2RH8A

Structure of apo anthocyanidin reductase from vitis vinifera
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
328
structure length
312
Chain Sequence
KKTACVVGGTGFVASLLVKLLLQKGYAVNTTVRDPDNQKKVSHLLELQELGDLKIFRADLTDELSFEAPIAGCDFVFHVATPVHFIKPAIQGVVNVMKACTRAKSVKRVILTSSAAAVTINQLDGTGLVVDEKNWTDIPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPTLMAGSSLTSDVPSSIGLAMSLITGNEFLINGMKGMQMLSGSVSIAHVEDVCRAHIFVAEKESASGRYICCAANTSVPELAKFLSKRYPQYKVPTDFGDFPPKSKLIISSEKLVKEGFSFKYGIEEIYDESVEYFKAKGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Anthocyanidin reductase
publication title Structure and epimerase activity of anthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
total genus 112
structure length 312
sequence length 328
ec nomenclature ec 1.3.1.112: Anthocyanidin reductase ((2S)-flavan-3-ol-forming).
pdb deposition date 2007-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rh8A00
4B3IA 1NXQA 3D4NA 3HHPA 3MWDB 2B5WA 1P1IA 3JD3A 1P1HA 4FOSA 3S2GA 1B26A 3FBGA 1DC4A 3JQ8B 3OETA 1YQGA 2CUKA 2HKIA 1PSDA 3FR8A 3QVOA 4PLFA 4IDGA 3KM0A 2VOJA 5GMOA 3ETEA 4RDHA 2V6BA 4QX6A 4TSKA 2YZ7A 3FN4A 1ZSYA 4R3WA 5H81A 3OQ1A 3DR3A 3DZIA 4H3VA 2EW2A 4Y9DA 4YQYA 3SC6A 4B4WA 2EF1A 4K28A 4AJKA 5JS6A 3B70A 3GN2A 1CIVA 3PHIA 5TNXA 4KDFA 5JMWA 4ID9A 2GGSA 2AQKA 4P4LA 5B4VA 1R37A 2Z5LA 3JCZA 4F6LA 1KVUA 3GK3A 4QT0A 4PLZA 2BFPA 3IIEA 2D5AA 3IDSA 4DA9A 3PQDA 3QWBA 5EQDA 2BLLA 2FZEA 4CL8A 3PP8A 3JQ8A 2VHWA 3EYWA 4YA6A 1HLDA 3D5TA 3WYEA 4PG5A 1A4UA 4L9RA 3PK0A 3UN1A 4G81A 3BMQB 2GR9A 3D3WB 3W8EA 1PL6A 3O38A 3DFUA 3PPIA 3MJCA 4J2HA 3UFXA 1Z7BA 5IZCC 1E7QA 3LLVA 1ISGA 2C5EA 5JO0A 2O2YA 2VWPA 4GKBA 2Y0EA 1EE9A 2B83A 3FD8A 3W4KA 4OXYA 3NDJA 5KVSA 4OL9A 3GEDA 1OI7A 1VSUA 2YFQA 1SB8A 2NWQA 1JU9A 1GCUA 3H9UA 5IXYA 1NFFA 3WTCA 1DIBA 1MG0A 3A14A 4E12A 1VJTA 1ADGA 4NH4A 3VKVA 3NTOA 4BO9A 3KV3O 4B3JA 4ILKA 4BO0A 1JVBA 4MKXA 4MVJM 3VH3A 3WGZA 3ZWMA 4PN3A 3RJ5A 1JQBA 2B4QA 2G17A 1PJ3A 1YE3A 3KYDB 4QFCA 4R9SA 1YDWA 3LQFA 4Z0HO 1RM0A 4BMSA 1K0UA 5C7LO 1BXGA 2WSBA 3LSYA 3D3WA 3MJVA 1L7DA 4AVYA 2WD7A 3WIDA 5JDCA 4YVFA 3EZLA 5HTOA 4FSHA 1SOWA 2HCTA 1TLTA 2FR1A 3DHNA 5HM8A 3L6OO 5I9MA 1JWAB 4A0SA 5ILOA 1EVYA 5AXDA 1ADFA 1PJSA 1DSSG 1M75A 2EP7A 4Y8VA 4ND5A 1L7EA 1ONOA 2P4QA 4LK3A 1A5ZA 3DBRA 4GKVA 1MP0A 2C7GA 1E1LA 1AGNA 3AY7A 2RIRA 3RKRA 5JAQA 4GBJA 5KVVA 4N7RA 4DBVO 4BKQA 2Z1MA 3F4LA 4IIVA 3WMXA 3RFTA 3VPSA 1H93A 3G79A 4PLWA 1QV7A 1DBVO 1NQAO 1KBZA 5G0UA 1T1RA 3LC1O 4W4TA 3WQQA 1BSVA 3Q1LA 4CM9D 1PJQA 3WS7A 3BAZA 1Q0QA 1ZH8A 4MVJP 4H16A 5C7IO 3T4EA 1P1JA 4XQCA 4LRTB 5G4KB 5KTKA 1GD1O 2VWQA 3ZWPA 4A73A 4OQYA 4YCAA 4NBUA 3NEPX 2VOEA 1Q1NA 1DLIA 2VRCD 3K92A 5G0VA 2GUGA 2Q4EA 1CERA 1SEVA 1SOVA 4M55A 4N5LA 4D3DA 3ROKA 4BNYA 3BMNB 4OSPA 4AJIA 4IPTA 1M2WA 4R1NA 4PLGA 4ZGWA 3WG9A 3RKUA 4E2XA 3OJEA 3MJTA 5JY1A 5LDHA 1HL3A 1UZNA 1YGYA 2E6UX 5L51A 3NJ4A 1Q7CA 3OA0A 4F3YA 1NFRA 3UGKA 3I4CA 4MIEA 3IAHA 4L4RA 3JQAA 4I5FA 1GYPA 4WKGA 3ZGYA 3GQVA 1ULSA 1T2EA 4J90A 4OIMA 5G4KA 3ICCA 4LMRA 2IYPA 4ZVVA 1H6DA 3MTJA 1LSUA 2VHXA 1I30A 5CP8A 4QFDA 4B8ZA 3RFXA 1ML3A 4EW6A 5B37A 4Z0PA 1XA0A 1I32A 2W2LD 4IGEA 4FPXA 1F8FA 2D8AA 1K3TA 4OQZA 3C3XA 1EEHA 1UXJA 2VTEA 1C14A 4RPHA 4EEXA 5JCJD 1BRMA 4NJMB 9LDBA 2PA3A 3FHLA 1T2FA 2QW8A 3LK7A 2PWZA 3DZKA 3GRKA 3WYCA 3AFMA 1N2SA 1NM5A 2WMDA 2B4TO 5L4LA 3TQHA 3RD5A 4GLLA 2SCUA 4D44A 3MJ4A 4QXMA 1MV8A 2HMWA 3ICPA 4OOFA 1H2BA 2OMEA 1DRVA 1T4BA 1NX6A 1PWXA 5TS3A 4BO8A 5DP1A 2OZPA 3R0IA 3ENNA 2J6IA 1ID1A 4MPDA 2GCGA 1NPTO 3JTMA 1LRKA 1Z74A 2Q2VA 1MA0A 3QQPA 1NQTA 5BSGA 4CMCA 4UUMA 1ISMA 2Y05A 3U09A 1XDWA 2V6GA 4KQXA 4DVJA 2EXXA 1ZK3A 2Z95A 2E48A 1NASA 1OOEA 1ZIDA 4B4OA 5HS6A 5JYEA 1WWKA 2HUNA 2X0JA 3VVCA 4CMHA 3PTZA 4W9NC 3D4OA 1X0VA 2Z1NA 1UZMA 4UUPA 3C1OA 3DBHB 3TOZA 3RC7A 2CMDA 1WDLA 4WLEA 1IHYA 3CEAA 4GLOA 2YDYA 3K6JA 4J2OA 5T64A 1MFZA 2H6EA 3OICA 3WWZA 2VYVA 1LTHR 4D79A 2X23A 3V8BA 4E33A 3GGGA 4L0QA 4BNMA 1GUZA 3NUGA 2O4UX 2UYYA 1I0ZA 3AU9A 3GEGA 2JD2A 4GPD1 4QSMA 2DBQA 1E6WA 4WEOA 1WMBA 4HX5A 1EFLA 2D1YA 4DTIA 3GZ4A 3CUKA 3OIFA 4JLWA 4CR8A 5A9RA 3ITDA 4EJ6A 4Y6RA 3WYBA 2EGHA 4DLAA 5FFFA 4DIFA 1LDGA 3WFIA 3OQ6A 3ANMA 3NTQA 1E7RA 4MVJA 1F17A 3DOJA 3CMCO 1MC5A 3O9ZA 4R1TA 2C29D 2NLOA 3DBHA 4KMSA 3CZMA 4G5HA 2WYWA 1ZBQA 3V1TC 3PHHA 1KOLA 4P22A 1NPYA 1DEHA 2PZLA 2B4RO 1HKUA 2HU2A 4R3NA 1GR0A 3C1TA 3OF2A 3SLKA 4RJTA 4P38A 5JBIA 4ROSA 2IYOA 3K96A 5JE8A 4QTZA 3W4IA 5ITVA 1BXKA 4DBZA 3ZU3A 1XSEA 3JSAA 4CLOB 3KYCB 3HDHA 3AUTA 1AN9A 4P8RA 1T2AA 3P2OA 1XIVA 2P5YA 2X5KO 5HRUA 4GX0A 1NTOA 2I3GA 2Y66A 4I5DA 4FGWA 1E6UA 1KVQA 3GVHA 4O1MA 3FCOA 5F3RA 1LRLA 3U9LA 1A9YA 3BZUA 1NR7A 4ZICA 3ZI0A 1HWYA 1ISFA 4GX1A 1U1IA 2H1SA 4L4SA 4WPGA 1VPDA 3IMFA 1HYEA 4OXKA 2WEKA 1DIHA 3PFWO 4JJGA 1HZJA 4ZQGA 3WBFA 2WE8A 5CG2A 2PKQP 1GV1A 1WDKA 3G1UA 3PHGA 3UW3A 3N74A 3V1YA 1B8VA 1P3DA 1V3VA 1VE9A 3WB9A 3WDSA 4NBWA 4C7JA 3GPDG 3KSZO 3V1UA 5A4DA 2AE1A 2DBVO 1QLHA 3JD4A 1B8PA 3KBOA 2VZ8A 4DPLA 1LU9A 1PIWA 4OOEA 4B4VA 4CUZA 1TT7A 4FFLA 3UICA 2EP5A 4CM5A 1AE1A 2PGJA 3S55A 4YRBA 1HDRA 5HBRA 4AJ4A 4AG3A 4Q39A 4BNKA 3OHSX 2NQTA 4IXTA 