2RH9A

Tryptophan synthase complexed with igp, internal aldimine, ph 9.0
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
254
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Tryptophan synthase complexed with IGP, internal aldimine, pH 9.0.
rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 95
structure length 254
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2rh9A00
3TV8A 3W1RA 3BARA 5D38A 1JCLA 3M5ZA 1BEUA 2BTMA 2J9XA 4IMFA 4Y8FA 4WD0A 1VYSX 5G2HA 3WJYA 1TPH1 4O4VA 3LX9A 5HR7A 3BK0A 3W2MA 1H1YA 2GQAA 3LGEA 5BOOA 4Z0SA 3M0ZA 3R2GA 1NEYA 2ZA2A 1C9DA 4N4QA 3P62A 1UUMA 3DI0A 3NQGA 4FNUA 2F84A 3FEMA 1EUAA 3P81A 1ONRA 2X1UA 4O1CA 2GOUA 5BMXA 4UTTA 1YTDA 2Y7FA 1A5CA 5C5YA 3TQ0A 3CU2A 3S1UA 2CW6A 3W1PA 5C6MA 2C16A 2NWSA 3T55A 3DAQA 3NEVA 1TQJA 1L6YA 1HL2A 2YFOA 3WFAA 1FCBA 2QJIA 2HTMA 2E6DA 3DFSA 2FB2A 4YLWA 3STGA 3QJAA 3S9YA 4O10A 3B03A 3H55A 4QM1A 4QJ1A 2WJZA 3KFTA 5G4EA 3STCA 5ABTA 1KM5A 2GQ9A 4CNOA 1AMKA 3IEBA 2RKXA 4O1AA 3V1PA 1J2WA 4FX7A 4W9TA 3HIJA 1K8XA 3GAYA 1TCDA 3CM4A 3NZRA 2QCFA 3GZ3A 3TXVA 1EB3A 4RLIA 1M6JA 1GWJA 1WQ5A 2A7NA 4UTTC 4AHOA 2WKJA 3LOTA 4CQ8A 2TMDA 5AN7A 4Y6GA 1SZNA 2QCNA 3W2KA 2ZZ1A 2NXHA 2O7SA 1Q45A 2AAMA 3LI1A 3LDVA 3G1VA 2Z6JA 1HG3A 4NNCA 2WO5A 1L9WA 4O50A 1LTDA 3DFQA 3UZJA 2E5CA 3R8RA 3GVGA 3W22A 3W1MA 1KW1A 1OFOA 1LBFA 4O0ZA 1K7FA 5K2ZA 1AL7A 5IBXC 5LGXA 1NAL1 4A3UA 4KWWA 4MY9A 3WK1A 1VC4A 1R46A 4UFHA 4QITA 5G5IA 1XBYA 4O11A 3KRUA 4DF1A 4DO4A 1F7BA 1GVQA 4RJEA 3GXPA 1H62A 1PCKA 5K4ZA 2DP3A 3I65A 1F5ZA 1ZALA 3DHDA 1Q6QA 4K8HA 1F76A 4AMAA 4AHQA 4UTIA 5CKSA 3HG5A 2X16A 3W7OA 4O54A 3O05A 1HUVA 1TMHA 3S1VA 1RQBA 1IIHA 4ZQPA 4BF9A 4MJMA 4EIVA 2FFCA 2Z1BA 4N6FA 1CX9A 3GLCA 1NVMA 1DJQA 4NNBA 4JTSA 1R2SA 5FI8A 2OJPA 4FIRA 3WJSA 3MMTA 1GQNA 1DL3A 1WYIA 2G5WA 1OJXA 3BW2A 5DXYA 5FF3A 3S5NA 3WJXA 1QDSA 4Y9AA 3NA8A 1GVRA 4I7WA 5G1TA 1FDYA 3D0CA 4N4PA 1RD5A 2IQTA 2C18A 2WNZA 1NF7A 3A23A 2OCZA 2XFWA 3B04A 4JYDA 4H6KA 4LV9A 2FQIA 2B4GA 1GJPA 3E0IA 1LRTA 3B4UA 3IIPA 1IGSA 1JVNA 1NFBA 1YPIA 3LRLA 3SECA 2FJKA 2HSAA 1ICPA 3C2FA 7TIMA 3ZWTA 4PFMA 3TA6A 2G95A 1GG1A 1LOQA 1OFAA 4FX8A 5DY3A 4WQ6A 3OEXA 1KTCA 1LCOA 3DFTA 3I7RA 4B5NA 2ZA3A 2CLOA 3LHWA 3O63A 3EX6A 3NPUA 2C0AA 5DELA 2C13A 3W1LA 3QEZA 4XUGA 3W7GA 3E9AA 1TPWA 1XUUA 2ZRUA 2RDTA 2V0TA 4RXFA 4BI7A 4MYXA 1Z42A 1MO0A 3UWQA 5AYXA 3L0KA 4GE8A 3BG5A 5L6UA 3HGRA 3ANYA 4GUIA 3HB9A 4UUIA 5F4WA 4NZJA 4FEZA 3THQA 5D30A 2W0UA 3O16A 5C2XA 3JRKA 3W1TA 3G0SA 1JCNA 3GKAA 1PHWA 2RH9A 1YLVA 2ZA1A 4E2DA 4LWWA 3FFSA 4MKNA 1GG0A 3W70A 5LNSA 2QEZA 5LKYA 3NQ6A 5F1UA 4E2BA 1P5BA 2ABBA 4CCCA 1G4PA 1FDJA 3DFOA 1OFPA 4K7VA 2C14A 4N9EA 3JS3A 2CLKA 1MXSA 3UWVA 4HN4A 4TMCA 3BVJA 4UIOA 2VOMA 3L5MA 4BWLA 1L6WA 4DQWA 2Y7DA 1WDWA 3T78A 4HNNA 4X3ZA 4UMCA 5AC6A 2UV8G 2CZ5A 5EYWA 5I3JA 1W5QA 4UTLA 1XCFA 2BX7A 4POCA 4HIBA 1ZENA 3LCHA 2H3DA 3I7SA 3M1ZA 3LHVA 4CQAA 1DBTA 1T99A 1H5YA 1YTKA 2NWRA 3ABQA 5I3KA 4O8RA 2ZTKA 3M5XA 3LRMA 2ABAA 4EVZA 4CQ9A 1VCGA 1PIIA 5D2WA 3W84A 1JULA 2XN1A 4BK9A 5U4NA 4MFEA 3TJLA 2QAPA 4JGDA 3PULA 1R2RA 4LOCA 5CZTA 1LBLA 3TCEA 1XFBA 1VZWA 3KVLA 2FB3A 4OV4A 3NQ2A 4LUIA 3GDTA 3EWUA 1FDZA 4E38A 3RMJA 3O1NA 1SO4A 3BO9A 1K7XA 5AHNA 1DV7A 1IIGA 1MEHA 3UPWA 2ZRVA 1I2NA 1SQ7A 2CLHA 1A53A 1SZEA 2ISWA 3I68A 3GNNA 4N02A 2CLFA 5HQEA 1JRBA 3L21A 4ZL1A 1Y0EA 3CEUA 3QW3A 3W1QA 3NQCA 1P1XA 3DENA 3NQVA 3P7YA 3Q2DA 2QR6A 4NUWA 5AC7A 5J5DA 3IIZA 3PBWA 4ZVJA 3PSWA 1UCWA 5K9CA 3SY5A 2VEIA 1ADOA 4QIUA 3O6YX 3RK8A 3FJ6A 4NJKA 5CZJA 1G4TA 1UJPA 4N9CA 3FKRA 1S5WA 3S5ZA 3E12A 2ISVA 3MW7A 4ONVA 4J9JA 4JTLA 2Y6ZA 3IIOA 2BZNA 1JRCA 3B8DA 3OVQA 1NSJA 1XXXA 3W7MA 2QCDB 3TK7A 2YW4A 1ZAJA 3HJZA 2P1FA 2RFGA 4AWTA 5CSSA 1TRDA 4UXDA 3Q58A 1O60A 3CHVA 1TV5A 3NGJA 1PCWA 1EP1A 2ZZ5A 1W3NA 4G1KA 