PNBA 2OHIA 3MRTA 3OLZA 4KXFB 4YJGA 3D4IA 1CQXA 2DULA 2BOVA 1YC2A 2QQEA 2YV5A 2O59A 3KZOA 2FPKA 3SYMA 3GBSA 5AT1A 1R12A 3ELWA 1D07A 1S02A 3KVVA 4FFWA 3CZ5A 1USGA 4AJKA 4BBPA 4DKXA 1Q7EA 1IJFA 4G0WA 2C54A 3QOXA 1GV0A 1QCDA 1XC7A 2FEXA 3FHOA 3L6DA 1QP0A 2DEUA 3GRCA 4DIEA 3G49A 4GL4A 3IVXA 4QUIA 4PGFA 4HDRB 3WLHA 2TSYB 1TEZA 1YXMA 1P74A 1G7CA 1V8PA 2HJGA 4IIFA 1YGYA 1QO9A 4U7FA 4CLRA 5JQGB 4NSNA 1Y6GA 3KKPA 4HT3B 2E0IA 3HRKA 1GTSA 2B4KA 2PYIA 1PL8A 3ESQA 1QUEA 3FXAA 2CEKA 1ACMA 3DGFC 3FVWA 3TZEA 4ZODA 1CUXA 2ZIEA 3HB4X 2IOFK 1C0LA 3R7WA 4PTLA 4EO4A 1KFCB 4V0LA 5L3SB 1R1DA 2QZZA 4Q7KA 4L6CA 2VA8A 4MV7A 3H1BA 1GOTA 4MQUA 4OQPA 5ALRA 1X3SA 3HS3A 3RFVA 1TZMA 3H83A 1QG6A 4BQIA 4R2HA 1M6YA 4HWRA 3MJ4A 4QXRA 3LHKA 4LPSA 2HJ9A 4L3VA 4D4HA 1NP3A 4C4PA 1MH9A 4G5FA 1GL6A 3ITKA 1OWLA 4B48A 4F1KA 2RGGA 1O96A 1CDEA 2CNDA 2D1TA 3GUUA 2XDAA 3QLTA 4LNUB 2D1FA 4L4UA 2OLEA 4NCNA 4MPPA 4WMLA 5DTEA 3T1QA 5L4LA 2VTDA 2A94A 4XWGA 4DQKA 3KZNA 1WF6A 4LJSA 5SYMA 2DM6A 4DF3A 2UYGA 4MA5A 4RFSA 4IVPA 2IBSA 2IH5A 3ZLBA 3W4JA 1DT5A 1U90A 3FNBA 3LBHA 1USVA 1JQLB 1ST2A 1T0BA 4J3FA 4LV6A 4O4JF 2QZSA 3FROA 3ROGA 3OF3A 1ZMTA 3N28A 4HEQA 5L3RA 2MINB 2B4TO 1BVUA 2GAFA 2XUZA 4D4JA 5JXGA 4PSCA 5LMUB 1ZMOA 2I3BA 3AFOA 1K98A 3K6SA 5E6SA 4HZGA 4DG9A 1UP7A 1EA7A 3EC2A 1J24A 1EUZA 1COWA 3HY4A 3ONNA 4HB0A 4LRXA 4LYYA 2ZE8A 5T41A 1BNCA 2BFNA 3PXUA 3U9SA 5L45A 5EZ6B 4B4VA 1RI4A 1ZRNA 1NI4B 2R47A 2IITA 3LJKA 2CVQA 4BV9A 3U16A 5K3FA 1PEDA 4N7BA 4AY5A 3BSSA 4Q4DA 2IHUA 3IHLA 4B80A 5G1NA 5G3YA 2OXTA 1P81A 2WMOB 4ZGWA 3NR2A 2ZIZA 4F71A 3QBEA 2J48A 3QVTA 2RHJA 4KBFA 1TEXA 4URVR 2L82A 4MVJP 2FUG6 3NHYA 4I2VA 3WGQA 1H22A 1O97C 2W71A 4LRTB 1Q22A 1PKEA 2MSKA 2PHZA 3KJQA 2VYQA 3AWDA 5BW8A 4U02A 4TV9B 1ZMBA 3AL2A 2NVWA 3I6IA 3W3AA 3EY4A 1WDWB 3OETA 3HSSA 3V9AA 5DLPA 3SS7X 3BFXA 