3H9JA 2J3JA 1B3RA 3K2EA 1QG6A 4YRDA 4B79A 3NDIA 4FC7A 1QV6A 5A3VA 4M1QA 1ONNA 3OIGA 1PR9A 3QE3A 4RPLA 2O2SA 4MKRA 4FFMA 4WECA 3UAGA 3X2EA 1NBOA 3B1JA 4YR9A 3HQ4O 4YEDA 3SX2A 2P68A 3F5SA 4NIMA 5HS4A 2YV2A 1NQOA 3ONEA 2AQ8A 4JGBA 2Y99A 5TF4A 5DOZA 1LUAA 3WOHA 2FPIA 3GEMA 3IKVA 4RPGA 1TVEA 1ZZEA 3P2YA 1Z6ZA 2J5QA 5K6AA 1BVUA 1ZXBA 1CYDA 4S1VA 2O50A 4XD2A 1VKNA 4MOWA 1X7HA 4B7CA 3RQSA 3I9KA 3LYLA 5IXSA 1LEHA 3D0OA 2J3IA 3PWSA 2EJWA 1DRWA 1LC0A 2RHRA 4OXNA 1NWCA 1P33A 2XXBA 2F1KA 3GAFA 4ALKA 5A5EA 2EJVA 2O23A 1YL5A 1HF3A 3HB5X 1C0PA 5CPBA 3E9NA 3VC7A 4YRAA 3C7AA 5J23A 3W8FA 2E82A 5AXAA 3SEFA 1HE4A 2PZJA 3JQFA 4D3FA 2IRWA 2R2GA 1WP4A 1T2DA 4CLRB 2ZCUA 1PJTA 3K2BA 4KZPA 3G0OA 5FEUA 4N5NA 1E7WA 1XQ1A 3V2HA 4DYDA 1BWSA 2AHRA 4XWYA 4WNIA 1Y5MA 1R4MB 3RI3A 4IGFA 3ZWCA 5IAAA 2NM0A 1HYHA 4GGOA 3UOGA 2HK7A 3H3FA 1HDOA 1DPGA 2FWMX 2GN9A 1YOVA 5F1PA 4X54A 4BKOA 1EK5A 3I83A 4JJIA 3P7MA 5DZSA 4DC0A 1H0KA 3W1VA 5BNIA 1DIGA 1J6UA 4YTEA 2ZTLA 3IKTA 2OUIA 4L76A 2UUPA 2VWHA 3OQBA 3VVBA 4PLPA 3NDRA 2X9VA 1P45A 3JQ7A 2BRUA 2C54A 1ISIA 4LSWA 1KVTA 4LSMA 2FPPA 1IY8A 5JCXA 1U28A 3T4XA 4PG4A 1YJQA 2GSDA 2YY7A 4ZRMA 3CZRA 5IDYA 5JDCC 4CL3A 1C1DA 1ZCJA 2UVDA 4ZN6A 3I9LA 3BTSA 4YJHB 3SJUA 2Q99A 2X22A 4OGWA 1HSZA 4JN6B 4TVBA 1D4FA 4RVGA 3D64A 5A03A 4UVDA 2NQ8A 2O3SA 5LCXA 3LC2O 4ITUA 3EK2A 4PLVA 3Q3CA 2AEMA 1HEUA 4XX0A 1LDBA 1IL0A 1Q7GA 1X13A 3C8MA 3JQGA 4LGVA 4FFOA 3ZCXA 4DPMA 1DIRA 4NZ9A 3WGYA 1K5HA 4L74A 3JYPA 1CWUA 3KEOA 1AXGA 1GV0A 1R6DA 4OM8A 2DTDA 1U8XX 3F9IA 2GZ3A 3PFFA 3MOIA 4J0EA 4YJHA 3DEYX 3EW7A 4WCFB 2I66A 1H9BA 3S2IA 5L4SA 1QXSA 2P2SA 3D4PA 2FRDA 5B4UA 1I10A 3M1AA 3WJ7A 3HSKA 4UULA 4J43A 2D3TA 5T8KA 3GNSA 3E48A 4FJ2A 4IY1A 1J0XO 2Q50A 4ALLA 1EVJA 5ER9A 2Y67A 1LC3A 4GQAA 5DF1A 4FQ8A 1GQQA 1Z7EA 3ROPA 4A26A 4XDZA 2WYVA 1YXMA 3TWOA 5I8WA 2BD0A 4NHEA 3BYZA 4Y98A 4W7HA 3I9NA 1GQYA 5BNFA 7ADHA 3ZWWA 3WQSB 3L4SO 4RF2A 4DQUA 5IDXA 3ETDA 3ZWBA 5JXWA 1C3VA 2JAHA 5JO9A 3T7EA 1FDUA 1P0CA 1FDVA 2QHXA 3RBZA 5THKA 5TJ9A 4FIZA 1IYZA 4NPCA 3OBBA 4RVFA 4J1NA 4WCFA 4CM1A 2X0IA 1DHRA 4J7UA 3IL2A 1PJ2A 3IUPA 3A9WA 3FNGA 5CHEA 1HTBA 1VKOA 6ADHA 4NK4A 4NFSA 3DOCA 5CDTA 2GLXA 4NJOA 1S7CA 4NBTA 4U8GA 5A9TA 2Y1GA 2ZJ1A 4CV0A 3JYOA 1EFKA 3HUDA 3RU7A 3KSUA 3ZWVA 4YJGB 1M66A 1QLJA 3GT0A 4J1TA 4WJZA 2ZB8A 4BO1A 5CDUA 4R1SA 3ZDFA 4JBHA 4LVUA 3RBXA 1LLCA 5TLSA 3DZJA 2JD0A 2X58A 1OMOA 4IUYA 4WE3A 5L4NA 3L6DA 5JAMA 1JTVA 3DMYA 3U4IA 5ENVA 3U4HA 1PU2A 1JA9A 1PZEA 3U49A 1G0NA 3HB4X 4KTTE 3H2SA 1X7GA 4G2NA 3VAZA 2CSUA 2O48X 3BXXA 1SNYA 4GSKA 4QQRA 3NT2A 4B8WA 2QX7A 2IEDA 1CEQA 1CF2O 3DZFA 3VPHA 3CINA 1T2CA 1DO8A 2P91A 4LCJA 4XYBA 4U0JA 5L3ZA 2YJZA 2Y0CA 2YQ5A 4YJGA 1LQUA 2B69A 2BH9A 3DZBA 4P4GA 3UCEA 3B6ZA 4H7PA 5I7EA 1MLDA 3G3EA 2YQ4A 1R4NB 1LX6A 2FPGA 1WVGA 3JYQA 1QYXA 1M6HA 2ZIZA 1HE3A 2EHDA 4YQZA 3LT1A 1Y81A 1RM3A 1JVSA 2C5AA 4KUHA 4J6FA 4CM8A 1EVIA 1YBMA 2D59A 3AUSA 4OYRA 3MCVA 1MC4A 2VUUA 3PGJA 3RUAA 4CMEA 2JFGA 3DWFA 1PJCA 3H5RA 3ZNOA 2GNAA 4TKMA 1GDHA 4MIYA 4RL6A 1QP8A 2P9GA 4PG6A 4HWKA 2GDZA 3DDNA 3H8VA 3WGOA 1YL7A 4TZKA 1HXHA 3DMTA 3LLSA 3TPCA 2X0RA 5DP2A 1JLLA 3O26A 5IJZA 2OL4A 2O3JA 4PLHA 4OKIA 4E4YA 4BO6A 3C7CB 1R4NA 4KDEA 4Z9XA 1O6ZA 3QY9A 5T5QA 1GYQA 3R1IA 1ZJZA 3QA9A 5KNLA 3HN2A 2NVBA 1NPDA 1QR6A 4HUJA 4AJPA 1EE2A 1ZW1A 2ZQZA 1X7DA 2G0TA 3OH8A 4JP3A 5CDGA 3G17A 4I8XA 1OBFO 1KERA 2JCXA 3DFZA 1BXGB 3GNQA 5F1OA 3BTVA 1UDAA 2H63A 4R54A 5C37A 1E3SA 1GAEO 2QYTA 4DUPA 2WD7B 3PWZA 3TL2A 3ZWYA 1CETA 3H5NA 4Z0TA 2BGKA 2I9PA 1HRDA 4JBIA 5L7TA 2HMSA 1RM5A 1GY8A 1L1FA 2WWRA 4OO3A 4DYVA 4GI2A 3HG7A 4W6ZA 5C3MA 1O89A 1NR1A 4XRGA 2O3QA 3GC6A 2RH4A 5KKAA 2CVQA 2Q3EA 5JLAA 3JQEA 3DBRB 2PGDA 1NYTA 2PY6A 3N7UA 5CDSA 2D0IA 2HMVA 4AJ1A 1OZAA 3ASVA 3V5NA 4BIIA 4DMMA 2NSDA 4N5MA 2ZTUA 4NG5A 4BKPA 4D45A 4E31A 5A5FA 3VZQA 3UHAA 2CVOA 5ICSA 3PDUA 4II3A 5K9ZA 3CSDA 4LW8A 1D7OA 2ZYAA 2HRZA 4PZDA 4JX8A 4IBOA 4J4BA 1PS8A 2BI8A 4YJDA 4B7XA 3GVXA 2CY0A 5CEEA 1FDTA 2B5VA 3M2TA 2PZMA 3JQ6A 1UXGA 1Q0LA 4BV9A 4JP2A 4YACA 3INGA 3RAJA 3NJ8A 5ES3A 3AW9A 4TZTA 2NUAA 2FSVA 1P74A 5F1KA 5EJ2A 1ZEJA 3K9QO 3ROQA 3AJRA 1NHWA 1KIFA 2VHYA 1OAAA 3FNEA 4Q3EA 4CQMB 1HYGA 5ER6A 4CMKA 1PQPA 2DPGA 4J7CA 3O4RA 4Q3CA 1CRWG 1DLJA 1E3JA 3DHYA 2WE7A 3DAPA 1R66A 3PYMA 2VT2A 4R5HA 2VYVD 3ZW9A 3GVPA 4RF4A 5DT9A 4YAIA 4N18A 3ZNNA 3ANNA 3L77A 2GN6A 4MDHA 2QG4A 1E5QA 1ZNQO 1HDYA 1PZHA 2AG5A 4DWVA 4NNJA 3AM4A 4C7KA 2BELA 3JQAB 2NV6A 3B1FA 1IZ0A 1S6YA 4TROA 4URFA 5IDWA 1E3WB 2W8ZA 2Y1FA 2J3HA 3E5RA 4E2YA 3RC2A 2WM3A 4KOAA 4BNFA 2R00A 1E3LA 1U5CA 1RJWA 2ZB7A 4EI2A 4BOYA 1PWZA 1B2LA 5JPIA 4CQMA 4FFPA 2AEFA 4EITA 3GN1A 4XQEA 5TSDA 4U0KA 2VQ3A 5K6AC 2Y1OA 4GMGA 3G1TA 2RBEA 4PVCA 3BHMA 4QECA 2PV7A 4R9RA 3I5MA 4MP8A 5JC1A 4DREA 3X2FA 1E92A 1GZ3A 1K2WA 2I99A 1CJCA 1E1NA 1Y7TA 2WJPA 1YS4A 1E1KA 2YV3A 3SLGA 3PGXA 3RVDA 2AXQA 3PI7A 4JIGA 1E3WA 2DBZA 3KVOA 4UUOA 3AUUA 4INAA 3UXYA 4DL9A 2DKNA 5KIAA 5TRTA 5FYDA 3JQ9A 2OP1A 4BNHA 2IZZA 3AK4A 3JQFC 1YB5A 4EUEA 1ENOA 4KWIA 2JAPA 3AU8A 1ADCA 2DTXA 1DB3A 1MXHA 4G65A 4I5GA 4DGSA 2FP4A 3P5SA 1BTOA 2UDPA 2YUTA 3GUYA 3UH1A 3W4JA 3A1NA 4NFYA 1DC3A 3AY6A 