4PCFA 5C54A 3L67A 4HNUA 4OQVA 3FLUA 1SW3A 3LXBA 3BV4A 3EWXA 3TSMA 1GYNA 2H90A 5HNRA 1XBXA 1KM6A 3GR8A 4ZQMA 3L5LA 1EWDA 3K30A 2PE4A 1W1ZA 1ALDA 5F2IA 3A9IA 2EHHA 2CU0A 2EF9A 3OIXA 3DHFA 1EEPA 3ABRA 2E77A 1SO5A 2E6AA 4JTKA 1DJNA 1PL9A 1RQEA 2ZTJA 3UD6A 4MZ8A 1KFLA 3W7QA 3CT7A 5TIMA 2YDAA 3C56A 4M7SA 4S1FA 2QCDA 5FEZA 3W07A 1CI1A 3G8RA 1FXQA 3MI3A 5D2YA 2E1DA 4NJIA 5K3VA 4JX6A 4IMGA 3H54A 3V75A 3P5ZA 3ZFHA 1TREA 4IXHA 4A22A 2VEPA 3LCLA 1LBMA 1KTBA 2V82A 1DQXA 1AG1O 3C0JA 4NT0A 3MHFA 1GTEA 4IQLA 1KM2A 3UPBA 2B7PA 2NXGA 3B0VC 4TR9A 1D9EA 3PB2A 3NDOA 4MLRA 1H51A 4E0CA 3MO7A 4IPJA 2Z0IA 4OU1A 2NX9A 2A21A 2DORA 5F1VA 3QQ1A 3W76A 1KM4A 4TU1A 1TB3A 3S1WA 3GNDA 3IGUA 4CLMA 3M44A 4P2VA 2DJLA 3GDRA 2ZRWA 1VYRA 3DKLA 3L5AA 3PBVA 1H7RA 1OYBA 1XL9A 2VFDA 4ORIA 4XKYB 3C4UA 3S5OA 4NQ1A 3KOFA 4YWIA 3LTPA 2VENA 5HULA 2ATMA 5BNKA 3G1YA 4MYAA 4RR4A 1GYLA 1ICQA 4PL1A 4UFJA 3N2MA 4JTEA 2B7QA 2A2IA 3PAJA 3U6WA 1S3HA 3HMJG 4JYEA 2YR1A 4LY8A 5IM51 3HO8A 4UTUA 3P74A 1TPUA 2JKAA 4D2JA 1P0KA 3N9SA 2B0MA 3W2UA 2KZHA 3I7QA 1JR1A 3EX3A 5U7SA 1DQWA 3TW6A 1B57A 4ZZ9A 1PHQA 2ZZ6A 3INPA 1TQXA 4K38A 3W9ZA 1I2PA 1SUXA 2PRHA 3RU6A 1WBHA 4AWSA 2GVJA 4ALDA 1BWKA 1G6CA 2YZRA 2QUUA 1H63A 3LLDA 2A1YA 1A5AA 3IRDA 1XUZA 3BGJA 2A4AA 3EXSA 3W72A 4O17A 1VRDA 5CZSA 1LM1A 3QMSA 3PC0A 2E5DA 2CZDA 1RPXA 1SZFA 4KKXA 3DFNA 4JXCA 2Y63A 3F4NA 1EUNA 3FYOA 2NXIA 2HMCA 4JTTA 1TPB1 3MYOA 4HPJA 1SFLA 3CC1A 2GJNA 2YW3A 4NX5A 1VCFA 5CPMA 1LOLA 1C8VA 1UUOA 3C2OA 1VJIA 3CPRA 5HMSA 5F2GA 3IVSA 1EPXA 1K03A 3W23A 4CNNA 1JQVA 2EGZA 3LRKA 3G1FA 3U8GA 5LSMA 2E09A 3G1SA 3O15A 2NUWA 3H53A 1O5KA 4NZFA 4HNVA 1C29A 2H3BA 2Z6IA 4WOZA 2OMAA 3W73A 4K7YA 3OVPA 4GUFA 4C1KA 2E5BA 2FLIA 4HT3A 3TSBA 5LZLA 1NF0A 5IBXA 3MHUA 5AOUA 1IXOA 2ZBTA 4O52A 5L9FA 1TIMA 3STEA 5AHEA 1GOXA 4UR7A 5EBUA 2CZFA 1L2UA 4C1LA 3ATZA 1QPOA 3QPZA 5AHLA 4LVAA 1QNVA 5D2VA 3OBKA 3HQ1A 1THFD 2C1HA 4DEFA 5DCDA 3C3NA 3W87A 3CEPA 2Q3OA 3L9CA 3QPYA 5AYYA 4R34A 4JR5A 2B7NA 3P80A 5F2LA 3M16A 1AW1A 1I2RA 2F7FA 2J9YA 3SGUA 1JCJA 3GDMA 1JQXA 1BWLA 4LC8A 3W3OA 1Q6RA 4GC4A 4PTNA 4S2CA 2GJLA 1RV8A 4MLJA 3TH6A 3UXAA 3EX4A 1VYPX 3O8AA 3W7RA 1GVOA 2OZ0A 5K7JA 2WNQA 2YYTA 4JDBA 5KITA 1QPQA 2C15A 3SFKA 1S5TA 2J24A 3NQDA 2J9ZA 3C2EA 3QMRA 1VLIA 3EKLA 1VQTA 1RVGA 4NJHA 4AF0A 4IWWA 5FEPA 3TSDA 4H3DA 3W86A 1WA3A 4ICNA 2X2GA 3NM1A 5E0KA 1UASA 2RHGA 3N73A 1RZMA 2A85A 3OA3A 4M5PA 1HTIA 2JGYA 4YL2A 3PUDA 4IGHA 4WXZA 1K8ZA 1W31A 1O5XA 3CLMA 3G1AA 1FCUA 1HO4A 3LCWA 1FWSA 3EWWA 5DBUA 3P60A 4UR8A 2ATSA 4LRTA 4JIQA 5CPLA 1H7PA 2QCMA 2Y62A 3IVTA 1SZGA 1YDVA 2X1RA 4AB4A 4M6QA 3EXRA 3KAOA 4FHAA 1AW2A 1SR9A 3M5YA 4GBUA 3F03K 5K9XA 5H2ZA 3HPZA 4X22A 3W85A 2WSRA 2JKPA 3LB0A 3TDFA 3KVKA 1X1OA 5DCEA 4BI5A 3G1XA 3W2LA 2YGYA 1LDCA 1PE1A 3QQ0A 3UY7A 2NV2A 3KXQA 3TC7A 4O16A 4YCPA 5CPNA 1JUEA 1DHPA 3P8IA 1SSGA 5LNVA 2X1TA 4RCXA 3M5VA 4IOTA 3LHZA 3EX1A 3ELFA 1QOQA 3W71A 2R8WA 3KHJA 1Q3NA 1QCWA 4ML9A 5EKYA 2R14A 1IXNA 2BSLA 1SSDA 4O28A 1T8XA 4S2BA 3NYZA 4O4WA 5D37A 1MSSA 3EWYA 1XDLA 3G8EA 2HS8A 4UNKA 3UWZA 2TYSA 4QNWA 3NL2A 4KFOA 5T26A 3PUOA 4JY8A 1Z44A 3DGRA 4A2SA 5K9DA 1I2OA 4JTHA 3UWYA 3QFEA 1LLWA 2W79A 2Y7GA 3TIMA 1ZAIA 2JKEA 2Q8LA 4JYFA 2FPVA 3MP3A 1ZFJA 4BR1A 3LI0A 4RK8A 2VEMA 4TIMA 4ZQCA 3FKKA 3W1NA 4MUZA 5GVJA 4FB7A 1GVFA 2NLIA 4YMZA 3R89A 2C3ZA 1DKWA 1H1ZA 2WOQA 4RXGA 1V5XA 4WXYA 3LHTA 1VGAA 3C61A 3A5FA 1GT8A 5C55A 4PC8A 1G7UA 1W8SA 1D3GA 3SI9A 3NVTA 4XBKA 3W7JA 4EF9A 1OF8A 1G7VA 1OVDA 4L4MA 2GVLA 4XWUA 4X2RA 2X1SA 1OX6A 1K7EA 3SW6A 3TMLA 1UB3A 4FF7A 4KFPA 1TTQA 4UNLA 1KFEA 5DXXA 2YYUA 3HG2A 3PR2A 3THAA 5D33A 2JK2A 4Y96A 3HBLA 2BLEA 3HPSA 3FA5A 3SJ3A 4DELA 3G1HA 1ZAHA 4UTKA 3TW7A 1H60A 3N34A 3SIZA 2NUYA 1JCYA 1SU5A 4DBDA 4N9BA 3CIWA 4JTUA 1N8FA 1B4EA 1TYGA 1TTIA 