4XDHA 3WWDA 4G4JA 4ZCPA 2FZ5A 4MS3A 4UBMA 4YJGB 3N5KA 1YBVA 2A57A 1C1DB 3OPQA 3W90A 4KO3S 4JBHA 1QZ3A 5DTRA 5JZVA 2C3UA 4GLLA 5AKXA 1VPEA 5HILA 3FWNA 4V2IA 4A2CA 1RRPA 1A97A 2JEOA 3UJ3X 3A4NA 5D2CA 2C8JA 3PNVA 3A7DA 4NI5A 4Z9FA 4EGQA 3PRKE 3UJBA 4H7KA 4NMWA 4L9SA 1V1MB 5EPOA 4WZBE 3IBGA 4BO6A 4QGFA 5K5EA 5IUKC 3A4VA 1OGJA 2YICA 3V2HA 2GI4A 2ZB2A 4JWTA 1KYVA 2W5UA 3NWEA 4NFLA 3TRDA 1NC1A 5FNVB 1SG0A 2Q4BA 3B36A 1K6MA 1V16A 3VKUA 2X4LA 1WTCA 4ZKEA 3U7RA 1DXQA 2IP2A 4J4TA 3S2YA 4BO4A 5FRDA 3A6LA 4CM5A 3TLBA 1R6BX 2WWIA 4FJ0A 1KSGA 4ALIA 4EYEA 4TYMA 4BNMA 4MR9B 4J0KA 2CDNA 3GDWA 3THXB 3M5WA 1NULA 1TCBA 1W46A 4KRYA 1FUIA 4HAOA 5HMMA 2I6FA 1IZ9A 2Z2ZA 1ZINA 1Y4UA 3N7TA 1N0WA 1TJYA 4WLVA 5CYPA 3OQJA 5AJUA 3L6BA 4BEBA 2DH6A 1L7BA 1NDQA 2ZYGA 2AMJA 1F2VA 4X6UA 4B6EA 1A4IA 1NBIA 1WUYA 3E3AA 3UUWA 1ZJ6A 3L43A 2REOA 4LTMA 1J07A 4DC1A 4IIJA 2O1WA 1SKYB 3ZU2A 3AR3A 3IQIX 5F78A 4US1R 1A77A 1FDUA 1ND5A 1E6EA 3A2LA 1X2EA 3DFUA 1MO3A 1ZD3A 2FOLA 3BC1A 2UZAA 4J49A 4PSKA 4RDCA 1ZGHA 3WLSA 1SHZA 3E23A 3DMTA 1M1YE 2OBYA 1GLNA 2QVZX 5K3DA 1L3IA 4FHGA 3QKRA 2O8DB 1YCGA 1SCUB 3EIUA 4R2JA 1WXWA 4UARA 1EWYA 2PEYA 1F5NA 2ZAOA 1NM5C 4PZLA 4JEIA 4MYUA 4PO8A 4EABA 2H9IA 2WP8J 3R44A 3WIOA 3H6HA 3HACA 4RIHA 1P33A 2V58A 3NLLA 4QU5A 4QTXA 1SXJD 2AMLA 2QD2A 4JJEA 3S1AA 4J0GA 1P8JA 4XFJA 2D00A 3I4CA 3M8KA 1T8PA 3QMPA 1ZJJA 4TT8A 3TIFA 3UCEA 5JMWA 4WKNA 1GNSA 1S6YA 3ND9A 4JSYA 4JVOA 6REQA 2HSEA 4KEAA 4PVCA 2BEVB 1JDVA 1UINA 2PBLA 4M9SA 2HPAA 3BRQA 4UTOA 2VO1A 4M0DA 1U9JA 5I8ZA 3C8ZA 5ECWA 3SE0A 1GSIA 1OC2A 1W49A 2PDAA 5F5NA 3H17A 2JDID 4PZAA 4K9KA 3MCUA 4CM6A 4Y1GA 2IDKA 1D7OA 3RVLA 4OX9B 1E6KA 2H4JA 3DCIA 4KSCA 4G0MA 4ZD6A 3TFQA 5ILGA 4KDCA 2PSSA 1LUAA 2YHUA 3C3XA 3U26A 3W06A 3GZNA 4IQGA 4MO9A 3VC1A 3NHMA 3RBXA 2R96A 3CV3A 3I6BA 5KCMA 5C5CA 1S4QA 1QP8A 