4JK3A 1MUUA 1TA4A 3KLPX 2BFMA 3H5AA 3H65A 4IXWA 3GMDA 1VSVA 2HAEA 4HADA 5EL0A 2W4QA 3HJAA 1P1KA 3H3JA 2G82A 3QWAA 3DBLA 2DLDA 1LDNA 5CPFA 4R41A 4BO3A 4ZQEA 4QO8A 4BGEA 1EQUA 4DC1A 1MG5A 3LT2A 3AI2A 5FWNA 3GY0A 4I5EA 2HJRA 1GZ4A 2PNFA 4R01A 4CM7A 4MVJE 4YT5A 4DQVA 1T25A 4IDFA 2AA3A 4A5OA 3FSRA 4A27A 9LDTA 4KTVE 4O6VA 1BGVA 1J4AA 3VTZA 3U62A 1QKIA 4HV4A 5EN4A 3RSHA 3K73O 4MVJG 4E13A 2JHGA 4O59O 3K31A 3MZ0A 4AFNA 2Q1SA 3TNLA 3HNPA 3RUEA 3WGHA 2RH8A 1IZ9A 5HA5A 3BMCA 3GH3A 4GWGA 5TX7A 4BO7A 2FR8A 1U7HA 4E5KA 2J5RA 3OJOA 1ZKMA 1X14A 4XKJA 5AXCA 3S2EA 4XYMA 5A02A 5F5NA 2LDXA 4ONEA 3UUWA 3K8ZA 3WTBA 2Q49A 3JQBC 2D5CA 1T1SA 2EERA 1PS0A 3LT4A 3PHLA 2X5JO 3OM9A 5U4QA 3CXRA 3OA2A 1VL0A 4FC6A 1ULUA 3PQEA 2O7QA 1X1TA 1E3IA 1XU7A 5L40A 2E4AA 1DAPA 1V0JA 2J5KA 1BW9B 3L6EA 4XGIA 4PGFA 1B7GO 4M8SA 1I2CA 1SPXA 1FXSA 3GAZA 4UVIA 1VRWA 3L4BC 4Q9NA 4J9UE 1GYRA 2EEZA 2IZ0A 4RQUA 1JN0A 4XB1A 4Z3DA 5ICMA 5BR7A 4Z6KA 4CM9A 5EQFA 5JDIC 4IQ8A 4PZEA 4JBGA 2DPHA 4PZCA 4TWRA 1YDEA 2YDXA 4KUEA 1DXYA 3M2PA 3F6YA 3U3XA 4F46A 5DCUA 1OFGA 1JKFA 4ZU3A 5A04A 1I01A 1EUDA 4I1IA 4RPJA 4BGIA 3HWRA 1YB1A 2CFCA 4RV9A 4M54A 4Q3NA 1P77A 1BG6A 1BW9A 1PS9A 3JQCA 3DTYA 3W8DA 3S2FA 4FFRA 2VUTA 1I24A 2OHXA 3Q9UA 1ZVMA 1ISJA 2POQX 5DCYA 3QSGA 5ILGA 4ALJA 4JQCA 2V7PA 2GYYA 1F12A 1PTJA 3FPLA 3W6UA 1MX3A 2IODA 4WCFC 1IPEA 1UXHA 1F14A 3Q9NA 4BUCA 4CMIB 2ZQYA 4ALIA 4TRNA 1A7AA 2X86A 4CM6A 4DLBA 1N9GB 2RHCA 1XEAA 4BHTA 3WGGA 4A2CA 1DIAA 4IJWA 3I23A 4E5MA 2P9CA 2GN8A 3QWHA 4H15A 1U4OA 3GPIA 4YPOA 2OORA 1O0SA 3ZV4A 2W2LA 1Q2XA 3JV7A 1TEHA 3AI3A 1SB9A 4RVUA 1R12A 3KLMX 3E9QA 4J3FA 3QVWA 4YAKA 4XB2A 3RC9A 2IXAA 5JCJA 1YL6A 3DC2A 2HMUA 1WNTA 1UAYA 5K0ZA 4Q3AA 5DBGA 2W98A 2B35A 3BTOA 4CMIA 4XJTA 1QYWA 2VZ0A 1P9LA 1Q7BA 4WOKA 1N9GA 3WBBA 4HNGA 1RYEA 1U2DA 3RBVA 1NP3A 4HXYA 4HNHA 4K26A 2IDZA 1V35A 3RWBA 1XELA 1BXZA 4UREA 3OIDA 1LJ8A 1E7YA 4BMVA 4J4HA 2IZ1A 5COBA 5DBFA 3HN7A 2CZCA 2HRBA 4BL5A 1HDZA 2BKAA 4IMPA 2HK8A 3E03A 3ZNPA 3JD1A 4HFNA 3K5PA 4Z9FA 4QO7A 1LQTA 5BSHA 5CEJA 2Q1TA 3VZRA 2C2YA 4ND2A 4TVOA 1TT5B 3VPGA 3AY3A 3VH1A 1RYDA 2GERA 2CDBA 3C7DB 4J1QA 3QW2A 3DTTA 4UVHA 2PZKA 3NYWA 3TZCA 4YT4A 1R0SA 3FWZA 4A7PA 3A28A 3HDJA 4YJFA 4U6QA 1R0LA 4L75A 1Z75A 2DUWA 1ZXLA 2Q4BA 3DMTC 2J8ZA 3M1LA 1H6CA 1SO8A 4AJLA 4J9VA 1YOVB 4YWJA 2BGMA 5B12A 1QMGA 3FF4A 5KJCA 1SBYA 4HP8A 5I9LA 1PX0A 3H7AA 2FZWA 4EEZA 3C85A 1KYQA 3I1JA 5I8ZA 1ZJYA 3MJSA 4K1LA 3JQ7B 1TT5A 1FF9A 4L8VA 3V2GA 4Z9YA 3DZHA 1U5AA 2CF5A 5AOVA 3FPCA 5BSEA 5IN4A 1YQDA 2BGLA 2YV1A 1ZO8A 2GZ1A 1C1DB 1AHIA 3NGLA 3PQFA 4FR5A 5BNTA 3MOGA 1V6AA 3ITKA 2CDAA 6LDHA 5JAIA 2QYSA 1WPQA 2OP0A 3EVTA 4WNCA 4BS9A 3ZHYA 3TDKA 1NAHA 1GCOA 1VC2A 3C1AA 4AJJA 4O5OA 1GUFA 2HLPA 1V3TA 2O7SA 4OHUA 4DQXA 2Q2QA 5JYDA 4IZHA 4RORA 5H83A 5AQ1A 4R51A 4J7XA 4EUHA 1Z45A 4NBVA 3JQGB 1M67A 1T24A 1GL3A 1N8KA 3I9MA 1V3UA 3OMLA 4LRSB 2EW8A 3E18A 4QEDA 3TOXA 3E6AA 3GHYA 3NX4A 3TSCA 3UF0A 4MVJF 4BNIA 2HSDA 1EZ4A 2Y1EA 1E7MA 1I2ZA 2DC1A 4PRKA 4J1SA 2VZ9A 2C0CA 4YDRA 3DO5A 3U0BA 2AQIA 2B36A 1UJMA 1PZFA 4IQ0A 2FY8A 2VYNA 3PYXA 5BQFA 2Y93A 4D43A 4LN1A 1GZ6A 2E37A 1LDYA 4DLLA 2O3UA 2JCYA 3ABIA 3L9XA 2ZKLA 4CQLA 3FWNA 2BHLA 3LU1A 4W9NA 4WASA 3NTRA 2VCYA 4NU5A 1I2BA 1B8UA 5L7YA 5L95A 4AJNA 4EZBA 1DJNA 4CV3A 3FTPA 4JNKA 3SJ7A 2YHUA 4XGKA 1N5DA 1MGOA 1YH3A 2I6TA 1J49A 3PRJA 5GZ3A 1IUKA 2O4CA 2VNAA 3GGPA 2HDHA 2C7VA 2YHIB 3BHIA 3BMOB 4I9HA 4E5NA 3PJGA 4RDIA 2X4GA 3PJEA 3GUCA 1LLDA 3GVIA 4CMAA 4MVJI 1GEGA 3IC5A 2QRKA 1BDBA 5U1PA 3DZGA 2V6FA 5I7SA 2AEJA 4HY3A 3ZU4A 3KETA 3BA1A 1YJ8A 2XF8A 3NT4A 4YXFA 4CMGA 3QVTA 3HZZA 3PYLA 3MEQA 4F6CA 2VWGA 3WICA 3D7LA 3CKYA 3OSUA 4JROA 1KVSA 4WLUA 5AYVA 2YHIA 4OH1A 1PL8A 4ND3A 1XLTA 3BMOA 3DAFA 3GMSA 3SC4A 1X15A 3MWEB 1A72A 4OSOA 1A71A 2PK3A 5LDGA 3RUDA 5KJ1A 5BSFA 2GD1O 3IP3A 3I52A 4U6SA 1KS9A 1XQ6A 2P9EA 3JQ9C 2IEBA 4AL4A 3VPXA 4XGNA 2RAFA 3GGOA 4UUNA 4DMLA 4E2WA 4D0SA 4IDBA 2EIHA 1U3VA 1I3MA 2Y1CA 4R69A 5G0TA 2FOIA 4R5MA 5C7OO 3MJEA 1UH5A 3NKLA 2G76A 3IJPA 5JFOA 4BQPA 3VHRA 1M76A 3TN7A 1ZK0A 4CM8B 2EGGA 4J49A 3ZHBA 1O8CA 1QYDA 1XU9A 3VOSA 1JDJA 2AMFA 3WNVA 3ZV3A 2CF6A 3O8QA 3R6DA 1LSSA 4XR4A 5KVQA 3RUFA 3PZBA 4Y67A 2X5OA 3F5QA 3FR7A 4WLOA 3DQPA 1SZJG 3WGQA 4ND1A 1H6BA 1XR3A 5KOIA 3KOUA 3SXPA 1VL8A 1LBEA 5TJHA 5IN5A 3H9EO 4ALMA 4FBGA 4WGGA 2EV9A 4ALNA 1B15A 3RUHA 2OBNA 2PD4A 2YW9A 1I3KA 3AWDA 2J3KA 4R4JA 4DIBA 3GOHA 2PD3A 2GRAA 3Q2IA 1ARZA 2A9FA 2GN4A 4BNWA 1Z73A 2I67A 3ANLA 3NAQA 3KB6A 4PRLA 1XG5A 3OJFA 3T7CA 4RZIA 1ZUD1 3U4DA 1ZEMA 1CQJA 1N1EA 3ETGA 3GRPA 1GTMA 3PIDA 3WX0A 1B14A 1ZK2A 2RCYA 5TT1A 4ZRNA 1ZK4A 1TI7A 4ZD6A 1DFIA 1WXDA 1DFGA 4UVEA 2JFFA 5FI3A 4YB8A 2JD1A 5DBIA 3CIFA 2PFGA 3OJLA 1I5RA 5TGDA 3KUXA 1X1EA 4CQMD 5KCZA 2H5LA 3STHA 2NVUB 3MTGA 1QORA 1WZEA 1O94A 4MO2A 3B20A 3KXDA 1D1TA 1J5PA 1JWBB 1BDMA 2X7HA 2ZB3A 4XZ3A 3UVEA 3IS3A 4TKLA 5I7VA 4BMNA 2YFHA 3COSA 4M86A 1N7GA 1PGJA 4DRYA 4B4UA 1ORRA 3QIVA 3QJ5A 1R16A 3U4CA 3JQAD 1BMDA 1A9ZA 1U4SA 4PIVA 3H4VA 4LISA 1PJLA 4A10A 4GX5A 2Q1UA 1GPJA 1DJQA 2W2KA 1OC4A 2ZK7A 1Y1PA 3EVNA 1H5QA 2FN7A 1YRLA 1NQ5A 3JD2A 3ADOA 2IE0A 3OP4A 2ZYDA 4IJKA 