1IXQA 1I45A 3CIXA 1W56A 1TPVA 3YPIA 4DF2A 2LLEA 4GFSA 1TTJA 3GXTA 4XTDA 3LBCA 1OK6A 1H7OA 1KM0A 3NQFA 1YXDA 4HKPA 3NPVA 3BW4A 4JY9A 3W7PA 2JGQA 3CWOX 1O94A 3SGZA 3W1XA 1ZNNA 3W7NA 2Q3RA 1XM3A 1XBZA 1SPQA 3C2RA 3M47A 1XBVA 3SSJA 4WY0B 3GDLA 2I14A 5HR6A 2CLEA 4JTIA 1WOBA 4JS3A 3STFA 2ALDA 3LCIA 4JEQA 1AL8A 1G69A 1LORA 1FXPA 1OK4A 1YTEA 4M19A 5TBOA 2J6XA 4MPQA 5A8GA 3QRHA 2QCEA 1QR7A 8TIMA 3PB0A 5D05A 3OG3A 5EY5A 4FX6M 3EWZA 4I7UA 3AO0A 3LBMA 4JD4A 1O95A 2PCQA 1QPRA 1L6SA 1TPEA 3IIVA 2BWGA 1G4EA 2QDGA 5F4XA 1LRNA 5H91A 5KZEA 5G1YA 2ZRZA 1YADA 3Q94A 1EP2A 4R53A 4PODA 1DOSA 3G3MA 1OFRA 5HJLA 3W6YA 4UFMA 1H7XA 5I3GA 4Z1CA 1X7FA 3QZEA 3QSTA 4MY8A 5CG7A 2NX3A 1LOSA 4LS1A 1OHLA 1GPWA 3N3MA 4NNAA 1UBSA 2ZDRA 1EP3A 4WY0A 3HG4A 4O15A 2FDSA 2Y85A 3W7HA 4RZ4A 2GVGA 1F2JA 3G24A 3HOJA 1TJPA 1BTMA 2WPBA 1TO3A 2P10A 3VNDA 3HGJA 5D2XA 4XBSA 4HNTA 1KLZA 3MHGA 5EL1A 1M5WA 4AHPA 1W5PA 3DXIA 4P61A 4K6AA 1JJKA 3UQNA 3R12A 4UFLA 5I3HA 1H50A 3DI1A 4GNJA 2FPYA 1KBJA 4N2YA 5D04C 2VFGA 4IJBA 1HO1A 3WK3A 2RDUA 4O1BA 3TR2A 5AC8A 3GKFA 3PSVA 4H4IA 4QSHA 5MHBA 4PA8A 4TX9A 4K39A 4FNRA 2ZQ0A 1P0NA 4OHQA 3T7VA 3N9RA 3PG8A 4FNSA 5AHMA 3LCXA 1TJRA 4RKAA 3A5VA 3EX2A 3VCRA 3NL5A 4FNPA 1SO6A 5K4XA 3F4WA 3UZ5A 3G1DA 2I9EA 3NM3A 1QOPA 1MEIA 4ADUA 3G22A 4R33A 1ICSA 4K36A 4ZQOA 2X30A 1LP6A 2J88A 1BKSA 2YFNA 5J5RA 2JBMA 3KVJA 1H7WA 3EKZA 4O18A 3T44A 3GAKA 3N14A 4IMDA 3KRZA 1QWGA 3LTYA 2XN0A 4MIMA 2PRMA 5HWMA 2QCGA 3NPXA 4O12A 4OGZA 2FIQA 1KLYA 1FWNA 4LS0A 2G96A 1FUYA 3CWNA 4A21A 4BI6A 4RV8A 1Z48A 4MZYA 2DZWA 3G18A 3L0NA 4IXXA 4YXGA 2RDWA 3HGSA 1W5NA 3RFAA 3ZS4A 4N9DA 4NXSA 1TV8A 2P0OA 3ABSA 5F4SA 1YXCA 1XKYA 2DZSA 4LTSA 2V2DA 3R13A 4OV9A 3W1UA 1SW0A 3O6CA 3S6DA 3QMTA 4LVFA 2AQWA 4FO4A 5DN1A 1W0MA 1ZY9A 3NG3A 4AH7A 1OABA 1H61A 4Z1DA 2DZXA 1YYAA 3QW4B 4MFDA 2TPSA 4IUOA 5KSWA 4OT7A 4UFIA 1W37A 4NJGA 3MI6A 4YCOA 4PEKA 4UTJA 2Y7EA 5AYZA 4WJEA 1X1ZA 3QM3A 5D02A 3HF3A 4WZHA 2DZVA 2I1OA 3WJWA 3PS7A 1RR2A 3AJXA 4GUHA 2A5HA 4JICA 4U28A 1WBJA 4EOUA 2EAWA 3P5YA 5LGZA 1Q6LA 3MWAA 5EA9A 2H8ZA 2QCCA 3PM6A 4O53A 1JUBA 1OYAA 2Q8ZA 3C2VA 2PRLA 1TSIA 2V9DA 2Y61A 3HGOA 1KFCA 1VLWA 1XC4A 3KVMA 4HSOA 4LRSA 2WSQA 1A5BA 1ME8A 3BPWA 1ZCOA 3M43A 3S8HA 5D09A 1WV2A 4GUJA 2G97A 2YX0A 1DORA 1WOAA 1W5OA 4ZMGA 3M6YA 3NAVA 1KBIA 2C19A 1U83A 5CZ0A 3TMQA 2ZZ3A 3VI2A 1N7KA 3ABOA 3VFLA 1QPNA 3MBDA 2AGKA 1ME9A 2ZRXA 4AF0B 2Y88A 4ADSA 1TPFA 3B05A 3RNDA 5LHFA 1A5SA 3S5YA 3MP4A 3DFPA 2V30A 3NQMA 3MBFA 2NUXA 5I3IA 1I2QA 3RLUA 3ATYA 1VH7A 4AXKA 4IMEA 1MEWA 4AEOA 2ZZ7A 2DZPA 1DVJA 2HS6A 3I6RA 3FS2A 1KM1A 3L68A 1TPDA 4Q32A 2QJHA 1B9BA 3TC6A 5E1QA 2V8ZA 3VE7A 3P61A 3A22A 3BG9A 5BMWA 1EX5A 3UNDA 2ZZ4A 1SW7A 4RZ5A 2V5BA 5KZMA 2B7OA 3GK0A 1FWRA 3W7CA 3W83A 4JDYA 1GTHA 5LNWA 4RZ6A 1T96A 1W54A 4UCGA 4Z1AA 1OFEA 3P84A 2A7RA 3VKJA 2WSYA 1KFKA 2GQ8A 4DPPA 3PY2A 3PF3A 4K8EA 2V2CA 1SFJA 3UXDA 2CLIA 2E6FA 4TMBA 4EWND 2PC4A 1MZHA 2QCHA 4QISA 4UTWA 3W7IA 2ZFAA 4Y90A 1VS1A 2ZZ2A 4UC5A 1S5VA 1EA0A 4Q4KA 1KFJA 3IV3A 3CB8A 3LCFA 1E51A 2XN2A 3G0UA 1GVSA 4UMAA 4XZ9A 1GEQA 3L66A 2H6RA 4Q33A 3M9YA 1F74A 4MJZA 1J4EA 4OBTA 3T40A 2NX1A 3TJXA 3VE9A 3L65A 4LUJA 3TROA 3HG3A 4CCEA 3W7LA 3LXCA 1K3UA 2CZEA 1TTPA 3BGGA 1J5TA 1W3TA 4KFNA 4MY1A 3MYPA 3NZ1A 5D32A 5KZDA 2QKFA 6ALDA 4LT9A 2QUTA 3L0GA 4BFAA 4UTWC 4UTMA 1ME7A 1PVNA 5DBTA 3TAKA 2A0NA 3PUEA 4O13A 5LNRA 3B06A 3GXNA 3O6DA 3W7DA 2GUUA 1X6UA 3WK2A 1M7PA 2OX1A 4M7TA 3TFCA 3LV5A 2YXGA 5KINA 1EIXA 3BLIA 1LROA 4O19A 1W5MA 2BXVA 3R5EA 1KV5A 3LERA 3PVFA 1LLZA 3RLVA 1OX5A 3W1AA 5F2MA 2CLMA 4O0KA 4M6PA 4WUIA 4CCDA 2DJXA 1VCVA 3O06A 1VR6A 2C6QA 4JIPA 1QMLA 5TQLA 1B4KA 2VFEA 2E68A 1VHCA 3SZ8A 1OYCA 3TQVA 4QAIA 2YCEA 5BW6A 5AFDA 6TIMA 3LHYA 5AB3A 1TPC1 3LCGA 3PBYA 3W74A 3WJZA 2DZTA 4FXRA 4WY0F 4JTJA 