4JD5A 3B82A 5HKKD 1CJMA 4RFSB 1L4HA 1N3BA 2OO7A 5CJ2A 1U8ZA 4OQDA 3KHTA 3T3EA 5CNMA 4KMSA 5A9TA 3NHRA 2CL0X 3TOCA 2ZYVX 1N3LA 2JIMA 1UKEA 3E9YA 3RIXA 5CB0A 1UBUS 4FKBA 2JA2A 4A0GA 3QBDA 1ODTC 2XOEA 2P9JA 4HAYA 1XAIA 5J4HA 5FNVA 2C2OA 1RM5A 4X6XA 3OWHA 1S1CA 3GLVA 4ZHQA 4QQFA 5K0FA 2E4ZA 1AKVA 5EY5B 5ITVA 1FDSA 5CT5A 3O4VA 1RQRA 3DMPA 2KPOA 3UGJA 2YIJA 2YZGA 4HP8A 4JJIA 4ZHQF 4PO1A 4AKIA 1BXGB 3PEYA 3NXSA 3WGLA 4BVBA 3OQMA 4FUQA 3A05A 1RPZA 5IYZA 5KU7A 4GPAA 3ER6A 4GW3A 4DPLA 1AVTA 5EHXA 5F98A 1EWKA 1MXFA 1UT8A 3JQDA 3VPBA 1K7CA 2B3DA 2FEWB 3BK1A 1G42A 3K9HA 3U7FB 4PC2A 3UJ8A 5KI6A 3TUIC 2DPXA 4ZVRA 4CR8A 5M5BA 4IJWA 1CF2O 2PM8A 4GIBA 1S4MA 3WWOA 3T3NA 5JC1A 1GUAA 2F7SA 4JELA 4XB2A 4ZV7A 4ETNA 5K4HA 3U56A 3I1FA 2BSQA 1DBRA 2B7BA 2DTDA 1U63A 3URMA 9LDBA 3H9GA 3SBXA 1TM5E 2O2GA 4JB0A 2V8BA 4XIFA 4B6RA 4BFLA 5LB4A 4BE9A 5JWRA 2PKQP 3NYWA 5LP6C 4G07A 1T3HA 2R86A 3JZFA 3QHPA 4F11A 3KPVA 2IU0A 1TM2A 2GNPA 4FC6A 4NVRA 1Q3HA 3JS5A 4O4HF 4YBZA 4EO9A 1MJFA 4HGNA 2W8BA 4RF5A 3HB7A 1FP4B 2IVZA 5BSTA 4HB4A 4R9RA 3L4JA 1EB9A 3KDAA 4JN6B 1GN8A 1DC6A 3IQDB 4TLLB 4H7EA 3BL5A 5LBIA 3GRVA 1Q14A 2JB9A 4FONA 5TMBA 3U81A 5BSUA 4DARA 3HCRA 3UH1A 3AF1A 5I9SA 1M0TA 4IMPA 1Y3IA 1CHNA 2P6PA 1WRBA 2IC5A 3B2EA 3L0ZA 4R2KA 5EE9A 4BVHA 5GJBA 2AR9A 2B1IA 4EHKA 4LW8A 3SSAA 2VHEA 2VYCA 3DBRA 2GUGA 1UBJS 1UDRA 3HCWA 3TINA 4C0XA 4ZKDA 5AVRA 4OMDA 3MN1A 3N2NA 5EUMA 3LVBA 3PR1A 3M5CA 3GJRA 4I7EA 4QQRA 3VMFA 3IAXA 4CTJA 2H2AA 2HJVA 5KPDA 2PSJA 4BE4A 1N5DA 3QSGA 4B8WA 3K2EA 2YS7A 1G7SA 1XJ5A 1Y6ZA 2HXSA 4IRMA 4PR0A 3CVUA 4JI4B 3VJRA 2EYUA 3H9EO 4NC9A 1L5MA 1Z28A 2X76A 5FUVA 4O4LA 2FPMA 3OKCA 2PUDA 2XUHA 3B8HA 1AY0A 1OXBB 3L8EA 2Y6VA 3GFSA 3LW7A 5LQMA 1XJCA 4PG4A 3KQYA 1JQDA 3DE2X 1C14A 1O94D 2AUNA 2WU0A 2X22A 2WDPA 2FWMX 3DBHA 5DLQC 4BNKA 2GZRA 5EJFA 2PRKA 