4I08A 2ZYGA 1PJBA 4FDAA 2NVUA 4O0LA 3WIEA 1AXEA 3DAGA 4HKTA 1SC6A 2AE2A 2GF2A 3AOGA 2HO5A 2BMAA 1ADBA 1E3EA 4J91A 4IJVA 4ESOA 3GFGA 1WLYA 2CD9A 3ZN2A 3RUIA 2GASA 3NV9A 3DHEA 4FJ1A 4XIJA 3ADPA 4TQGA 2XPCA 4BO4A 4EYEA 5ITWA 2A92A 1B3BA 3GVCA 1DAOA 3FBTA 3A06A 1VI2A 4FB5A 3EHEA 1C0IA 4IMRA 5DN9A 4PG8A 1YONA 1EDZA 1XKQA 1DOHA 5KKCA 3WJAA 3ZV6A 1N92A 2Y68A 2YYYA 1W8DA 1W4ZA 3FRJA 4BQRA 3KSDO 1XWFA 2I5PO 4YT2A 1Y8QB 3RJ9A 3NGXA 2GPTA 3WMWA 4BB6A 3KYBA 1U3UA 4CLEA 1QYVA 4CR7A 1O9BA 3E1KA 3TZHA 3TZKA 4BNZA 3NRCA 2DM6A 1SMKA 3PLNA 3BMQA 2X9GA 2DUUA 5LC1A 4FD3A 5F21A 1IE3A 1RM4A 1LXCA 3I6IA 3TFQA 3F3SA 1U3TA 1I36A 3WSWA 2BI7A 4CLDA 5EIOA 1YB4A 1F8GA 3QV1A 1G0OA 3WNQA 4E30A 2X8LA 3Q6IA 3RU9A 3K30A 5COAA 5TQVA 1YBVA 3QRWA 3KHUA 3EDMA 4EDFA 1OC2A 4YAGA 2A35A 1EBUA 3VKUA 1SEPA 4Y6PA 3PVZA 1Y8QA 1B16A 3IP1A 4IDEA 1LRJA 2O3TA 4MP3A 3KO8A 4B3HA 3DBVO 2AW5A 3KYDA 1DHTA 3AOEA 2DU8A 2DFVA 2P4HX 3JQDA 4QUKA 1HLPA 1I33A 4NMHA 4Q3BA 4IDAA 1HDXA 5IF3A 1E0DA 3HE3A 3WR5A 3TF5A 1H2HA 2TMGA 5DCWA 3BIOA 4PCVA 3IUSA 4XR9A 4II2A 4MVJD 2DT5A 4NI5A 3WLFA 4RVSA 1CQIA 1HE5A 1U9JA 5DULA 3UCXA 4BGVA 4R68A 3JYNA 3ZZNA 2Q45A 1GFSA 3WGTA 3ZNQA 1EUCA 1NAIA 1LA2A 1X0XA 3WXBA 4HBGA 2ZJ0A 4NK5A 4XQGA 1GUYA 5F5LA 1IHXA 1PJ4A 4CV2A 3RCBA 4BV8A 5KJFA 4YAEA 1B0AA 5JNLA 4MKZA 4RO0A 4XDYA 1YVEI 1QRRA 3DBLB 4GSLA 5TT0A 5T67A 1F0YA 4OMUA 5A9SB 4MIOA 5CAEA 1EUZA 1FJHA 4YYZA 5HWSA 1FK8A 5BT9A 1AHHA 1XHLA 4Q3DA 1C0KA 2DFDA 3EY4A 1PR3A 1YBAA 3OFSA 1PGQA 1Z82A 5JY6A 2XOXA 4IS2A 1PZGA 4J4TA 4N54A 5IZ4A 2DQ4A 1UP7A 2EWMA 1P44A 1ENYA 1PGOA 4DPKA 5TC4A 4WEQA 5B1YA 3PWKA 2TMDA 4W7IA 4WLFA 4Y6SA 3BMCB 1UXKA 5ADHA 4CM3A 1LDMA 5EINA 4XA8A 3PIIA 4IINA 4NR0A 3ON5A 3BMNA 3L9WA 5A9SA 1ISHA 1YKFA 2OFPA 1NHGA 1LLUA 4CR6A 3S1LA 1HETA 4MINA 4TMFA 5GZ1A 2IXBA 1TXGA 7MDHA 2HQ1A 3EC7A 3RIHA 3AM3A 5CG1A 3JD0A 2OGUA 1U8FO 2PTGA 5FI5A 1MFPA 4C4OA 3GG2A 4TRRA 4D42A 1DFHA 2NU9A 3ZHXA 1VM6A 3TZQA 4EGFA 3GZNB 2VNSA 3IQDB 3VZPA 4RVDA 2C20A 3OEWA 1UR5A 4M49A 4PLYA 3O03A 1V8BA 1IOLA 2ZB4A 3EUWA 4GVXA 5COQA 3LF1A 4EBFA 4NU6A 1LNQA 1UP6A 3C24A 5B4TA 4NJMA 3HFGA 4RF3A 1QYCA 3ONDA 4CLXA 1WDMA 1A4IA 2QIOA 4I9UA 4KP7A 1TB4A 4J16A 3G49A 2CDCA 3A4VA 4K6CA 5AXBA 1UP4A 1H6AA 4FOOA 3LDHA 4GX2A 2JCVA 4CV1A 3EZYA 5IFLA 3VDQA 4WUVA 1UAGA 2HK9A 3GZNA 1F06A 1A27A 3EAGA 2C82A 5GY7A 3W6ZA 3GLQA 4CMJA 1KEUA 4WK6A 3VPFA 1D8AA 3VZSA 1NVMB 2EKQA 4E5PA 2CVZA 5JAZA 1ZSNA 4FCCA 2Y0DA 1H94A 1K6XA 2BF7A 3NT5A 4MP6A 4OAQA 4BO5A 2HJSA 4O63O 4W99A 4RQTA 1NNUA 4GMFA 4TRMA 3LVFO 5T8KC 2I76A 3LT0A 2VHVA 2XXJA 4D3SA 1G6KA 3INTA 3KRTA 3GFBA 2W90A 2X0NA 3I6QA 5A06A 3IOYA 1JKIA 1NVTA 1XGKA 4XYLA 2VRCA 3PJFA 4GH5A 4D7AA 4DXHA 4RVHA 1E1MA 2AG8A 5T57A 3WLEA 5IZCA 1VJ1A 3QP9A 1YO6A 1GU7A 4BNJA 4FW8A 1ZSVA 1O95A 1MB4A 4PFJA 1H9AA 2F00A 4E5YA 8LDHA 4L4XA 5MGBA 3GNTA 1RWBA 5G0SA 1JKJA 4ZHSA 1AUPA 3PZRA 2VHZA 3F46A 5DOVA 2E49A 1KVRA 4EUFA 3ZWAA 4XJSA 5G2OA 3TRIA 3ZW8A 3BHJA 3LZ6A 4XYEA 3VH2A 4UVGA 4XQ9A 4XEHA 2DVMA 4D41A 2ZATA 2UAGA 3L0DA 2JKVA 1A7KA 4M87A 1PL7A 1R15A 3GG9A 3QHAA 3INRA 3GHHA 3DOOA 1YQXA 3I9JA 4IDCA 4BVAA 1UDCA 3TJRA 1DRUA 1GPDG 1RKXA 4GL4A 1P0FA 1PQUA 1GEEA 1U3WA 5AVOA 5JMPA 3OECA 5JC8A 2VRBA 1UZLA 2NACA 2NADA 2VYND 5U9CA 1UXIA 4CODB 2FMUA 5KVCA 3KZVA 3RROA 3HDQA 4F45A 3PHJA 1ZMOA 3E9MA 3ZV5A 5EESA 5KJ6A 2BFAA 2NTVA 4GGPA 4CLOA 2WD8A 3GA0A 1MXFA 2EG9A 3KYCA 3VDRA 4YJFB 1Y9EA 2NTJA 4AJEA 1JAXA 1HSOA 2R6JA 4A03A 1LDEA 3GF4A 1IPFA 4IM7A 4PVDA 4IDDA 1CDOA 2HMTA 2NU7A 3PEFA 2O3RA 2P5UA 3RUCA 4PLTA 3Q2KA 1HE2A 4E6PA 4XCVA 2NNLD 1D1SA 2ZTVA 4EJ0A 4BNVA 4RGBA 5GZ6A 4CUKA 5MDHA 5DNAA 4R16A 1E77A 3GDOA 4BKRA 4D46A 4E0BA 1PEDA 3Q11A 1W0CA 4CMEC 4D0RA 5H82A 2VUSA 3V2UA 1NWHA 3JYLA 1KC1A 1C1XB 1RPNA 2FHSA 1K6IA 5EERA 1I3LA 4K9DA 2V65A 1GADO 3OJ0A 3ASUA 3TL3A 4CLHA 4GWKA 2PD6A 5G4LA 3E8XA 2I65A 3N58A 4CPDA 3F4BA 2A4KA 2QZZA 1Y6JA 3WQRA 4FFNA 3U5TA 4J0FA 1EQ2A 1U2GA 2ZTMA 5A3JA 3CPSA 3AFNA 1ENPA 3UKOA 1EMDA 1E7SA 4RLSA 3QLJA 4ND4A 1E5LA 3RASA 3QVXA 4WLNA 8ADHA 3F47A 4KUGA 1SAYA 4P4NA 3B1KA 4BNNA 2VTDA 2X6TA 1N1GA 4YBZA 2B37A 3F1LA 1JW9B 3UCFA 5IDQA 2X1HA 2BFOA 3H2ZA 1QSGA 3HDYA 1C1XA 3WFJA 1N7HA 2A94A 3ORFA 2QQ5A 4RF5A 2WDZA 2PKQO 1HT0A 4E2ZA 1FMCA 1BVRA 2UV8A 1EBFA 1KY5A 4ZQBA 4WCDA 1GQ2A 2QRLA 1VJ0A 4M89A 3RFVA 1IULA 2JL1A 5T6BA 1ZMTA 5KWEA 4ZQHA 3ZH2A 1FDSA 2NVWA 3QVSA 4K6FA 1P1RA 3KTDA 3DONA 1W73A 3SVTA 3H9QA 1LSOA 2AQHA 4HFMA 3DB2A 4Z3KA 4CM4B 4CQLB 4CMBA 1K89A 1EDOA 1P1FA 4XRRA 4UAGA 1E6EA 4LVCA 3TFOA 2PH3A 2WTBA 2OOSA 3KEQA 4UEJA 3EGOA 5CFZA 1SCUA 2NTNA 3CMMA 3LF2A 4FS3A 1DDOA 4I9NA 4ZJUA 4U7WA 4EJMA 1XCBA 3S8MA 2G1UA 5L45A 4E21A 4NFHA 3AM5A 3H9GA 4AJ2A 4BNXA 4FJ0A 3WSVA 1C0LA 3WGIA 4CLRA 1NFQA 2EKPA 3ROMA 3ZU2A 4RLHA 5JW6A 3CTMA 3R3JA 4UEKA 2NU8A 3WWYA 4UEOA 4E32A 1Y8RB 1Y9AA 2Q1WA 1DC5A 3DXFA 1LLQA 2ILTA 2H9IA 1VLLA 3GR6A 2VN8A 3RC1A 4CUJA 4B7UA 5C5IA 1LI4A 2EKLA 3CH6A 4JXKA 1ZFNA 4AICA 4CM4A 2V6MA 4S3MA 2PR2A 1R4MA 3HADA 3OEYA 3Q0EA 1UUFA 1U7TA 4BNLA 5L7WA 2X9NA 4IIUA 3QWIA 3E82A 3DL2A 3AUAA 3ZU5A 4IZIA 5L53A 2JFHA 1R0KA 3JQBA 1Q0HA 2Q46A 5A1TA 4BKUA 5A05A 3M6IA 4BO2A 1NVGA 4GVLA 4IJUA 3PJDA 