1R2TA 3JR2A 3GB6A 5A5WA 3RF9A 1IF2A 5FF4A 2QCLA 2VFIA 1WXJA 1RQHA 1YDOA 3MJYA 1LZOA 2EPHA 2VEKA 3F1QA 3DU0A 4MVAA 2Z2UA 1FY6A 4JN6A 4HSNA 2R91A 3EXTA 4QQ3A 5CGQA 3TUUA 1YDNA 3IGXA 1HFBA 4PH6A 2A6LA 5DY2A 5HWJA 2YSWA 5G4WA 4GJ1A 4O14A 1I8JA 1JUKA 3QF0A 3GR7A 4JTGA 2QDHA 3EEGA 4N6EA 1VPXA 1M7OA 3NPWA 4HHPA 4HPXA 3Q37A 1IXPA 3BLFA 4MOZA 2PURA 3B0PA 5FEXA 2V2HA 1YPFA 1YXYA 2ISSA 3GYEA 3U2OA 3OVRA 5FEWA 4NXKA 2NZLA 4LVDA 3NQAA 4LC6A 1KM3A 5CPOA 1QO5A 4R7JA 3FIGA 4L4LA 5CSRA 1XDMA 1FCVA 5FF2A 4KWVA 2DZUA 4FNTA 1A50A 4XTIA 1GZGA 2D73A 2VELA 3C6CA 3W88A 4MZ1A 4AVFA 4IPIA 4PL2A 4FNQA 1B3OA 3ZWSA 1V7YA 3DZ1A 5FF7A 1F6KA 4FXSA 3G0XA 3OHIA 1W3IA 3BG3A 2ZCGA 4A29A 2VC6A 1PV8A 2ZYFA 5KMYA 4JTFA 3CTLA 4BWLC 1R30A 1KTNA 1F6PA 4DPQA 4WX2A 5E93A 5FF0A 5EPDA 3LTSA 1AK5A 2A7PA 3O07A 1Z41A 2WNNA 1D3HA 3MP5A 4EF8A 3S0CA 3C8FA 3QH2A 1KFBA 4LU0A 2CWNA 1FQ0A 5AHIA 1VHNA 3FOKA 3N19B 2FPTA 2VFHA 1OG0A 1FWWA 3W7KA 4GUGA 1AW5A 3TE9A 2H8XA 3A21A 1P4CA 3E02A 3B0UX 5LNUA 1FBAA 1QAPA 3UY8A 3GX9A 4RX0A 4M6VA 2ZRYA 4WOQA 3TFXA 1OFQA 3FJLA 3IIXA 5FESA 4JNMA 4Z08A 3UWWA 3TAOA 3TU9A 4I9AA 4IMCA 4DBEA 3M41A 1F05A 1QFEA 2TSYA 2YPIA 4LVBA 3NO5A 3GIYA 2W6RA 3HPXA 3TQKA 2Y89A 3BLEA 2QJGA 1LYXA 3LXAA 3KRSA 5EMUA 3MI2A 2CLLA 4I7VA 3P82A 2V5LA 2TRSA 3E96A 3P8JA 2QAFA 2OT0A 3BW3A 4NJJA 3EB2A 3NQ7A 4FIQA 1G4SA 3WK0A 4NU7A 3IGSA 1K8YA 4TO8A 1EWEA 4UMBA 2J27A 1T0OA 1F73A 1U5JA 1KV8A 2EKCA 4O1DA 4GWEA 4GRSA 1SO3A 5SWUA 1OX4B 3W2JA 3DBPA 4JX5A 4GXMA 1G67A 3T4CA 1TV7A 4O57A 1LRQA 4K37A 4QNEA 2V81A 5DCBA 1ZJIA 4CNPA 4LS2A 1OF6A 3USBA 4LW7A 3SR7A 3TX9A 3NOEA 5AHFA 1ML1A 3S1XA 4ADTA 4LVGA 4AWUA 4LNYA 3PG9A 3DH7A 3LLFA 3W7EA 2GPTA 4LV4A 1ZHAA 3FYPA 4DXVA 5D03A 3TKFA 2O7QA 4U4MA 4X9SA 3NQEA 2WV8A 3TXZA 1JCXA 2VXNA 1X8FA 2NV1A 3QYQA 4DF0A 3N2XA 3M7WA 1O4UA 2CFFA 3A24A 4NVTA 3DKJA 3MUXA 5D2TA 4OWGA 1XI3A 1OX4A 4OE7A 3S42A 3QC3A 3GDKA 4JX4A 5G2WA 5DLCA 3W75A 3L2IA 3NQ8A 5HWNA 2A6NA 2FTPA 3LM7A 1WAUA 3QSRA 4AAJA 1I4NA 1JCMP 2VKZG 3UWUA 3UYCA 3LHUA 1CW2A 1TRIA 3TNOA 4UTHA 1QO2A 2OT1A 3NXFA 4UFKA 4ZQNA 1K02A 5HUPA 1FWTA 3P67A 3PBUA 4XQ6A 4Z0JA 2WQPA 5LHEA 4IX0A 5KTLA 3CQ0A 4IX2A 4A2RA 1OFBA 2QF7A 2DU2A 3IVUA 5I3FA 3C52A 3PWAA 1N55A 4DO5A 3ZR4A 4ORMA 1OFDA 4ZQRA 4NX0A 3NR0A 1FCQA 1FX6A 1WX0A 3LV6A 3G3DA 4DO6A 4Z1BA 2R94A 3NNTA 3KX6A 1KA9F 3E49A 1H7NA 3W2NA 3EWBX 1Q6OA 5BRBA 3NL3A 2Y70A 2E6YA 2QUVA 5HINA 2VFFA 3NL6A 5HUOA 4XKYA 5G2IA 1R47A 1PS9A
chains in the Genus database with same CATH superfamily
3AS3A 2BMBA 3BARA 2Z1WA 4C6OA 3WQVA 3SN4A 4IMFA 5ECVA 2ISDA 1NARA 2VX7A 1YHTA 3FJNA 3FHAA 5LIYX 3W2MA 3AICA 3P14A 3LGEA 3DYMA 4Z0SA 3UETA 4RUBA 4GLEA 4AYGA 3CAKA 3R2GA 3A4XA 4PMXA 3RXZA 3WBEA 1JPDX 3FEMA 1VFFA 3P81A 2PCEA 4FAMA 1ODUA 1TV2A 2Y7FA 5CBJA 5DRIA 3LU2A 4GFIA 3CU2A 2CW6A 3W1PA 3T55A 3UR2A 3DIPA 1UA7A 4HOXA 4ZFMA 4YLWA 1QNQA 3QJAA 3ID7A 3BMWA 3S9YA 3B03A 1AMKA 2RKXA 1C91A 3W53A 4A8LA 3GFXA 3HIJA 5I00A 4DXXA 2FVLA 2QCFA 3DYOA 1A0DA 4BZYA 1M6JA 1GWJA 4UTTC 3W0KA 4FS9A 1R38A 4E5TA 4Q4PA 4MAVA 5AN7A 1SZNA 2ZZ1A 4RE3A 2E25A 2O7SA 1Q45A 3G1VA 1SMDA 3LD5A 1I0BA 2Z6JA 1HG3A 3VD7A 4EPEC 5EFDA 1L9WA 1UZHA 1LTDA 3UZJA 4GK8A 3N6QA 5LGXA 2A3CA 3T81A 1EJ7L 2GSEA 4MWAB 6XIAA 3BXWA 3WD0A 3CL7A 4DO4A 1GVQA 4RJEA 2WMJA 1PCKA 4M0XA 4DY1A 2PP0A 3I65A 2PTDA 1F5ZA 3QHNA 2G4JA 4K8HA 2ANUA 3QPEA 1W9DM 1PKMA 4UTIA 3K1DA 1BWVA 4BF9A 3ZIZA 4FPSA 2D0GA 2XWEA 2W9MA 4DLFA 1NVMA 2YL5A 4NNBA 1PX4A 4JTSA 3UNTA 1GQNA 1ONEA 1EHNA 1A5LC 3AXXA 2J8GA 3BLLA 3EOEA 2G5WA 2CXGA 3P6LA 4AW7A 3WJXA 1QJWA 1IWPA 1YMYA 2I56A 4Y9AA 4MWAA 1PZ2A 3VABA 2OCZA 3RMEA 2XFWA 1FP8A 3WH7A 1Y5XA 2V5JA 4QE4A 2BOFX 1IGSA 3RLHA 1IZKA 2FJKA 4HPGA 2HSAA 1ICPA 3TA6A 2G95A 2IPWA 1LOQA 4FX8A 5DY3A 1PZ3A 2ZA3A 3JW7A 3SFWA 2DSWA 1TVLA 4H6EA 4F79A 