3F4LA 1AO3A 2IYYA 4GZMA 4QU8A 1QBKC 5TQJA 4FHFA 3CSDA 3JVIA 4WN9B 1R2QA 4H17A 1Q0HA 4YV7A 4B3GA 2YJGA 2EW2A 2VJLA 5YASA 4PGAA 4XPIA 3DL2A 3NPMA 4I5IA 1IDN1 4R1SA 4QLBA 4W5WA 2YFKA 1VA5A 4HDKB 1LBHA 3L9WA 5K0NA 2PR2A 2BFFA 3TF5A 1EHCA 1EX1A 1QHFA 4UVEA 4BO7A 1UKCA 1SXQA 1IM8A 2HCJB 4TMFA 1F0PA 1UBSB 1XKQA 2XECA 3A7EA 1USIA 4IG4A 4QUEA 2WP0A 4ZAVA 1H6BA 2LR0A 4KR0A 3MRVA 2DUJA 2F1OA 3DNPA 1P4JA 1G5PA 3PPWA 1C7FA 2IJGX 3TLGB 3MPUA 2I9PA 4J0HA 4JOSA 2JGDA 1PV2A 3HCEA 2Q7DA 4JXJA 5GY7A 4TYNA 2JRCA 2GPJA 3JRNA 2J5XA 1QONA 4M0CA 4PAQA 2PL1A 4PYJA 3KS9A 5FTKA 1DELA 1YU9A 2Q6LA 1T9GR 4FM9A 4AD8A 2IHJA 2WVJA 3OEEA 2CLIB 2FW9A 2CFTA 3FDIA 3ZW7A 2WEKA 5EAIA 1U0OC 2MSNA 3RK1A 3MERA 3FCUB 2HLDA 3FHLA 2OMEA 3WMWA 4WBNB 1UQUA 3STWA 4CKXA 1U3WA 2E9SA 2OO5A 4M8NE 4DLAA 1T36B 3PIIA 2VK8A 4E7PA 2ZW9A 1ZONA 4H0NA 5JPCA 2PT7A 1ZXLA 2PLRA 1WVIA 1SCAA 2O6HA 4D8WA 1GT91 4H59A 1RXEA 4MMZB 5AP9A 4HQFA 2QTVB 4L72A 3U9TA 3PEUA 1ISHA 2AFIE 5EP2A 3W3AH 2A84A 1XRMA 3ROPA 5EESA 1OJLA 2FH5B 1SUWA 1T1EA 2YV1A 3AK4A 3BL6A 3N0XA 4IOKA 4NZPA 4A4DA 5BV2P 2ZWMA 5DN6D 4YRRA 5BN5A 2Z6VA 5A4JA 1JEYA 1OOEA 2O4UX 4IJQA 5LZ4A 4Q82A 1X1DA 3HWWA 4ITRC 3KWMA 4EVSA 3SZOA 2ZBPA 3O4HA 4GPIB 1D03A 2HBQA 2O8NA 3EGEA 4X7RA 1KKMA 1SUIA 2FEOA 2D3TA 1VE7A 2Z08A 1VI2A 4KIJA 3ZIUA 1YV9A 2QVBA 3PXXA 3FZGA 4KQEA 4IXNA 5HE8A 1KKUA 4DJDC 4DPMA 3GDFA 4BMDA 5TDHA 4BZPA 1HFKA 1NLUA 1CD5A 3NTUA 4QEZA 2G9UA 4QGGA 1WHSA 4V24A 1LK5A 4ZYTA 1Z2OX 4AW9A 5BURA 2O8FB 4XUEA 2H65A 3KO8A 2X0RA 4MRVA 1KK0A 3EQ6A 1H42A 1XMSA 2OPHA 3PQFA 5HF6A 3C5HA 1ZX1A 4PVDA 5JASA 1RI5A 2BRUA 3YASA 1U2PA 3U1VA 2PRSA 3O2SB 2PCJA 4MGEA 3HJRA 4ZVPA 4AMGA 1H65A 4ZV9A 1Z3CA 3U4HA 4EFLA 3AUXA 2NIPA 4K6KA 4KFUA 5IAGA 1U5BA 1XWFA 1KSJA 5CVJA 3UN1A 3Q98A 1KZ1A 3GDOA 3MJHA 1OX4A 4FE4A 2VHVA 3LNTA 1LD3A 4OY3A 2CW5A 1TB4A 