4RZHA 4AJOA 2C07A 1Y5RA 2OXIA 4MVJH 5I7FA 2FR0A 3PDJA 2NU6A 4YAJA 3I3OA 4KQWA 2C2XA 1Y8RA 2CNBA 4PLCA 5ENDA 3TZ6A 1ENZA 3FNFA 2QZ9A 3AOEC 4R1UA 2R00C 1K6JA 1M6WA 3ST7A 1T4DA 3LC7O 1PQWA 1W6UA 3L4BA 5IG2A 2VT3A 4TRJA 3SBOA 1WW8A 4IS3A 4JJFA 5JDIA 2PKRA 3AI1A 4GAEA 2OO5A 1KEVA 2D4AA 5CDYA 1PGNA 2DAPA 4W82A 5CEFA 3PXXA 2JHFA 5I9NA 1XYGA 1O5IA 3P19A 1HZZA 1D3AA 1WMAA 3ZWXA 2ET6A 5TIIA 3H6KA 5DDIP 1V9LA 3E5MA 3O8QB 5KJEA 4BB5A 1P31A 3FTNA 2JJYA 3F1KA 2OBYA 3D3EA 2XAAA 3GDGA 2QRJA 2DBRA 1HDGO 3HFSA 3ONFA 4PG7A 5G0WA 2PH5A 4HFJA 4RPKA 2UUOA 4KWHA 1VL6A 1KEWA 3I9OA 1KY4A 2GO1A 4OJNA 1KEPA 2FSSA 1PGPA 1UDBA 2WYUA 1KETA 3CE6A 1DC6A 5EMHA 4OKNA 4NQZA 4XIYA 2Y1DA 3ZWNA 2B0JA 1BHSA 2I3AA 3ZWOA 4YT8A 3IJRA 3VH4A 1ONPA 3ZHZA 4FGSA 4WOJA 3QWFA 5THQA 4CJXA 4NBRA 5EPOA 2DTEA 4ZQFA 3R3SA 3FNHA 4HFRA 4U5QA 1JAYA 2LDBA 3D5QA 3BTUA 1WAMA 4LCEA 4AJHA 1I3NA 3FI9A 1EK6A 3D1LA 2D2IA 3PLRA 2C59A 1YWGO 2G5CA 1EVZA 4WLVA 4BNTA 1LSJA 3I4FA 4L73A 1FDWA 4BGUA 2GZ2A 4IQGA 3EMKA 4FN4A 4ZA2A 1HDCA 4JCOA 2Q2WA 1I8TA 4DIOA 4BNUA 2PLAA 5JSFA 4BNGA 3ENKA 3GDFA 4RCVA 3L07A 1G1AA 4E3ZA 2ZCVA 5L9AA 4NDNE 3VTFA 1WZIA 2W2KB 4MJLA 4XYGA 1KC3A 1T26A 1IB6A 1ZK1A 5FF9A 4LMPA 2PGLA 3ULKA
chains in the Genus database with same CATH superfamily
1KMIY 4C2UA 1OV4A 1NW5A 4B3DA 1POXA 2H4JA 1FSFA 1G98A 3JD3A 3BF8A 4J0HA 3VZCA 4J75A 4MITA 5EMJA 1F6BA 4EI8A 1I2MA 4K9NA 4O0MA 1Q0ZA 1VKJA 4IMJB 4LE2A 2W11A 1B26A 3FBGA 4LY0A 4C29A 3ADCA 1IVSA 3ELDA 1DC4A 3JQ8B 8MHTA 1UPBA 1USKA 3HNOA 3OETA 2C5SA 4I81A 3ERCA 2QM3A 1B73A 1S8FA 3FR8A 2OHVA 3MWFA 3QVOA 3S29A 3W04A 3SS9X 1X94A 3LX6A 3QPBA 5GMOA 2PBFA 4UFOA 2V6BA 1L9KA 4QX6A 4LE1A 4TSKA 3TGWA 4RY8A 4C0BA 3NO4A 1ZSYA 3L79A 4R3WA 3DJFA 4AIIA 2NN3C 3KYJB 2J9FB 4ETNA 3SQLA 4YCLA 1X3LA 2MSLA 1I0LA 4AJKA 4DNXA 5JS6A 3E22A 4HQ6A 3X0DA 4OEHA 2XLCA 1N6PA 1DAEA 1I0IA 2OV4A 4P4LA 4DIEA 5B4VA 5AVVA 4Y2JA 3C7KA 1E89A 2LUOA 3GK3A 4ZVLA 1AQNA 3LAWA 2BFPA 5BVGA 2XRZA 5AK0A 1N9KA 2JFOA 2ORIA 3PBKA 4RVNA 4DIUA 5JASA 5EQDA 1NNEA 1Z6XA 1BDJA 1PFUA 3JQ8A 3RH0A 2VHWA 3EYWA 3IAM1 1FX1A 1VJRA 3H5WA 3G0BA 5B7QA 4JKOA 5EJIA 3BMQB 4MKGA 4HYQA 1JL3A 2UYOA 3W8EA 4LK2A 3VR2D 5IZCC 3OHPA 4YX9A 2QOEA 1VLMA 3L05A 1KNQA 4XLTA 4KIFA 3A6DA 4JY7A 4ZCLA 3VYWA 2BBTA 4QC2A 5JO0A 3BCRA 5A1JA 1K27A 1XVVA 2Y0EA 3FZQA 1W48A 1AQ6A 2KS6A 1E4OA 2QSYA 4RUKA 4B80A 2MYPA 2VKTA 3OESA 2OLJA 2VJYA 3CYFA 4LDJA 4D5EA 2ZM5A 3GEDA 6REQB 1OI7A 3EXIB 3SICE 2JGJA 2NWQA 1JU9A 4R1MA 4JSYA 3VM6A 2J3EA 2VT7A 1I7DA 3WTCA 1MG0A 2FQYA 4IXDA 1I5OA 1TQ2A 1AS0A 2V7UA 3LXXA 4ZCMA 4ARUA 1DIOB 3DP7A 5JATA 1IXZA 1JZQA 3SR0A 1IAQA 2P3LA 2VAXA 2VK8A 1XAIA 1M0WA 5E4TA 4URVR 5IKMA 3HBAA 3VH3A 2H0AA 3NALA 4W8OA 1JQBA 2G17A 4BVKA 1XXHA 1P2DA 1DX4A 3HXKA 3VX4A 1YMVA 1Z5VA 3T15A 4QLOA 2Z6VA 1X9HA 2WSBA 4AT1A 4UTOA 4L8YA 3EQ2A 2YZ2A 3QU5A 2XGSA 3UMSA 2BMDA 2X4IA 3W9UA 3AXSA 1MZPA 2ZUDA 1M2FA 5EUCA 4WIAA 4ENTA 3S3TA 2Q0QA 1SOWA 2HCTA 3ABSB 4ZVKA 5CYOA 5JMOA 1Q83A 2EFHB 4LUCA 1JWAB 2YVAA 2JZOA 1EVYA 1V4BA 1PLLA 1ECFA 1DSSG 2J09A 1DMSA 3EXIA 2EP7A 4Y8VA 3OTWA 2J59A 2QR5A 4FOPA 2Z5VA 4K0RA 1A5ZA 4RK7A 1U0NA 3GGSA 3A36A 1MP0A 2C7GA 4GKVA 4R2JA 1E1LA 2PLWA 3ANXA 4EI7A 3AY7A 4JJ4A 4I9FA 4RM3A 2WF9A 1U0BB 3VR4A 1XB2A 5KVVA 2HIAA 4PYIA 4DBVO 5IT5A 2J31A 3UEOA 5JRZA 3BIFA 4IIVA 3D2BA 4F7DA 3GP5A 2QLTA 3MAJA 4MMZB 1XU4A 1EM6A 4KDCA 1TZCA 3RFTA 5FDFA 721PA 5T41A 1KBZA 1C8KA 2CHQA 3RC8A 4NKRA 3GX1A 4MWSA 3CX6A 1PJQA 3R40A 2QR3A 1ZH8A 4H16A 5AKLA 4REQB 5DTIA 1SUIA 1HE8B 4N0DA 3ZWPA 1KYXA 4H7FA 4OQYA 2YX1A 4M3NA 1G8JA 1Z3IX 1CVLA 4NBUA 1PUIA 3I6ZA 4I6EA 4L0CA 3A4IA 3C3WA 5ADWA 1PT7A 1Y80A 1TYCA 221PA 2XYHA 3U7RA 2C7BA 2AUNA 2GUGA 1CERA 1W88B 2PRKA 2Q4EA 4M55A 3P9XA 4FD2A 4JEMA 2PAFA 5CVUA 5BYBA 5TF0A 1IZZA 4OSPA 2OQIA 4MARA 4P3PA 1UKYA 4MK4A 4ZGWA 3G2IA 1TA0A 1U2GC 3MMXA 3RKUA 1J8MF 2C8LA 1UBUS 3DV2A 2A1IA 3TTSA 5JY1A 5L51A 5JROA 4DV5B 2ZRBA 4J7AA 1X86B 4BZQA 1EFUA 3A37A 3IERA 3UGKA 4GZLA 1OE0A 1HQDA 1T9AA 4CTNA 1XL1A 3C8HA 4XEUA 3OZBA 2ZT8A 4I5FA 4QJ5A 3IOEA 4REQA 4DSZA 1O03A 2R7AA 1RLIA 1S2IA 1T2EA 1U1FA 1CIPA 3GQVA 3NIDB 1DAIA 4J90A 3VC3A 4I1VA 1BS1A 4AWAA 2CL6X 1XZAA 1BA3A 1M10A 1N0WA 5FBWB 2DUJA 1KR5A 3KVNA 4A8PA 4Q21A 2WWHA 4Y2VA 4G25A 3RFXA 5BUQA 4BVHA 3KKNA 3FFWA 4LJLA 4EW6A 2WVJA 1RNLA 2EFYA 3M82A 2A3NA 3FSJX 4JQOA 4O3FA 3ND7A 3TMAA 4KO8A 1Y6QA 1I32A 3AJ9A 4JI1B 2QYOA 1JB9A 1QFJA 3IE2A 4GECA 1X8KA 2EL9A 4IRMA 3C3XA 2ZAOA 2MT9A 1SJ9A 1UXJA 1ZLXA 1C14A 1JJFA 2VTEA 3A1FA 1G41A 1OFHA 4HLCA 4M8NE 2AX3A 3TUIC 3ZBQA 3L1IA 3ZCQA 5JCJD 1VYVA 4NV0A 4TYQA 5EHIA 4NJMB 4AKEA 5DEOA 9LDBA 2PA3A 2CNKA 2QX6A 4O2BF 4YJ3F 3GRKA 4YP0A 2B7BA 3CNBA 3CLHA 3DZDA 1RHUA 1N2SA 1NM5A 3PRYA 4PYNA 3M8KA 3ND9A 3KQNA 3SVLA 4BFYA 5GINE 1RR6A 2H4ZA 2XIQA 2Z9CA 5LP1A 4FMDF 1M8FA 1ZOPA 2YWGA 4Z4IA 1W0JD 3EDOA 4ZCQA 1IN1A 3MJ4A 4PAMA 3R24A 4QXMA 3RSSA 2HMWA 3ICPA 2GARA 2OMEA 2OAEA 3OEHA 4HB4A 4XARA 4M46A 5BV2P 1EHCA 5TS3A 4AURA 4BO8A 3IA7A 3UG7A 4DMCA 3BS4A 1ID1A 4Q9LA 3WFZA 1BS9A 1NPTO 4GNRA 2LCIA 4ER0A 1Z74A 1L5VA 2Q2VA 1Y3DE 3R5SA 4HMQA 5DVZA 4QGGA 5EUMA 3TCKA 3IESA 5BSGA 1AJEA 4KE7A 2L42A 2Y05A 1HG1A 2J9XB 