3ARWA 4HSHA 1J0ZA 1HNYA 3QEZA 1TV3A 3W7GA 3SRKA 1S2WA 2ZRUA 1NELA 4BI7A 3VO0A 1Z42A 4F0HA 4UQDA 2ICSA 4UUIA 3EMQA 1D8WA 5D30A 4PRTA 5HDRA 2RH9A 4IIFA 2HE5A 4DLMA 3O0FA 3FFSA 4E2VA 1GG0A 1TJ1A 5LNSA 3ZVHA 3E38A 1OQFA 2F2KA 2GWNA 1Q6DA 1BPLB 2ABBA 1DXEA 1XP3A 2EPKX 1G4PA 3FK4A 4AXNA 2QDEA 2YXXA 3BVJA 3LPOA 4FOKA 4U3AA 4MJ2A 4PMJA 2Y7DA 4QS6A 2YZ5A 1JNEA 1K9FA 4UTLA 1O66A 2Z7GA 1XCFA 2PWDA 4POCA 2AGTA 1EC9A 1ZENA 2H3DA 1QOXA 4ATDA 1DBTA 1T99A 4AIEA 5I3KA 3KTCA 3GG7A 3OIHA 4CQ9A 4YVXA 3RGTA 1NOUA 5BYWA 3KHDA 3CLWA 1WUFA 3QYSA 1NJJA 1XFBA 5IDIA 1VZWA 4W7UA 3S4TA 2OPJA 3D3FA 2FB3A 4O8AA 4L9YA 4OV4A 1JEZA 1FWHC 3C86A 5HNTA 3GDTA 2DT3A 3EWUA 4W86A 4DYEA 1SO4A 1XRTA 1K7XA 3SCUA 2OZ8A 2ZRVA 3A3XA 1I2NA 1SQ7A 1O68A 2CLHA 2HK0A 1HF6A 1EL3A 1A53A 4N02A 3GFZA 3VINA 1Y0EA 3NQVA 2WBGA 4AD0A 1OGBA 3SCWA 1DJZA 4RW5A 1XD0A 3IIZA 1UCWA 2ZXAA 5K9CA 3PZMA 3RK8A 1G4TA 1K9TA 2TODA 2VHLA 3T0TA 3FKRA 1S5WA 2VC9A 2WKLA 2ISVA 1XLMA 5KETA 4J9JA 3OQEA 2Y6ZA 3B9EA 3B8DA 3OVQA 1NSJA 4Q7BA 4XIMA 3HM7A 2YW4A 4PUNA 1ZAJA 3HJZA 5CSSA 4UXDA 1BTCA 1P0DA 2QLYA 2ZZ5A 1W3NA 2YXOA 2CKSA 3CL8A 3CV6A 2ZX6A 4OQVA 3PZUA 4I9JA 3LXBA 4V1YA 3BV4A 2AAAA 2D2GA 1GYNA 1Q7ZA 1XBXA 2GDVA 3KL5A 4B9ZA 5F2IA 2CU0A 4V15A 3WL0A 3Q45A 1C9WA 3TCSA 2PFHA 3ABRA 1SO5A 4C6BA 3CUXA 3R6IA 2XH4A 1X6NA 4MZ8A 3OU8A 1KFLA 2YDAA 1GKPA 1Q5MA 3C56A 4PB4A 3H21A 3W07A 3S2MA 1M1BA 3E0WA 2OYMA 3FN9A 3TTSA 4BCEA 3UJFA 2WAGA 4IMGA 3OW1A 2J7GA 5A8PA 4OTKA 2YCIX 1DIKA 2V82A 1DQXA 1PEZA 5A6LA 3C0JA 4D6EA 4IQLA 5ABEA 4I6VA 3EDKA 1LT7A 4QEHA 4CD7A 3MUAA 3H4GA 5CJMA 1ZBVA 1H51A 4E0CA 2Z0IA 2NX9A 4W8BA 1UIOA 2WYSA 4HU8A 2NQZA 3IGUA 3WSUA 2XIBA 2BP1A 3M44A 3PJWA 1FFRA 3WBYA 3H26A 4GZ7A 1XJBA 3WQCA 2J6VA 2ZRWA 3L5AA 3PBVA 4FXFA 1OYBA 3NDZA 3U4AA 1XIFA 3AXIA 4XKYB 3PNZA 1UPPA 4NQ1A 1EFZA 1CXEA 2QHAA 3NSMA 1R9XA 3WNMA 3LTPA 5FL1A 1UWIA 5FJTA 4MYAA 4XD6A 1PZ0A 2W66A 3N2MA 2CHRA 3GC4A 2BFGA 3VDAA 4J40A 4JTEA 2B7QA 2A2IA 3PAJA 3U6WA 3F2DA 3QGAC 5IM51 3T0DA 4YWSA 3MZ2A 5C8BB 2PWHA 4EX4A 4PBGA 2PDBA 4D2JA 2G3NA 4FLRA 2V3EA 3CL6A 3N9SA 3D47A 6REQB 3I7QA 3EX3A 1P6CA 3OG2A 4ZZ9A 3UR8A 2YCJA 2GDQA 2ZZ6A 3LQGA 4GG9A 3WLTA 1DEDA 2QT3A 3KP0A 4IPNB 1SUXA 1GZ1A 2VR5A 2PRHA 4AWSA 1G6CA 1IV8A 1YW1A 1L6GA 1DWFM 2FVMA 2WHLA 5HK4A 2A1YA 1LM1A 3QMSA 1CCWB 3PC0A 2BXYA 5H6HA 2E5DA 2CZDA 4KKXA 1GQKA 4JXCA 3S1GA 3CGTA 4JTTA 2QQ6A 1TPB1 5A94A 2WCGA 1S39A 6REQA 2YW3A 4NX5A 1VCFA 2QIIA 3CPRA 4L9XA 1FHDA 1QATA 3LRKA 2WXDM 3G5EA 3G1SA 3TEVA 3VIKA 3KOXA 3CZEA 3W73A 4K7YA 5EMMA 2I5IA 2E5BA 2FLIA 1E6SM 3TSBA 4LYPA 2BV9A 3UFYA 3GH5A 2EJ1A 1NF0A 3CHEA 4R9OA 2ZBTA 5L9FA 3STEA 5AHEA 1GOXA 4IL0A 4UR7A 1L2UA 4P8VA 3QPZA 1QNVA 3HQ1A 1THFD 2C1HA 4JHMA 4H9ZA 4YJ5A 3C3NA 3BL3A 2FDMA 3WLJA 3TTEA 1DPMA 2EQDA 1TVPA 2B7NA 3UGRA 3M4HA 2CETA 1UR2A 1AW1A 3CV1A 1JQXA 5I0DA 2ESCA 1KFWA 3W7RA 1FWFC 1PPIA 5K7JA 2YYTA 4JDBA 2RUSA 3NWRA 4LB3A 3OLGA 4BS0A 4MNMA 3QMRA 1VLIA 1DIEA 5FEPA 3WYZA 3FSUA 2X2GA 4KT2A 1US0A 4JOMA 3N73A 2XGIA 3GM8A 2PGRA 3UESA 3OA3A 1X1NA 3KCJA 4IGHA 2XFYA 3CLMA 3LCWA 3EWWA 4BKNA 4AD4A 4RW3A 5DBUA 4PMRA 3N17A 2ATSA 4LRTA 1R3VA 3H24A 3A4JA 4S3KA 2J7FA 1XV8A 2QCMA 3B9OA 2OQHA 5M1TA 1YDVA 2X1RA 2FZMA 2OSXA 4I5UA 5MKGA 1SR9A 3I6TA 3M5YA 5CC7A 1ESWA 3HPZA 3W85A 2WSRA 3TDFA 2XGBA 1X1OA 3GY1A 5DCEA 3G1XA 3W2LA 3SGGA 3UY7A 2NV2A 3TC7A 1NDZA 1DHPA 3P8IA 1SSGA 2CNCA 3KS5A 4PR4A 3M5VA 3LHZA 3VGFA 3GXDA 1WZMA 2CZVA 2R8WA 1FH9A 5EMLA 3VD3A 1Q3NA 1QCWA 9XIMA 5EKYA 1FWJC 3BDKA 3OTRA 2BSLA 2OGJA 1XF0A 1Z3NA 4E2OA 1RCXB 2NQJA 3L23A 3M0VA 2XISA 3DGRA 1UD2A 2E7FA 4US6A 4A2SA 5K9DA 3VOJA 2PS2A 4L9ZA 1EGMA 1FH7A 2DQWA 4KMQA 3F2CA 1W9VA 4GXPA 4EACA 3T2OA 4ACYA 2OGYA 4P8XA 2VEMA 4TIMA 3W1NA 4MUZA 5GVJA 4HP5A 4CN1A 1GGOA 4IM4A 1M41A 1XYFA 3TYZA 4GNVA 2EKGA 2WANA 3C61A 