2C7PA 2NLOA 5D6OA 1FMCA 1KJ8A 1PYGA 1OW3B 3G5LA 5J5CA 3L7NA 2ZE6A 2OGWA 3P32A 3W1WA 3OUTA 2VP3A 3VA7A 1LWOA 2IUEA 4Y2YA 3QW4B 3TMKA 3M49A 3A4YA 4U0KA 2PJDA 3EWAA 2EWVA 4EB6A 1Z47A 5C80A 2F3RA 5AR1A 2VYND 1FQOA 1C3JA 1LBIA 3UMMA 2ZIVB 2MJLA 4RD4A 1Q19A 2FTKE 1Q6YA 2Y27A 4YAUA 1QB8A 1TU0A 1CRPA 1D8TA 1X1BA 4EY4A 2Y99A 4RADA 2AQ8A 2NO1A 1P3DA 1PSWA 4PS0A 4F12A 3KLPX 3O8OB 5EGNA 4TTPA 2ZRMA 3KWJA 2ZBFA 4HDMA 2FMXA 1YBFA 1NQUA 2OV2A 2VCHA 4LDPA 3N0WA 4LNAA 2G8LA 3MRSA 4AJOA 1I94B 2JJQA 4K6OA 3I2JA 3PC6A 1DDIA 1GKLA 2TMGA 4F5WA 4UFOA 3U4AA 2BT4A 3D0OA 3KEFA 4ONEA 2C4HA 4YAEA 4ABYA 3JYHA 4YONB 3KDPA 1H9BA 1N1MA 3OLCX 1JSRA 2PTHA 1SCQA 1X1EA 1J70A 2GN8A 3VJKA 1SULA 3T7SA 2CFIA 2I4LA 4L73A 5I48A 3I6MA 3HN7A 4KI0A 3IELA 4NCIA 3CMCO 2R00C 5BNFA 1KS2A 1MAUA 4HEA1 1P7WA 5G2OA 4LXQA 3DMDA 3JALB 4Y9DA 2NSLA 4A8JC 1TM4E 4L2IA 4MP6A 4DCJA 4IH4A 1P1JA 4IJUA 1U0EA 1JZSA 2GXUA 2HWKA 3RJ5A 4ARCA 3PXAA 1JR6A 2QRHA 1ECBA 4IOMA 3VHXA 2W6QA 3P7MA 3SHQA 3C7DB 5E9JA 4CR6A 1VPDA 5KTOA 3FYUB 2MYUA 4G5HA 4IHKA 4QRHA 3NBAA 1TW2A 1OLXB 2VHCA 1LPNA 4KQ6A 5BN1A 4WJLA 3UIEA 1E1QA 4Q4JB 4D79A 1GGFA 1XEWY 5I7AA 4JUBA 4MQMA 1T9AA 4MW5A 2IYNA 1QRUA 3AJEA 2WG0A 4B40A 4JJ8A 2H5LA 3V48A 1XNJA 1MAVA 2GN9A 1E60A 4QWMA 4DAEA 2AOTA 2CHVA 3QXXA 4E1AA 4EGFA 4RCVA 1NRXA 1Q1NA 4CQMB 8ADHA 3WLAA 1QG2A 1S1MA 1H0RA 2UAGA 4I1SA 4P7FA 4TV9F 3R5KA 2VNSA 2VSNA 3BSWA 2Q4DA 4CMKA 3PQ5A 4MO2A 1IHPA 2GB4A 4BJ3A 1U7ZA 2GZDA 4YLYA 2VNHA 2Z1MA 3KL2A 1E3WB 3QEKA 4H3KB 1TU4A 5LQRA 4FKMA 3MM4A 4OMUA 2QX4A 1CV2A 2XNDD 2FN4A 1KMIY 2W37A 3ASUA 3MJSA 5DKFA 2BZGA 1Y63A 2CL7X 4XGQA 4WFQA 3LQYA 2Z1NA 4C5AA 4DY6A 2H2IA 1QG0A 4HNTA 1X2BA 4E33A 1Z4MA 1T4CB 4ZVSA 4TXNA 3U2QA 3OJFA 1NRWA 1X19A 1W8DA 4AJEA 1AK2A 3BEDA 1RJEA 1YA6A 1T9HA 1CQPA 1H8HD 4KL8S 2H6EA 4RD0A 4JI5B 1P2BA 1DTWB 3MELA 1XZCA 