3LBNA 4HVCA 2V6GA 5MHTA 1RHKA 4GP7A 3ILSA 2FPMA 2Z95A 1MOQA 1NASA 4LZJA 3ELBA 1VMEA 4CNBA 4CIBA 3L4KA 5HS6A 5JYEA 3EDCA 1WWKA 4XVCA 4D9NA 4XW2A 2HUNA 2CK3D 2X0JA 4CMHA 2VTBB 3EBOA 4KH1A 2R65A 4UUPA 2Z1NA 3HP4A 1OB5A 2XA2A 4FOLA 5HM6A 1I4LD 1RI1A 3PD1A 4H7IA 5CXXA 1QGUA 1IHYA 1P17A 4CHTA 4F8YA 2A59A 3COYA 1R3UA 4ADSG 4L6AA 2PZBA 3BJMA 3QLTA 1MFZA 1I80A 2P6RA 4KPUB 2VYVA 1FOEB 3DNFA 5K8VA 3S44A 2C9BA 3V8BA 3ORQA 3QOYA 3BF7A 3BN3A 4BEJA 4Q02A 1AMOA 4RW0A 3R8FA 1E6WA 2QD2A 4L0MA 1RQPA 5EEHA 3V7UA 2PJRA 1IHPA 1VECA 2CZQA 2GKGA 2MSDB 4G0ZA 4Q7EA 4DTIA 3CUKA 4X62B 5KSZA 4JLWA 4CR8A 5LZ9A 3ITDA 1OI4A 2PQ0A 1XLVA 3WWDA 4N48A 5KWIA 4EJ6A 4G0NA 1RKVA 5I4CA 1C7ZA 1KP3A 2FGJA 4QEKA 1V48A 5FFFA 5A3SA 5K05A 3OQ6A 2LKDA 1O96A 2H4XA 4P0QB 4MVJA 4DHWA 3CNQS 4RY0A 5H9WA 3WV4A 2VTBA 2DWPA 2PJZA 4XAQA 1MC5A 1R7RA 3GNLA 3NC4A 4KYIB 4PIMA 4BZZA 2XTJA 3WV5A 1YQEA 3CX4A 1ZBQA 3V1TC 1XCMA 2BM8A 2O0MA 2FZ5A 2QX4A 2IGBA 4KPUA 2BR3A 1HKUA 3HSYA 2GUWA 3C1TA 3ES9A 4OFWA 4MV9A 3WBJA 4E46A 1QTNA 3FLEA 4P38A 3I5AA 4GYYA 4GMHA 3E4DA 3IEKA 4K03A 4RZQA 4DJ5X 4PHHA 1DKLA 1XLTC 3Q8LA 3G2HA 2V97A 4DBZA 1GNPA 3SYMA 1G5PA 3CX8A 3JWGA 3AVOA 2UVQA 1DCMA 1XNJA 2ZXEA 3HDHA 1T2UA 1P9OA 3QXXA 4P8RA 4WZZA 3MYRA 1UMBB 3GCZA 1MW9X 4KRGA 4PPQA 1NIPA 3PFBA 3KJFA 2I3GA 2Y66A 3GLFA 3T7RA 1RBMA 1ZNXA 4G85A 4J03A 4FGWA 2NU7B 4JXZA 4F0JA 1PVDA 4BP9A 1ITZA 4AP5A 4P7KA 1LRLA 3SZOA 1E9RA 1WW2A 1A9YA 3IFSA 4MW1A 2PS0A 4MYSA 3ZI0A 2N9UA 1EKXA 3TDMA 4GX1A 1KJQA 4C30A 3ZLTA 1U1IA 3PXDA 4WPGA 3L0ZA 5CGZA 1VPDA 1KOGA 4OXKA 1Z5OA 2HNBA 3PFWO 1HZJA 4ODIA 5JH7F 5KWVA 1I7SB 1S96A 4X44A 3WBFA 3AI7A 2PKQP 3RK4A 3LXMA 3K0BA 3UW3A 5A0TA 4H35A 4QOFA 5HUQA 2PO7A 3DT6A 1AVTA 4RJ2A 1NE7A 3GPDG 3KHTA 1D2MA 4RA9A 4DWOA 1SZPA 3KBOA 5FOUA 5CDFE 2JCBA 3KSMA 5JPCA 1UMBA 2RK3A 4B4VA 3F98A 1PZMA 2FPIB 2XNSA 1TT7A 4DLSA 1ATIA 2IQIA 3S55A 4CEJB 2P27A 3KALA 3RWOA 4EPWA 4AJ4A 3T9DA 2C2BA 5C46F 1WCV1 4IXTA 5CVVA 1MRZA 1W93A 2RGNC 3H9JA 3PQ7A 1BROA 3ZCRA 1CJUC 3FUUA 5DSXA 1RTTA 1RI3A 2JGRA 3BMXA 4GYWA 1QV6A 4UDNA 1Y48E 1YK1A 2C57A 3O5AA 3ZZMA 4M1QA 4RHCA 2PMKA 1U90A 4RPLA 5KSYA 2P1ZA 1JEAA 4MKRA 4D92A 4WECA 3W3AD 4NCNA 3X2EA 1P2FA 3AB7A 2IOQA 3DT8A 1K2VN 4K8RB 1PLKA 3PUWA 4YEDA 1GNLA 1JU3A 3IKLA 1LF0A 1DT5A 1Y1RA 5J4VA 3ZGVA 1B8NA 2OCAA 3GFOA 5J43A 2AQ8A 2Y99A 3WMRA 4MXDA 621PA 5JSZA 3EMBA 3WOHA 2FPIA 3IKVA 4RPGA 4I8IA 5AOCA 4AWXA 5K8IA 1RRMA 3RRJA 4Q66C 1XC7A 3A3YA 1A8UA 4P31A 3VYTB 1DKPA 2Z2XA 3A1CA 3T5DA 4F5ZA 4AF8A 1I94B 2QUHA 1NZJA 4XD2A 1M8JA 2Y92A 4U9HS 2FKNA 2FSPA 2W2QA 3EQ8A 1ULTA 1YRAA 4MSUA 4RL4A 5DV9A 4DR5B 3UENA 3D0OA 2J3IA 3AJAA 3U7GA 4RQAA 5CJJA 1FQWA 2ZTSA 1BWPA 1IQ0A 1MB9A 1TYDE 3D6JA 4LOLA 2R7NA 3BSSA 2C4TA 3THWB 3KEFA 1K8RA 1NWCA 4QOJA 2CV2A 5FV7A 1P33A 3GAFA 4G86A 3QU2A 4L22A 4QYWA 3HVRA 4MWTA 3WLTA 3R23A 4IV0A 1HFEL 2A67A 5CPBA 1LY1A 2Q3LA 1P9NA 3Q15C 3VC7A 5HZMA 3C7AA 5IJXA 3RRFA 4CTKA 1RQNA 2E82A 3MAGA 1Z5PA 3N6RA 2XB9A 3KD2A 2IRWA 2R2GA 4QUIA 4D3FA 4P5PA 5F2OA 4ECAA 3BFPA 1SC1A 1RT9A 1EM8A 4ARIA 1L5OA 5IT0A 4OB8A 4MB0A 4YV2A 2IH5A 3G0OA 3HU1A 3RIXA 3PEYA 1VBFA 2B78A 3SSAA 1N2HA 4QM7A 1LW6E 1M72A 1P61B 2I4IA 3V2HA 1TGYA 8ABPA 4DV4B 2F8TA 4N47A 4FYWA 1JH9A 3DMFA 4HH0A 4WNIA 3EXG2 1JA1A 3RI3A 5MFPA 1JDUA 4EGAA 2NNWB 1U8CB 3ZWCA 2PL5A 2O05A 1IJEA 1QE5A 1YZUA 1TKBA 1J24A 2NM0A 3OFJA 5C1IA 3VYUB 3F7TA 4GGOA 5EP4A 2BEWA 4LIPD 3SDSA 1U7WA 3LD9A 3OIVA 2B0CA 4X54A 1EK5A 3G9ZA 3W1WA 1ICEA 1EWYA 1IFXA 2VP0A 4AJ9A 1PZXA 5DZSA 5C1BA 4I1OA 4B3SB 3T3NA 3MTQA 4JC5A 4DM7A 4UQLA 5BNIA 2FAXA 1DIGA 1J6UA 2B82A 2WJGA 2X6RA 4YTEA 3D7RA 2EZ4A 2HNKA 4DEYA 3EZ6A 1CRLA 1YZHA 2R5WA 4IW3B 1O6BA 2AG6A 4H1HA 5AI8A 3OQBA 3UWPA 3VPAA 3FXAA 2P4UA 3NDRA 5J2UA 2UUBB 3KELA 1ZGCA 2HZ7A 2X9VA 3F3KA 5K0BA 4HDAA 5BNWA 4RDCA 4JEIA 2F9FA 4TLAA 4LSMA 4F91B 5JRDS 4GSYA 1IY8A 1XROA 5JCXA 2DFPA 3BRQA 2BF4A 2UUCB 1OIXA 4URHA 3BORA 4X7MA 4IFEA 4R8SA 5CGQB 4CL3A 1RTKA 5IDYA 5JDCC 4YUYA 4OH7A 1QPZA 1C1DA 1ZCJA 2DQZA 2UVDA 4Z9AA 1XRRA 3UANA 2QTBA 3BQNB 3D8SA 2Q99A 4L3WA 4OGWA 4JN6B 5TVGA 4GOKA 4TVBA 3IIJA 2O8EB 5LM3A 3FTEA 1QG0A 3FCXA 1XTTA 3R9WA 1Z4NA 5LCXA 3AEKB 2ZRHA 1DTSA 1GKYA 3ZDBA 4JYAB 1C9NA 4MI1A 1FU8A 2GXAA 2FW8A 2GN1A 4ITUA 2BFFB 3EK2A 5TMPA 2MYUA 1PN3A 1XTSA 1LDBA 2HU5A 3OUZA 4P4TA 1DO2A 1Q7GA 1C7QA 3O1JC 2JA2A 4KYTA 5C0OE 2WTUA 1RQRA 4FFOA 1QV9A 1H1TA 2G83A 4OI1A 4DPMA 3DWIA 2CJYA 2ZIAA 5HHTA 4JUBA 2PX3A 3DDWA 2GVDC 3PKIA 3A26A 1FUYB 1AGXA 2FEAA 2N46A 3RRYA 2ZWPA 4PHGA 3F9IA 4EVSA 5AVXA 2OFFA 3PT9A 5E2IA 1C4XA 1C2YA 2P2GA 1JXQA 3MOIA 4J0EA 4X91A 5EVJA 3SC2B 2JJQA 3DEYX 4DXAA 3ZUPA 4NE7A 2WAXA 3CF0A 5LQCA 3FM9A 3ICOA 2G9NA 3X1WA 5T3YA 1E9BA 1MAUA 1ZESA 1ZGGA 2F64A 3E3MA 3EVBA 3QKIA 2A1TS 3HSKA 4O5AA 4OQLA 4TTAA 3WJ7A 3ADDA 2D3TA 2YOHA 3SQXA 1OFIA 1G21A 1Q6YA 3FX2A 3GNSA 3HZRA 4G56A 2BGUA 3FOFC 4EG8A 1C1YA 3RR2A 4KLCA 2WJ3A 4YUAA 5C18A 2PAAA 4NEGA 3ZVMA 1MJGM 1ZINA 4GQAA 2HEGA 4IJMA 5CA1F 1NBWB 2Q6TA 3HYTA 1JKMA 1GQQA 2O7VA 4EYGA 1A76A 3P52A 1QKJA 1Z7EA 3ROPA 1KTIA 1YXMA 5D3QA 1MHPA 2H08A 1SD1A 2WU1A 2ODQA 2J67A 1QHHB 2C5GA 3BYZA 3OMXA 4NHEA 2EX1A 2WWVD 1N6KA 3AEUB 3QY0A 3SF8A 3VRHA 