4U33A 5EB8A 5DMYA 4GX8A 3UCDA 5A95A 3C0SA 5B7YA 4ZTYA 3SUUA 2VC7A 4RPPA 4XISA 3SI9A 3JUGA 1HP4A 3L2MA 1EIBA 1N2VA 4XBKA 4GO8A 1WZKA 3H6OA 4PUKA 5BXSA 3QR0A 4X2RA 1C8YA 1K7EA 4NSBA 1RJRA 3RM8A 5HQLA 4FF7A 3W37A 1MRQA 4QFUA 2YYUA 4ROQA 3HG2A 2Y8VA 3KWXA 3SUSA 3GC2A 3HBLA 2BLEA 4JNYA 1UROA 1XCWA 1FWAC 3K1GA 2VNCA 2QDDA 4AX7A 1O1HA 3ARPA 1ZAHA 4U5KA 1JCYA 4H01A 3CIWA 4JTUA 2EJAA 3A6OA 1B4EA 3MCOA 3ZQ9A 1RK5A 1IXQA 3ITYA 3WENA 3EA1A 1W56A 3YPIA 4DF2A 1OIFA 4MMWA 1RD6A 1WDQA 1A5OC 3V16A 2PP1A 3K13A 1FRBA 5G1MA 2DZAA 2R9RA 3WBAA 1O94A 3W1XA 1RJQA 4AEFA 3W7NA 2HEJA 2Z00A 3M47A 4ACZB 2I14A 5HR6A 4JTIA 4GI4A 4B5SA 4R85A 3STFA 1E43A 4H7VA 3M07A 2OWCA 4M8UA 1QK0A 1RXOB 2J6XA 2DUZA 4EAMA 3WNPA 5A8GA 3PB0A 1PX8A 4A3RA 2VJXA 3OG3A 3VIIA 4PCPA 4F0SA 1YNPA 3LBMA 4JD4A 4PUDA 4PMOA 2FZNA 1QPRA 1L6SA 4YVVA 3RITA 2QDGA 5F4XA 4P8WA 4C5ZA 4GY1A 2O4QA 1A4LA 1JYWA 3MCMA 1OFRA 3IJLA 3B3DA 5FJRA 2QMJA 1X7FA 3QZEA 3P3BA 3QSTA 4MY8A 5CG7A 2NX3A 3P2VA 1UHVA 1OSEA 1EP3A 4ACZA 3MO4A 1BF6A 4O15A 1WAWA 2FDSA 1KR1A 5A6BA 2GVGA 3SRDA 2WPBA 1E9LA 3CMFA 3HQOA 3HGJA 3UXIA 5EL1A 4M29A 4AHPA 4X61A 2VUYA 4WEVX 1I1WA 4A8NA 1UP0A 2YKKA 4JTDA 1XIBA 3N11A 3UQNA 3PTKA 1UMLA 3CBWA 2GVYA 2OG9A 3VNIA 3OZMA 2WJDA 4H9TA 1DQUA 1LT8A 1XIMA 4IJBA 1H11A 3FYYA 4HYRA 1XH0A 4GA8A 3RRAA 3KM8A 3TR2A 5AC8A 4H4IA 5MHBA 4PA8A 4K39A 1OGGA 3QVQA 4LEQA 3T7VA 3PG8A 5AHMA 4HNCA 3SRHA 4YHEA 1U5VA 3ECQA 1VFOA 2VWSA 3A5VA 5A6SA 3EX2A 5BOFA 1LF1A 1QXLA 4ZOEA 2BS9A 3CTTA 2I9EA 1QOPA 4GYPA 3HFTA 4JKLA 4AFYA 1MEIA 3QLLA 1TA3B 2V3DA 1FA2A 1DIOA 3BLKA 1ICSA 3ITXA 4ZO9A 2BB0A 1JDCA 1AFSA 4N42A 1HKVA 3VU2A 3VA8A 4I8YA 1GVIA 3GNRA 4EKJA 3S47A 5HPCA 4IMDA 5FCZA 2XVKA 2XN0A 4MIMA 2OWWA 2PRMA 1VFLA 2FIQA 4H6QA 1JZ2A 2G96A 2VD8A 4A21A 1PAMA 1QASA 4MZYA 2DZWA 3G18A 2J7BA 4UWMA 2Y0FA 3VNKA 3HGSA 3APGA 3ZS4A 4FXJA 2CKRA 2Z29A 4N9DA 4IIEA 4UQBA 1CT5A 2DVTA 1YXCA 1SW0A 3S6DA 2AQWA 3U2CA 2ZUWA 5LIXX 5CPTA 1H61A 3WMBA 1YYAA 1S2CA 2VRJA 1UWRA 3RG6A 4IQJA 4CU8A 4F66A 3HQPA 3T08A 4UFIA 4PTVA 4IP7A 1KKOA 3URAA 1TG7A 1X1ZA 3GXIA 3E0VA 1CECA 5JMUA 3I4KA 4QXIA 3EOOA 4LBUA 1UA3A 1V77A 4F2TA 4U28A 1KBBA 2EAWA 3BICA 3P5YA 4NZ3A 3SB0A 1Q6LA 5LGZA 5EA9A 4IGMA 4G7FA 3TWAA 3PM6A 3T05A 3HGOA 1KFCA 1VLWA 4HSOA 1G1YA 1U30A 1S2VA 1MQRA 4GZJA 3GVRA 4AZ6A 4UQAA 4KESA 2L5HA 2C19A 1QI5A 1U83A 2XM2A 4ATWA 4CEUC 1QPNA 3MBDA 1ME9A 2ZIDA 4C7FA 4AF0B 3MQTA 4ZSTA 1UR4A 5BXRA 1A5SA 4DUWA 3QY8A 3VUSA 3CAWA 2PDHA 2PD5A 4DBSA 3MBFA 3RYSA 3ATYA 1V0KA 4ECLA 2ZZ7A 2DZPA 2HS6A 3BJFA 1KM1A 3K8KA 1WDSA 2QJHA 1B9BA 2ADAA 3VE7A 3GG0A 5CCZA 4RE4A 5BMWA 1IEXA 3VKBA 3CS2A 3KBWA 1CPUA 5HPOA 4C1NB 4DM2A 3GK0A 4GO9A 4ASTA 1RA0A 3VK5A 2W5FA 3GQYA 1GTHA 3IJ8A 3GR4A 4RZ6A 4GZIA 3GDBA 2YDQA 3MKCA 4QAWA 3P84A 4CQCA 2A7RA 3VKJA 5IXEA 3PY2A 3SCOA 2V2CA 1SFJA 2NSOA 1TMLA 2PC4A 1KD0A 1ELSA 1MZHA 2PGFA 4QISA 4M3PA 3W7IA 3B4YA 5HANA 4UC5A 1KFJA 3GNXA 3G0UA 2SFPA 3VGBA 3L66A 3M9YA 1F74A 4MJZA 1J4EA 1JXKA 3ABXA 2NX1A 3AFBA 3T40A 2W67A 1PWMA 4MKSA 3HG3A 3OOQA 1ITXA 4C1NA 3PZGA 2CPUA 1JGIA 1TTPA 1KO0A 2QKFA 6ALDA 4LT9A 1IE7C 4ZODA 4BFAA 4M24A 3GXNA 3O6DA 4PFHA 4MHBA 2YL6A 2DSUA 7ODCA 1CTNA 4Y8EA 4GJJA 1OCQA 1LROA 1JZ8A 2BXVA 3M0XA 1BG9A 1LLZA 3RLVA 2XINA 3V7PA 1EZ2A 5JBEA 1DTNA 3MSGA 1R6WA 1E70M 4ENLA 5JUVA 4M6PA 4ZA0A 1VR6A 2C6QA 4WSHA 1VHCA 3SZ8A 1K6AA 5T91A 4QAIA 2YCEA 1UZ1A 5AB3A 4DWSC 3UU0A 5XIMA 4CU6A 4I90A 3B9NA 4XD5A 4JTRA 1JDDA 1IGWA 3RF9A 5JH2A 2QCLA 2XU2A 1WXJA 1YDOA 1W3HA 1A4MA 5FJPA 3NTYA 3DU0A 1W9BM 3QC0A 3GVVA 4JN6A 3P93A 3W24A 4XZWA 4AY8A 3MKVA 1YDNA 2V5KA 2PMQA 1O5RA 1JZ4A 2OSYA 1UQYA 5DY2A 5G4WA 3DC0A 5LXXA 1GOIA 4DXKA 2PTWA 4WSKA 4N6EA 1VPXA 3NPWA 3ZLFA 1DJGA 3BLFA 2WWCA 3WLNA 1KNWA 3I10A 4Y7EA 4LVDA 5I24A 4W85A 2OSWA 2PGEA 4LC6A 1KM3A 1QRQA 4W5UA 1QO5A 