4RIEA 2WYOA 4WX2B 5ALQA 1NNUA 3LUCA 2YIMA 4GL2A 2JFVA 1OY1A 2JLQA 1EK6A 4BNIA 3HXOA 2XA2A 3KD3A 4UDOA 1A82A 3DUFA 1XYYA 1NLYA 2TMYA 4N8EA 2JIZA 4CPDA 1H66A 2I0FA 4IQFA 1F48A 1JXAA 3ZY2A 2ZBDA 2O0LA 5GVSA 2ZR9A 1KBZA 3HY3A 3KOUA 3ZIAA 5CLJA 1AKYA 1CQIB 2O23A 5D3MB 5JZMA 5DX8A 1PJ4A 1L4MA 4NECA 4YRBA 4NHEA 4AYXA 2JG3A 2PLAA 2QQFA 4KYUA 4GGOA 3CCFA 3HJTA 2V7BA 1FYFA 4LJ9A 2P9YA 3PQDA 4YYEA 3UV3A 1TK3A 4BMPB 4ETMA 2QL9A 1D4ZA 1U2DC 1KJNA 4ZC1A 2VHXA 4UM9B 1JEQA 1QR6A 1EU1A 2P6MA 3LX4A 1QHHA 4L51A 4Y6SA 4YDRA 1LS1A 2J5RA 1BWRA 1T34A 1Z5OA 3DE7X 3IQWA 3VTKA 2GFHA 5F7OA 3EVNA 1H2XA 4LF4B 3I2FA 3K09A 4YAKA 5CFQA 2VJMB 4K9SA 1YK0A 5ALKA 5C46F 4L08A 4ENVA 3L7JA 2JJ2D 2FVXA 4KVZA 1C2YA 2CJPA 1RYZA 1XRJA 4M2LA 4YXWA 5KOHB 3H1FA 4M0PA 3SLGA 5JR3A 3TZ6A 1HLGA 1YZVA 1E4EA 4URZR 1DNPA 1CR0A 3LX5A 3JASB 4CRWB 3UBTA 3MCZA 1M1NA 1T8YA 1ZJWA 4U8GA 3WP0A 1OVGA 4F93B 1LSUA 2I4NA 4ILEA 3K0BA 5C7YA 1HDCA 4YV2A 4H7JA 3DPIA 3GFGA 1BC5A 1QO0A 1XAJA 3HI6A 1BS2A 1Y81A 3IDQA 4RS3A 3S44A 1YVEI 3AF2A 4FMCF 1JDSA 1JKJA 3AB3A 4RVUA 1FL9A 4QQNA 4PW0A 4CF6A 4CNBA 5C1OA 3NI2A 1XRLA 2KSQA 2WM9B 3QTLA 4EG6A 3MWLA 4U2GA 4KPFC 3EGXB 4HRVA 2X0KA 3Q8KA 3ZXXA 2V98A 2P4UA 2R4UA 4M6WA 4JA0A 3DT9A 2PL5A 3ISTA 5LIRA 1KMCA 1RWWA 3I64A 1Z5UA 3FG9A 1N7GA 2HGSA 2FRXA 2HT6A 1U6KA 4MUGA 1D2EA 1T2AA 4ND6A 4C4ZA 1TVKA 3O9VA 3VDMA 2BFBB 5EPUA 3EIQA 1L4UA 5CB4B 4K0KB 3QMVA 4P4TA 4B33A 4RACA 2WF8A 3TECE 2BMWA 3OFND 4MW9A 3F6CA 3NEYA 1PS8A 4HLDA 1DIAA 2NU7A 3QMMA 2AFRA 3L05A 3GXOA 3I6QA 5DSXA 2WTAA 7REQA 2ZRAA 1XEFA 2VWGA 3OIYA 3RFCA 4WOCA 4YPFA 2BKAA 2Y1WA 1XNRB 2JW5A 1KZ7B 4JR0A 3IH5A 1QIDA 4UHDA 4FGKA 1YIAA 4W9NC 4BNDB 1MEEA 4UMEA 3PX7A 1QTIA 4A1OA 3PWZA 1JHZA 3EZ2A 3E15A 1CE8B 1Y1LA 1SCIA 4HVTA 5JT1A 2IZZA 4NEHB 1NSFA 2PKQO 4XLTA 3AVVA 3O73A 4W5NA 2HAEA 4CL3A 4S24A 3UK1A 