2FUG6 4OGLA 3WQSB 3ZWWA 3ZD7A 4CQNA 1DVRA 4DQUA 3B89A 2YCBA 1C3VA 2JAHA 5TQJA 1PFGA 1Y37A 3BEOA 1P0CA 2UYQA 3T7EA 1Z63A 1BQEA 1CU1A 2JI7A 1Z25A 3ASZA 1IYZA 1T6XA 4NPCA 3LJKA 3KQOA 4H7EA 1GRRA 2GZAA 4CM1A 2X0IA 5IKPA 3FKSA 5IYZA 4E4TA 5JZMA 3NS7A 4TPKA 1N5IA 2E21A 3ACDA 2DZDA 3RSZA 1HTBA 3W8RA 2OKGA 3WMGA 2XUKA 2Q41A 3K0SA 1CUZA 4BB9A 5U4XA 2VDUE 2ZTHA 4MJ7A 5IC6A 1U8YA 1ZC4A 2IP2A 3DOCA 3O7MA 2H1LA 3QG5A 4KRYA 4QPCA 1YJXA 4LXYA 4NJOA 1I4EB 5A9TA 1EUQA 2VPYA 3P4YA 2ZJ1A 3AV0B 4IR7A 3EWNA 3RFFA 1EFKA 2A6PA 1JYFA 1YBHA 3ZOKA 1FRZA 1U1CA 3LCUA 4JP8A 2B1RA 1M66A 2QB5A 4EENA 2G6BA 4GOJA 5JISA 4Q3OA 4NX2A 1QHHA 1E2MA 3P2JA 4WJZA 2QP3A 5B3JC 4ZTBA 2XH8A 1A8HA 4R1SA 3ZDFA 4F1JA 1YT5A 3CRQA 4D96A 5B7NA 3I09A 4R1PA 421PA 2N3ZA 4X6YA 4JI3B 5BOSB 4L2IA 1JTVA 1TMKA 2ZAMA 4YRGA 1UMCA 1PZEA 1SCDA 3Q87B 1NA5A 1VE7A 4DT1B 4D9GA 4FYIA 5JNWA 3SZGA 1EP9A 1CB0A 1YC5A 2O48X 2OAQ1 4MRPA 2MSNA 1KEZA 5IU6A 3K6SA 1KMMA 4QQRA 4DLKA 4OIFA 3AQ4A 2IEDA 1CEQA 4Y2UA 1IMJA 3CINA 3SHWA 4TYPA 1DO8A 5BV1A 4BVLA 1ZUWA 3NH9A 5WRFA 2CLEB 4KXVA 2UZ1B 3ZGLA 1FPMA 2JLQA 3G85A 1XE3A 2YQ5A 1IUNA 4C5BA 1TKCA 3PDIA 3HGQA 4Y2XA 1RKBA 1MLDA 1JI3A 1Z4MA 2C9ZA 2GT1A 2J30A 2MMCA 2YXLA 4C0XA 4C4RA 3GJ3A 2ZI3A 1QYXA 4AS1A 1NVVR 1QG4A 2V7TA 5CLIA 1Y81A 1RM3A 4M38A 5DSTA 4KAJA 1TIPA 1WKCA 3NUZA 4J6FA 4IV8A 4HXFB 4P58A 1YBMA 3HJHA 4OYRA 1MC4A 4V2UA 1RKQA 2HWKA 4HNQA 5SYAA 2IXTA 3VU8A 4CMEA 4DT1A 1DJMA 2WUDA 4OK6A 1SBZA 4HN9A 1PJCA 3SBDA 4UTVA 1KE1A 4KSYA 5E8RA 1Y5LA 3ZNOA 1XJWA 1CR0A 1I4OA 2XA9A 1UEIA 1GDHA 4RL6A 4OJTA 5FAKA 3E7WA 2O1WA 2QMYA 1VP3A 4LJKA 1GU1A 2AFVA 3DDNA 3FZGA 4L6IA 1YL7A 1DXHA 2ZJBA 3O74A 4R0NA 4TZKA 2XLBA 2P2ZA 3TQTA 1DAKA 1FU7A 2GLTA 4LFBB 3L1JA 1WE2A 3L43A 1IB0A 1U2PA 5BN5B 4L9WA 4PLHA 4Q82A 4QBFA 4E4YA 2FG5A 1P81A 2BGRA 4TKZA 3W7AA 4KDEA 4Z9XA 2FZCA 2ZRCA 2QTCA 2QLMA 4W5RA 2XTZA 4UW9A 1ZM4A 3A6GA 3K71B 3HN2A 1PHPA 2IHYA 2NVBA 2O6LA 4H3SA 2HA5A 2IOYA 1K8YB 3QKSA 4L07A 3WL7A 2ZQZA 4AJPA 4B74A 1X7DA 3VKHA 1H0RA 4JP3A 3AVTA 3C1UA 1OBVA 1QVAA 1X77A 1OBFO 3H4IA 1ZH4A 2FJPA 4I8XA 2PUGA 5CBPA 3T1TA 1R27A 2Z2JA 3EOBI 5LXTB 5DLEA 1QZTA 4IDPA 1CUFA 4R54A 1YJCA 1JG4A 2QYTA 4F4FA 1YVDA 1RZVA 1SKQA 2EBHX 3W3ZB 4DILA 4FK8A 2NYAA 3PB3A 4JBIA 1K5PA 3M89A 2HMSA 4WXYB 1RM5A 1Q0PA 2JI9A 1L1FA 3TE6A 4BBAA 1E2LA 4PSUA 4DYVA 1RADA 1SZDA 2D0PB 5M34A 3ZDDA 2C3PA 4W6ZA 4EMBA 2VQFB 1CQWA 4RMIA 3VBCA 3ZD9A 1S1MA 4EEKA 1KFJB 1TAHA 3G7UA 3N0VA 3NB0A 4PSAA 3IT3A 4K9KA 1A50B 1CS0B 1L1QA 3A4TA 5NULA 1LS6A 5A7GA 1Q20A 1M5TA 2ZR8A 3AX6A 4AJ1A 3ASVA 4NYMQ 4X8HA 3V5NA 4BU0A 4AO6A 1WDWB 2ZTUA 2ZWAA 2NO4A 4MYUA 4E31A 3UHJA 4JUAA 4CTMA 3C4QA 5JSQA 3VZQA 5KTRA 3ZCPA 4H08A 1LK7A 3PDUA 2HF8A 4II3A 4ZDWA 4NCIA 3TO5A 4Z4HA 3K1ZA 4XX1A 1TVMA 2I4TA 3JWPA 4FVTA 3KFLA 3UHFA 4IBOA 3L8GA 3ZE6A 2XCLA 1ZW6A 2BI8A 2WV9A 4ZOQI 1OJLA 2H5JA 4RPCA 1VCHA 1WNFA 1MO6A 4F5WA 2CY0A 1G7RA 3DKKA 3BE8A 1W9MA 3HUUA 3L7MA 4BQIA 4GC9A 1TIBA 4FYHA 2B8NA 2WBLC 3P94A 4WK0B 1FNDA 1UXGA 4C20A 1ZHOA 2GPYA 4GI3A 5H80A 5IJWA 3PKZA 2D5BA 2PMWB 3H19A 4JP2A 1CS0A 1EX7A 4BAUA 3UTCA 1CY8A 3O4GA 1Y3FE 3OPYI 2WIBA 4C43A 2Y3IA 4TZTA 3N3BC 3GEBA 3DDZX 4BJ1A 1WUJS 4ENVA 3DV9A 2NSJA 1IJBA 2HDNB 3AJRA 4XGQA 1OAAA 3FNEA 2ZSKA 3M70A 3N8KA 1G55A 2H5EA 1FVOA 4ZCRA 2R96A 1PNTA 2BSAA 2GPWA 1EA7A 1QIIA 2W6QA 2JLZA 2IHTA 1AZLA 2PGAA 2YNMA 3GW8A 4I55F 1E6LA 5DIFA 3B12A 1ZS9A 2RBKA 3NLLA 3UMGA 2MDTA 2H2AA 4V0RA 3SD7A 3ZW9A 2ATEA 3GVPA 4M7PA 2QYHA 4RZXA 1XCPA 3EH2A 3L77A 4MDHA 3DNMA 2QG4A 5KWEA 1PZHA 2V7GA 3P0JA 1J20A 5AKIA 2M6SA 1KZ9A 2BELA 4KV9A 4UHFA 3JQAB 2NV6A 4BASA 2OBFA 3ZVRA 4ZYYA 4TROA 5IDWA 5LBUA 4BMXA 1E3WB 5FL7D 2Y1FA 1DG9A 2J3HA 3UC9A 1EUYA 1TU0A 1OY1A 5I7EA 1TVCA 3NZEA 2F3QA 2GI4A 3I2HA 3I64A 4KE6A 4KOAA 1NN5A 4QRHA 1TJ4A 2DPLA 3K09C 4KPFC 3RNLA 3QJYA 5GVSA 1N1MA 1U5CA 1Z6PA 1JZSA 3KQKA 3GBVA 1RJWA 1XVLA 1PKXA 1UPTA 2DFNA 1PWZA 2ZB7A 4GEGA 4WZBA 2G67A 1T5OA 4NJEB 3C3JA 4FR2A 3FGZA 2CKMA 3LTEA 1ZUNB 3PPYA 3UV3A 4EITA 1JAZA 1NW4A 3GN1A 1UT8A 3IHWA 3MFQA 3OZIA 4M7OA 4U0KA 5TSDA 3ZG6A 2RJOA 2JHAA 5DNDA 2RBEA 4Z53A 2YOGA 4ZT4A 3PSHA 2C58A 3B53X 4QECA 2HQRA 2PV7A 3VNRA 1WVIA 3I5MA 4MWDA 4OHMA 4R9RA 4OY3A 1ODCA 2QMUA 4G5FA 4R83A 5EJAA 3X2FA 3R6GA 1E3DA 1GTZA 1YTLA 3PE4A 3GBPA 3P27A 3RU2A 1N2ZA 4MUYA 1E1KA 3PGXA 1LBHA 3L8YA 3MRTA 1E3WA 1GPUA 1XZPA 1RMQA 1T3GA 2YASA 4D9BA 3V1NA 4DL9A 3GRCA 1THGA 3PVCA 3EXEB 5CTAA 3MERA 1RC1A 5KIAA 2JIDA 1J2YA 4L5CA 4NU0A 5TRTA 5FYDA 5BRAA 3C3DA 2ON6A 3V80A 2A5YB 3DT9A 3PR2B 3JQ9A 4CQJA 1DCKA 4M0LA 2IW1A 2IZZA 3AK4A 3JQFC 4P5EA 4JBYA 4NJEA 2RDMA 1GPBA 3WGNA 1ENOA 1ND5A 1XCGB 1ZGAA 2W71A 1NUSA 4KWIA 5B3JA 5JJLA 2BGTA 4DGSA 1O0CA 4I5GA 2BOVA 2FP4A 1EFRD 3GLHE 3PG5A 4NOKA 5D1HA 5HJ2A 3WHLA 5AESA 5KTMA 4QFBA 3UH1A 1EESA 3E3LA 3A1NA 3LNTA 2I2BA 3AY6A 1MUUA 1TA4A 4HLUC 2BFMA 3H5AA 3I9FA 3SEAA 1NNLA 2HAEA 4HADA 2XIJA 2AR9A 3FWYA 2ZRAA 2W4QA 4TWBA 4XVUA 1KH2A 2C03A 3CZ9A 4IH9A 3U4AA 3AEXA 3OU6A 1JEQA 2R6R1 2WDPA 1RYFA 2FETA 5K0CA 1D7AA 1P1KA 3RVBA 2SKDA 2DLDA 4DJDC 3EXEA 5B3KA 4BO3A 1N8TA 4ZQEA 3QFSA 4W9MC 2W8BA 1B23P 3K20A 2WFAA 3AI2A 1P5RA 4P7FA 3TI9A 1YI1A 2HJRA 1GZ4A 