3DN5A 3D5HA 3SN1A 4NY2A 3DHUA 4XTIA 2P0IA 2C71A 2VD9A 2D2HA 3C6CA 4HU0A 1W1YA 4Q4OA 3U9IA 5FF7A 4OFCA 1F6KA 1UWQA 1W3IA 2OR2A 1TX0A 2D2JA 1PV8A 2ZYFA 8A3HA 1H0IA 4ATLA 3CTLA 5J8LA 1GCYA 5A6KA 4KIEA 2YOCA 4IIHA 4WX2A 2I9UA 2A7PA 1UZ4A 3O07A 1Z41A 1D3HA 1BYBA 1KBLA 1E56A 3S0CA 1J96A 4CVUA 1KFBA 4LU0A 1HL9A 5AHIA 3WL1A 1QVBA 2PDLA 2FPTA 3VGEA 1UD4A 5CLTA 1B9ZA 3CPGA 1W32A 3WLHA 1AW5A 2I5QA 3U4FA 2VGGA 4L1WA 1F3XA 1FBAA 1QAPA 3WD3A 3QY6A 6A3HA 4WOQA 3TFXA 3FJLA 5I2UA 2VC5A 3UWWA 1YIXA 3TU9A 2WSPA 4I9AA 2IQDA 4JFVA 2OX4A 5D9PA 1V3MA 2QYGA 4PMUA 2I5GA 2TSYA 1QT1A 3RPTA 1CBGA 3NO5A 2R1NA 3HPXA 5CPQA 1XQKA 3KRSA 3G1RA 2BDQA 3MS8A 3UZWA 4AUBA 2D3LA 1SJBA 3FXGA 2CLLA 4GIAA 3UZZA 3PJXA 3PTQA 4XZBA 3VNMA 2TRSA 1IT8A 1E0WA 4DJFD 2PWVA 1V3HA 1QI3A 2ZXQA 2QAFA 3VZXA 3ARQA 4MAZA 1UR8A 1ITCA 3TYEA 3BW3A 1G4SA 2IS7A 2IQ0A 5E9AA 1EWEA 4ML4A 3ZLHA 4BJHA 3M0KA 5LIKX 1OCNA 3W2JA 3CV2A 1Q8JA 3DBPA 4JX5A 4GXMA 1TV7A 4XD3A 1BXBA 3DOPA 1UKTA 3LENA 5DCBA 1REQA 5E0CA 3N2BA 3N4FA 4CNPA 4E3VA 2YBVA 3AMKA 1JYXA 3TX9A 3U0HA 2DW7A 1ML1A 3S1XA 2ALRA 4RPQA 4LV4A 1NDVA 3LNPA 2B81A 3FYPA 2E67A 1PWLA 3ZT5A 3TKFA 4LAUA 2O7QA 2X42A 4X9SA 3IACA 5CSYA 3VDCA 1DHKA 4DNHA 4RDZA 3WDJA 4KBXA 3WD1A 4DF0A 3WNKA 3ZVIA 3A24A 4W7VA 4OWGA 3S42A 1CIUA 3QC3A 4GISA 5AECA 4JX4A 3C0LA 3W75A 3NQ8A 5HWNA 2A6NA 3L2LA 1GQJA 1B30A 1FVPA 4OJYA 4AAJA 2J66A 3RX4A 3ITOA 1J93A 3FVDA 3LHUA 3WLRA 1CW2A 4R88A 3T0CA 4HYWA 1V79A 4O1FA 3TNOA 2VURA 1HKIA 1QO2A 2OT1A 2FGZA 5HUPA 2PDKA 1FWTA 4LUSB 4AZGA 4GVIA 1U1UA 1P6BA 3V18A 1IWBA 2HK1A 2PLMA 1GYMA 5LHEA 5RUBA 5JVLA 3CQ0A 1XSIA 1OFBA 2QF7A 3KBSA 5I3FA 3HU7A 1N55A 4ORMA 4DUOA 2PI6A 1FX6A 1U1HA 2E4TA 3A9BA 2ZUUA 4DO6A 2HXUA 4KQNA 4Z1BA 3NNTA 2GVEA 3KX6A 4GYFA 1I75A 5CQ1A 5FJUA 3E49A 4C90A 1H7NA 4R5EA 2Y8KA 5BRBA 3GNOA 2E6YA 4PBFA 1ZGDA 4AY1A 4LFYA 5G2IA 5IFTA 4CCZA 4TO8A 3TV8A 5I78A 1JCLA 1GUVA 3AU2A 4GCXA 2EPMX 1FKXA 3KBMA 1VP5A 1H1YA 5BOOA 4CNSA 4J28A 2PWEA 3M0ZA 3T1GA 2ZA2A 1C9DA 1WPCA 1EQCA 3P62A 1UUMA 2F84A 3MUIA 3MMWA 2BY1A 4LUYA 1J10A 4B5WA 1P0EA 3E0LA 1VJSA 1ONWA 3MDWA 5C5YA 3TQ0A 3OLIA 3S1UA 1BLIA 1DWAM 1FWDC 1WDPA 1FCBA 4J4KA 5HA7A 2QJIA 3BOXA 3M0LA 2E6DA 3DFSA 1N8WA 4QG6A 3STGA 3GNPA 4O10A 4QM1A 3H55A 3STCA 2O55A 1R3SA 1KM5A 4WVXA 3IEBA 5HJXA 4O1AA 3K8LA 1J2WA 4W9TA 3GAYA 1CGTA 1PDZA 3CM4A 3NZRA 3GZ3A 1R7OA 3H70A 1EB3A 4L6DA 4RLIA 1EO5A 1IEIA 1GPFA 4AHOA 2WKJA 4LUTB 4S3EA 2RGMA 1JGMA 1TV4A 3GS6A 4AZIA 3LDVA 1FOBA 2YLLA 4O50A 3DFQA 1QBAA 3R8RA 3W22A 1OZQA 3SQSA 5A6TC 4BF7A 3FSTA 1NAL1 4KWWA 1R46A 5G5IA 4UTFA 2OELA 2TAAA 3MV11 4O11A 3KRUA 1F7BA 3GXPA 4H8UA 1O7AA 4PSPA 2ACUA 3RM9A 1V3IA 1MDRA 3IPWA 3M0JA 4QBXA 4QE1A 3O05A 1GKQA 1HUVA 1TMHA 1XR2A 3N1AA 1NWSA 4ZQPA 2D3NA 4KRZA 3MSRA 3OGSA 2RAGA 2Z1BA 1DJQA 1E1CB 2VGIA 1GHRA 5H1WA 1FP9A 1XYBA 2BNJA 3WG6A 1OJXA 3TVAA 1UBPC 3ITCA 1ZB5A 4GMEA 1GVRA 4I7WA 1FDYA 1J0HA 2IQTA 3LBOA 1NF7A 3UGVA 2X1IA 3B04A 4LF2A 3MKKA 4IIDA 1LRTA 3BCFA 1L6FA 3LRLA 3SECA 4IPLA 4ZEPA 3MB9A 1A3HA 4G8TA 3SDOA 4WQ6A 4HZ7A 1LCOA 3I7RA 4B5NA 1VB9A 3O63A 3EX6A 3NPUA 1E1CA 3SAZA 4XUGA 5BOEA 1H1NA 4DWSD 1TPWA 1XUUA 2GGIA 2WW5A 4GI8A 4Z1YA 5L6UA 3APYA 3ANYA 1W1IE 4GUIA 1PSCA 3PUGA 3TN6A 4NZJA 3PZQA 4FEZA 3THQA 2W0UA 4D72A 4QLLA 4UB9A 4E2DA 2AKZA 2BGNE 4QRNA 1LL6A 2QEZA 5F1UA 3OP2A 4PN2A 3TWBA 1FDJA 3O0KA 1OFPA 3UWVA 2CLKA 1MXSA 3A3WA 4UIOA 3R58A 4UR9A 4BWLA 4GYKA 4DQWA 1WDWA 4I6KA 4X3ZA 3C5QA 2UV8G 2CZ5A 3S2CA 5I3JA 5FIPA 2Q01A 1XSKA 1W5QA 2D1ZA 4BY3A 3WX7A 1V02A 1B2YA 4F4RA 2OXNA 3M1ZA 4CQAA 2X7VA 3ITVA 1H5YA 4L1XA 2NWRA 3ABQA 4EAYA 2PBGA 4O8RA 8XIAA 2ZTKA 3LRMA 1HQTA 2ABAA 3H12A 2Y24A 1PIIA 4ILSA 5D2WA 1JL8A 4NASA 2XN1A 4MFEA 1X7IA 4JGDA 3WMLA 1ZJBA 3MANA 1R2RA 5CPSA 4C6QA 1HKMA 1ISXA 4S3GA 2XSBA 3PZTA 3R8GA 1XLDA 2BXZA 