5AW1A 1SU7A 3MOSA 4WASA 4EW3A 1GPYA 4RTMA 2FCAA 3CNQS 1T9DA 4EOGA 4HZIA 4QDXA 2N0SA 2QNBA 2RGUA 2ZSJA 2O5RA 3Q3HA 4BUZA 1UKYA 2IYLD 2IZOA 2WD8A 4GMXA 4N6OA 5DB4A 1XQ6A 1W5SA 3BMQA 5DO9A 3RSQA 3WNQA 4QHTA 4OXQA 4RELA 5FBHA 3W9YA 5L40A 4EBFA 2H16A 4TLCA 1O97D 1WD7A 3L0SA 1NIJA 1RLJA 1LVGA 1N0VC 1D0SA 1WPXA 3AESB 2QRZA 2OT3B 2B1GA 4G56A 3IR6A 3ZWPA 2NPFA 3S55A 3FSRA 1ZBQA 3JQGA 4E5VA 3ZUPA 3C5EA 3TQIA 2V45A 5LJIA 1PR0A 3N9IA 1L1QA 4QTTB 1SHLA 3V4SA 1WUIS 3RIYA 5A2QA 2YKGA 5KUTA 1EWQA 5JE8A 3IQGX 4IIUA 3NV9A 4U3JB 5EXTA 1BSVA 4LJAA 1DAKA 4B75A 1CYEA 4YRDA 5FA5A 4DT1A 2XXBA 1K5PA 3ZWVA 3KV1A 4K87A 4ZQIA 1R0ZA 2XRMA 1GEGA 4U2EA 3MGBA 3D5QA 1JVBA 4NEGA 2HK9A 3A36A 4YQZA 1W4RA 1IYZA 1YDEA 5G1PA 3DT6A 3HM2A 1Q44A 1ZDMA 1OILA 3IBCA 1VJDA 2P9ZA 2ZAIA 4AKSA 3VZRA 4YXFA 1LLDA 4FGSA 4DUZB 2PSEA 3FHJA 1NQXA 3NWPA 3K6RA 3A37A 4RMHA 1G9TA 5CDUA 3T1YB 3VZQA 4B2PA 3NDPA 2YS6A 2XITA 3WKAA 1FDIA 3P5BA 4K9LA 3VR4H 1V5IA 4EENA 1UEJA 1DKQA 1V48A 2DPMA 3VSAA 1JEDA 2ZWIA 1O89A 4YUVA 5IVKA 2W2NA 2B3TA 3IVCA 4ATNA 3GLKA 1UXHA 2XQKA 2YXLA 1K68A 3PENA 1B7GO 1J97A 3D5TA 1D6MA 2BEWB 4YP1A 1YDMA 2C2MA 2RK6A 3HFGA 3JARB 3NP9A 4GLBA 1HQKA 1SG9A 1RJFA 4Y2RA 4BV8A 2XHEA 4C6SA 4LF9B 2QL5A 2QUBA 4LI3X 3CNBA 4BFCA 1GXSA 4Q7QA 1K08A 5AXDA 3DP7A 3O8LA 4BRZA 1NVDA 4P93A 1H0KA 1G0NA 4NEQA 4LF7B 2FXIA 2JGLA 5JOQA 4OQNA 4ALMA 3SFZA 2A5DA 1Z26A 2Q1XA 2ZBUA 3RODA 3B70A 1W35A 3CJQA 3M5PA 4I4TB 4OXNA 3GT7A 3KOMA 3GRPA 2H18A 4XPZA 3JRWA 3INYA 1BU5A 4LGVA 4S3MA 4HGQA 4YNBA 3CO5A 3D0QA 4A16A 4OHFA 4B81A 4PCUA 2RGDA 2DT5A 3OJOA 3FTQA 3T5BA 1BFDA 5JBNA 3U7GA 2EWMA 1Z82A 1BJTA 1FFWA 4OK6A 4BWGA 4YP0A 1ZIYA 3LZCA 2J45A 2X1VA 2A0FA 2IEBA 1TZJA 2VH5R 2O2DA 2ZRQA 3HC7A 1ZXXA 2ZVDA 2JLAA 3GD5A 3KT8A 4M83A 3AY0A 3T1VA 3NDRA 1XJ0A 1E61A 4LC0A 3UJDA 1X8KA 5J1TB 4I9UA 2YZMA 2WWTA 