2PNFA 5J9FA 3AMVA 3FRIA 1TAQA 2R97A 4GS5A 1VSTA 3O6VA 3UQYS 1KIMA 2F3TA 4IDFA 5F5XA 3UNXA 2NXEA 1J5XA 4A5OA 3DPIA 3L8EA 1TM1E 4MDYA 1JGTA 4A27A 1OB2A 2CCGA 5JD5A 2ONJA 2HSZA 1J4AA 5EXEA 3Q5GA 2GB4A 3TCXB 3T5CA 5KNCA 3AESB 1HE1C 3R9XB 3PCXA 1RDFA 2AZ4A 4AFNA 1U28C 1H1DA 2BZ1A 2V5AA 3A6PC 1G5HA 1G8GA 1QWSA 2PGXA 5FPKA 4GWGA 2V9ZA 1UDXA 1U7HA 4E5KA 5C8XA 4AYWA 3H0CA 4IHJB 4UMFA 2ZR9A 5J4HA 4JP5A 1ZKMA 4JI0B 4JJEA 4XYMA 4NEQA 3VQTA 4LF8B 4ZJZA 2BH2A 3WTBA 4N3NA 2RB4A 2Q5LA 1T1SA 2R7LA 4OP2A 3UC5A 3UJ6A 2A58A 4BYMA 1G8PA 3MT8A 2D1QA 2BGIA 1E2KA 3IPCA 4JFRA 4EB6B 2QTNA 3BWBA 1Q17A 2C5FA 2H5IA 4ZOLB 1P18A 4YYEA 4ZVNA 2F1HA 2QM8A 4NZZA 5ALWA 4XIFA 4OXQA 1P75A 1KFBB 2GEDA 4ZAGA 3JAMA 1E3IA 1E6CA 5L40A 2Q4TA 1BW9B 3NGMA 1SXJE 3Q88A 3R9XA 4MS1B 3OE4A 3EJWA 1IN5A 3R5TA 1C7RA 1KQPA 2ZE8A 1JKXA 2FPRA 4M8SA 1I2CA 1XMSA 1U6JA 3LRTA 5LMUB 2CVFA 4JVMA 2CLSA 1ODJA 2R6ZA 4GE0A 1MMFB 7AT1A 1EFDN 1GU0A 2P77A 3FWHA 1OWNA 3L7CA 4IQ8A 4C0WA 5KQPA 2OO5C 3KTAB 4PZCA 4TWRA 5H9VA 1YDEA 2YDXA 3GLGA 2I6XA 1RW4A 4PHCA 5ERYA 5DCUA 1ST3A 3MD9A 5JVDF 1HZZC 2HDOA 1I01A 4ZU3A 1YFZA 3PTLA 3Q8MA 4ZVPA 3HWRA 4O29A 4F38A 5LD2C 5AVQA 5KTNA 3NR2A 5HK9A 4Q3NA 1ADYA 1JIJA 1UC9A 2REBA 3KC2A 3LNCA 4FUQA 3SI7A 1BW9A 3MINB 3DTYA 4FYJA 1A3CA 3B7GA 2RH9B 2OHXA 3Q9UA 1ISJA 2POQX 3ONNA 1Z5NA 5ILGA 3IEIA 5D3MA 3UHOA 2V7PA 5A6VA 5BPFA 1R9JA 1MIOA 4KIJA 2A0WA 3OTIA 3K0CC 5HPYB 3FPLA 5AQEA 4CKCA 5AM5A 1M83A 1EBBA 4LG1A 1UXHA 4N49A 3IEUA 2VQDA 4WCFC 1F14A 3O2SB 2C92A 4UQOA 4AS2A 1E2BA 4F9EA 3GAMA 4ZMSA 4B40A 3CRVA 4PFSA 2Q7OE 1A7AA 1PE0A 1K66A 4IJ6A 4PSDA 1N4DA 3BKXA 3NAMA 4DLBA 5CA0B 1N9GB 1H2ZA 2NO1A 3I45A 1BC5A 1GAJA 2JAUA 4BLSA 1VJGA 4D97A 5CCXA 1IVNA 4UJ3A 1RQXA 5E9AA 4ASUA 2ZYWX 1Q0RA 2GN8A 2HA0A 3TVYA 4OHXA 3KJHA 1N6LA 5HF9A 1H4QA 4Z2AA 2VKQA 1II8A 5TPWA 4B46A 1EB8A 5JAPA 3KS9A 1OLUB 3VFDA 3R77A 5EUQB 4WZAE 3MINA 4MGKR 1T4GA 3WLKX 1X1BA 1AG9A 3Q3HA 4AMBA 1TEHA 2HWUA 3IRUA 4LJSA 4RVUA 4PNEA 4EDHA 4F4HA 4EBBA 3BRSA 1QGDA 2XMDA 4XB2A 3KXKA 1RCFA 3PEEA 4LYDA 3WB1A 2WHPB 4IDHA 3DG9A 1UAYA 4UEWA 4UXIA 1CE8B 1IEQA 2ENWA 2VQEB 5DBGA 4EK9A 2W98A 1GTJ1 3SC3A 4LF9B 4LV6A 1QYWA 5IM4F 3G5LA 1Q7BA 4GZ6A 4AKGA 1HMPA 3NXKA 3L0YA 3O7WA 3QPVA 1N9GA 4FKBA 4GOND 1KI7A 1U3DA 5TR9A 4XCQA 1RYEA 5DM4A 2W58A 4MX8A 4K26A 2IDZA 2NO0A 3UB4A 3FSGA 4EWLA 4RMHA 1BXZA 4UREA 1I2AA 1LJ8A 3NCHA 1NI4A 4UE2A 3OQMA 4AC9A 3W79A 5IK2D 1OLUA 1AV7A 3ABZA 1RS0A 2BKAA 4TKVB 4IMPA 2J9GA 5HF5A 2AZMA 4AN4A 4IIDA 1TM5E 1WD5A 3BJZA 3K5PA 4FTWA 3S2ZA 5JQGF 3PFCA 3LTNC 1XPJA 5HK8A 1KJZA 3R3WA 2Q1TA 3AEQA 1KE2A 2QR2A 3VPGA 4H3HB 1CE8A 1NVBA 2CDBA 1EVLA 1ZZGA 4BQOA 2VHJA 5FFNA 3Q40A 4RZ2A 3MD0A 5CB4B 5IMBA 2PZKA 3LCRA 4NATA 2HTEA 4G5SA 5LB2A 3EA4A 3ADBA 3ZCVA 1KO4A 3FKQA 3GJYA 2V96A 1HL7A 3HDTA 4URUR 1PD1A 1R0LA 4NDZA 4PYLA 4YJFA 3A2KA 5EA2A 3OEEA 3E5HA 3F78A 2P0EA 3D02A 3DMTC 5IFKA 1H6CA 4S1PA 4J9VA 4P2GA 1JI0A 2BGMA 2G1PA 1ABEA 1P6UA 2FCRA 4ZDIA 3SZRA 4QM6A 5EWJB 1CZNA 4TKVA 1XTJA 1YAJA 2IHZA 3ID6C 2WIGA 4DBLE 1SFRA 4M9XA 4NV1A 1DJLA 1KYQA 3P9SA 4QT4A 4MKFA 4EHBA 2QN9A 4YUZA 1QAMA 5K99A 4GDMA 3JQ7B 4YGXB 2AKYA 1SPBS 1JPNA 3IMCA 3PEVA 4L8VA 1KI6B 2ZEJA 3DZHA 4MAMA 3V2GA 3FOEC 1U5AA 2GAOA 3CNNA 4DADA 3AP3A 5CB4A 4TQUS 5BSEA 1YQDA 2YCLA 2XZOA 5FTKA 2H2GA 5F4BA 4AROA 2FSGA 1AT1A 4PZPA 4B6SA 4Z1OA 1D6JA 4FR5A 1QDLB 1ZCFA 3MOGA 2O8FA 6LDHA 2CDAA 2OD7A 5C7YA 3QEBZ 2QYSA 3PR3A 1WPQA 1T5DX 1Y4UA 3KXLA 4H59A 1YAHA 3C45A 4WNCA 1WUHS 5AHKA 1NAHA 1GCOA 3TDKA 4FE3A 1GUFA 4PPFA 4FDUA 1FYFA 1P5ZB 1U8AA 2GK3A 3U60B 1IH8A 5EWJA 1RXVA 1YQ9A 1WVMA 2IU6A 3R5XA 3AM1A 2XAUA 1XNHA 1MD9A 5INTA 1BHO1 2GYUA 1QVWA 5BORA 4NF2A 3JQGB 4WBNF 1JHYA 4U7DA 3R3YA 3JPYA 2YYZA 3GRAA 4OV6B 1GL3A 1N8KA 4QPJC 1V3UA 3IP7A 4LRSB 2EW8A 2DR3A 3WKAA 4IGIA 1M1UA 2C7OA 3GHYA 5LLTA 2WQ7A 3TSCA 1KI6A 1YB7A 1XDSA 2VDQB 4P82A 1EZ4A 2Y1EA 4EUKA 3REFA 4H77A 4PRKA 3JWHA 3CWCA 5BV8A 1UOOA 3IE1A 5GTDA 1QQ5A 2R6DA 2AQIA 3V3TA 2FG7C 1L4BA 3DFKA 4LYEA 2JLXA 1JYSA 2YJGA 3FB1A 1NYLA 1UJMA 4E7PA 4IQ0A 3T7IA 2W93A 5JXJA 3OWXA 1MO5A 4FDVA 4JUIA 5HTKA 1JIKA 3HJUA 3Q7EA 3UWKA 3MHTA 3EQZA 3V4VB 1GZ6A 3V6LA 1LDYA 1JBKA 2OQRA 4W7SA 9GPBA 3LKBA 2DSNA 3OOEA 1DEXA 4LXIA 1RAGA 1UQUA 1Z12A 3R5HA 2WAOA 3RVKA 2EQAA 3SXUB 3M34A 4RE6A 3TLYA 1R0YA 4DLWA 5A3RA 1J97A 5EOVA 1D2GA 2REQB 4X5OA 1MNQA 4JR1A 4CYMA 2BHLA 2VJDA 4HQFA 4WFJA 4X6UA 2DJ5A 3NTRA 5AK5A 1QP0A 2VCYA 4QNMA 1BVYF 4NU5A 2IS2A 1F2DA 3Q98A 1J0CA 4JGIA 1RQ2A 4AJNA 1BGXT 3THXB 3LECA 3UG6A 3V46A 3VR6H 4D8VA 5JFTA 4UNRA 3JARB 3L1HA 3DFMA 2ZULA 1STOA 3FTPA 4JNKA 1N5DA 2I6TA 2EFGA 2QMHA 4OQ4A 2FPKA 4XVHA 5FBQB 1IUKA 3VTZA 4CDRA 1Q7TA 5GZ3A 1EXMA 2O4CA 3GGPA 3GJ0A 1U98A 3FF1A 4M83A 4WKCA 4UHCA 2SECE 1AZTA 2PX5A 4KMRA 5BQXA 3BHIA 1Z56C 1K88A 1NLYA 4Q00A 3WLLA 3R75A 4CT4B 3QUAA 3BXEA 1GZ5A 4I4CA 4Q4HA 3ZZ1A 1E8NA 3T5PA 3HBJA 2X4GA 3DTNA 1E2JA 4TMZA 3KQLA 2PGNA 5AHXA 1Z5UA 1YZQA 4ICIA 1RC0A 4QWWA 1A2KC 3IC5A 1KPGA 4D0SA 1LBIA 3SXUA 4BAZA 4QG3A 3EJ6A 1BJKA 2UZAA 1CNFA 4FKMA 2REQA 5I7SA 1E79A 4PTZA 4YJKA 1YR7A 3WWCA 3RYHB 2VF2A 2WNHA 3OPQA 4NCHA 5TQ2B 2WU4A 3TR0A 3ZU4A 3NT4A 3I53A 3SP1A 4CMGA 1TTPB 3QVTA