2Q49A 3WZLA 4A6PA 1ADFA 1TQ6A 5H1YA 1UXJA 1I80A 3KM0A 5EE3A 1HEIA 4QASA 3BERA 3WIUA 4H27A 4U6SA 4BO5A 3FWPA 3H5RA 3CINA 3OFKA 3HQ4O 4L50A 1PJAA 2VPIA 2HQBA 3D9QX 1M8JA 3EA0A 3EJWA 3HB5X 1JYFA 4J07A 5JECA 3B3QA 5BV1A 2Z5GA 5AKYA 1D3AA 2Q21A 2ZYTX 3CC8A 4QBGB 1NU6A 4MUMA 4TKUA 2P1DA 4Y8VA 5FEMA 4UREA 4CFYA 4YJDA 3GJ7A 2HSJA 1UFKA 4NZNA 3W05A 2FLWA 3H1TA 1HFWA 2NACA 2O14A 4DLPA 1M1XB 5I3CA 3L2OB 4PC6A 1YZKA 4YO7A 5F77A 3GP3A 3LLSA 3OJWA 3UUGA 4BNYA 5L95A 2O8DA 1TM7E 2RGAA 1UZAA 1U1GA 4JL8A 4G9EA 3QPVA 1U7TA 3OQNA 2YNMC 1AGYA 1NQVA 3I73A 3H8SA 1MH1A 1M7GA 2CLFB 1Z0FA 1YQDA 2BFDA 3E9RA 4OYRA 4QGHA 3TEMA 4C5CA 1D1QA 4EGCB 5ALYA 2CUNA 2PQ6A 3RE1A 1AXRA 3V1LA 2RHDA 4DT1B 4GT1A 2F1RA 4YRSA 1R9JA 3RVJA 4BX3A 1L7OA 4KWCA 4ZI5A 4ZT4A 2XSZA 3B53X 3VFDA 1I24A 3UAVA 1NZDA 1BAPA 3B6EA 4PSDA 5REQA 3DQZA 4LG1A 1CJVC 3KXKA 2GTPA 4MTCA 4WT7A 2Y67A 3QBJA 2O54A 1AIPA 1LS6A 1T24A 3B1KA 4TMYA 2AR7A 2C5SA 2IVFA 2AS0A 4R3WA 4ASUD 4WXYB 3RQSA 3V4PB 3WWZA 3B3FA 1KOJA 5H3CA 2ZTUA 1GO2A 2VP5A 1TI7A 2XJ4A 3EDRA 4CM9D 4X66B 5I4CA 2F8TA 1U2ZA 1Y6JA 2WDZA 3FF1A 2WOJA 2D4AA 3NQ41 4YPVA 1J5XA 1H0HA 3QKSA 3DVSX 1JYSA 2P9EA 2ZZNA 4L85A 2NU7B 1Y4SA 2IYSA 1U3VA 2IW3A 2VDWA 3GPIA 1KO8A 3BMQB 1QC5B 3KIPA 3GRZA 2MYPA 2G0NA 2NZWA 2Y0EA 4RTQA 5HGJA 2H5EA 4BRSA 1OIVA 2GPAA 1AUXA 1T2CA 1VXOA 4JDPA 5D8DA 5EWMA 1V5WA 4RWEA 3ZV3A 2BGNA 1BWPA 2ZE7A 4NBTA 1HZZC 4A23A 4KLRA 5BXYA 4M1SA 5KNCH 3A4TA 1Q7TA 1CEXA 2J4FA 2WFMA 1DFIA 1YJXA 3GOHA 3DM5A 3LF2A 3KXDA 1NNI1 1G17A 3RYIA 5BN3A 3AO0B 1HEYA 3OLYA 1Q0SA 4FEAA 3H5WA 3AL3A 2XB9A 4TUYF 4KR2A 1J2RA 3FNGA 4YA6A 3WL7A 3A1WA 3GY0A 2DR3A 3PTLA 4GUDA 5DK6A 3V6LA 2P4QA 1JEJA 5JROA 1UBNA 4Q3NA 4MDYA 4F91B 3FVQA 3CPEA 4GI3A 2C3PA 3G9UA 1U5AA 4N5NA 2LE0A 2H29A 4IW3B 5JH7F 2XGMA 1JHOA 3PNQA 1QGZA 4LHWA 3DBLA 3FKSD 4ARVA 5LQJA 1DCMA