3NQ2A 3RLGA 4XSMA 3WLMA 3O1NA 4WDWA 1TWSA 1BQGA 4GI9A 3VCNA 1EO7A 1IIGA 9XIAA 4WSJA 4UQEA 3VMNA 1SZEA 3I68A 4AVNA 2CLFA 1WKDA 3L21A 4ZL1A 1G94A 5FSDC 3ARVA 3NQCA 1P1XA 3DENA 2J25A 3Q2DA 1ZBWA 3GRIA 2QR6A 3ANVA 3JZUA 2D0HA 3NZGA 3PBWA 1XC6A 3PSWA 3IRSA 4XZHA 2VEIA 1ADOA 3O6YX 1M01A 3FJ6A 2XIOA 1B54A 4AD5A 5DMLA 4ZO8A 1NQKA 3EA2A 3ARTA 3W7MA 1B3ZA 3SY1A 5A69A 1XYCA 3IK2A 4YTQA 2P1FA 2RFGA 2XVNA 2W61A 2QPUA 5BRPA 1O60A 3CHVA 3ISIX 1TV5A 3NGJA 2QMKA 2MUCA 1EP1A 2YJQA 1MNSA 3PNUA 1A5KC 3KOZA 4PMNA 3LG3A 3L67A 1KCKA 1H4PA 1DTUA 1SW3A 2JF6A 2VMFA 2BVYA 3AYRA 3TSMA 2RJGA 5HNRA 1CB7B 4ZQMA 1SYTA 3MUZ1 1ALDA 3N6JA 4FALA 1Y65A 3A9IA 3BV7A 2EHHA 1N82A 3T4WA 2EF9A 8CGTA 4JKMA 1J18A 2E6AA 4JTKA 3M64A 3WH6A 4H41A 2QULA 3UD6A 1UP2A 5TIMA 5BWAA 3EYPA 4M7SA 3UG3A 3G8RA 5GNXA 5DX7A 1ZBKA 2EPNA 5D2YA 2E1DA 4NJIA 3W81A 4Z42C 1PKNA 3H54A 2VGBA 1T40A 3R8HA 1V51A 4ZBCA 4A22A 4C5YA 3GH7A 3O2LA 3R0KA 4I5RA 1XGZA 1VEOA 1SR0A 1TKKA 3DG3A 4ZB2A 3U2ZA 2Y4SA 2PUZA 1KTBA 2WM1A 4C6IA 3TOYA 2FMNA 3AHYA 3WLOA 3GU1A 4CD4A 4NT0A 4JIIX 5I07A 1GTEA 2NXGA 1ZCCA 4DI9A 3WNNA 4F9JA 3R7MA 4I8DA 3MO7A 4OU1A 4WHBA 2A21A 2DORA 1KM4A 1XIJA 4TU1A 3S1WA 2QF8A 2DV0A 1ZBCA 3BURA 3GDRA 3F7JA 3M0YA 2WHMA 4J7RA 3V3WA 1S46A 2VFDA 3UYIA 4JFWA 4LALA 4Q4QA 2J62A 3S5OA 2ATMA 1GYLA 1ICQA 4PL1A 3UW6A 3KOWA 4ICMA 1EJUC 3VGDA 1KGWA 1B31A 2YR1A 1XLEA 2VEGA 3CZLA 2KX9A 2YB4A 4UTUA 1AD1A 3R0UA 4AEEA 4QSFA 3VM5A 1DJWA 1P0KA 1EH9A 5ABFB 1E4MM 2FH8A 1JR1A 1DQWA 4S39A 3TW6A 3WDQA 4C6EA 4D1JA 2J4GA 1B57A 1JD7A 1W3KA 4GYJA 3W9ZA 4Z2JA 1I2PA 5C9UA 3URNA 3ZOAA 1XGEA 3T0AA 1BWKA 1WDDA 4L56A 4M80A 2Z4GA 4U3CA 3LLDA 2WJEA 4JTCA 1DYSA 1BGAA 1XUZA 3BGJA 2DSKA 3GXFA 2ZUVA 1J9YA 4GX9A 1RPXA 4B5UA 1XYAA 2Y63A 3F4NA 2NXIA 3K4AA 3BCDA 4HPJA 1E6PA 3CC1A 2YDSA 2GJNA 1JI1A 1VF8A 5ABFA 4RDYA 1C8VA 1UUOA 1VJIA 3SRFA 4EE9A 5F2GA 5A8OA 1VBHA 2VUNA 4CNNA 2RDXA 2EGZA 4NYYA 2E09A 2NUWA 1OCBA 4NZFA 4HNVA 4WOZA 3OVPA 2ZDSA 4GUFA 1BG4A 4KCTA 1UD8A 3L12A 3MHUA 4TX6A 3H2EA 1GK8A 1ZJAA 2QPXA 4S3BA 4JCLA 2CZFA 3RAOA 3WH5A 3CWHA 1QPOA 4YYCA 3QV9A 5AHLA 4PTMA 2CESA 4LVAA 4E8GA 5D2VA 3WEMA 4EXAA 1OC7A 3UJRA 4DEFA 4JCMA 4W89A 3QLDA 3L9CA 4IJRA 4Q7NA 4R34A 3WQWA 1E73M 3M0MA 3LPFA 5F2LA 3M16A 3GVWA 3GTNA 3SGUA 1JCJA 1P43A 1OB0A 4JIHA 1J0JA 3GTHA 5LYRA 3W3OA 2GJLA 3EX4A 1VYPX 1V4YA 2V5DA 3O8AA 5FA5A 1GVOA 2OZ0A 1CGUA 4HZ8A 3MVTA 1KBKA 1EGZA 2J24A 4OIFA 3KUMA 3ME3A 4HHMA 4BQ4A 1XLCA 1RVGA 1CXLA 4HU3A 1GOMA 2CHOA 1UASA 1CXFA 3L4WA 4TX8A 3L4UA 5C9ZA 1RZMA 4AYSA 2A85A 2A3LA 2XIMA 2WZIA 4TV5A 4YL2A 1PTAA 3PUDA 1K8ZA 1V93A 5ABGA 1U22A 3AUOA 4KF1A 1WNOA 4UR8A 5CPLA 1EYEA 3IVTA 2PEVA 2G50A 4AB4A 3EXRA 3KAOA 4H2CA 1RCQA 4GBUA 1OZMA 3VM7A 5H2ZA 4C60A 2JKPA 3LB0A 1JPKA 3WQFA 4FI4A 2Z1VA 3QQ0A 5F7UA 1JUEA 2DIEA 2X1TA 5D8WA 4RCXA 3B9AA 4AD2A 4HB7A 3WH8A 1EJSC 3ELFA 3W71A 2R1MA 4RE0A 1V7AA 2BHUA 2R14A 2ZX5A 1UQZA 1SSDA 2IUZA 5CC5A 3NYZA 4YTTA 4M1BA 3ZT7A 4CD8A 5HATA 4O4WA 3WZ0E 3XISA 3LPGA 3AHVA 3R4IA 3XIMA 1POKA 3PN8A 1Z9AA 2FMOA 1XDLA 3G8EA 3OZPA 5AZ0A 4P7LA 4XAFA 3ZSTA 3QZ6A 3BMVA 1Z44A 2FJUB 1ZPTA 1AQMA 4KS0A 1I2OA 3FXYA 4HA4A 1ZAIA 2A3HA 2JKEA 3GFYA 3W38A 4F3HA 2FPVA 1OCJA 2Z1SA 4QJ4B 2Y2WA 3LI0A 4B92A 4K3ZA 4ZQCA 2ASHA 4FB7A 2NLIA 2UY4A 3KCLA 3R89A 2JFEX 2C3ZA 4Q8OA 1DKWA 2ZUSA 1EJVC 1H1ZA 4RXGA 4GH1A 1V5XA 2Z26A 3ABZA 3LHTA 1KXQA 3N4EA 3MWCA 3I3EA 3WLPA 1GT8A 4PC8A 1G7UA 3FJ4A 2Y8UA 4AIBA 3NCOA 1IR1A 3W7JA 4QS5A 3FX4A 1DJIA 3IK4A 4L4MA 4H19A 2CERA 3TW9A 5FAJA 2X1SA 2WPGA 2E8ZA 4U31A 4KFPA 1VEPA 1HJXA 2P53A 1QTWA 4B16A 4NZ4A 7REQB 5A3HA 3PR2A 3THAA 3UPMA 2GGHA 2YCLA 3B0XA 2JK2A 4Y96A 5HOSA 3T0BA 3A4WA 1B3VA 1W2VA 3FA5A 5BU6A 3SCNA 1V02E 4DAIA 4DELA 4UTKA 1XINA 4CN4A 3N34A 3QR1A 2NUYA 4N9BA 1HVXA 1W9PA 1F07A 3RR4A 3WBXA 1TTIA 1GOQA 1I45A 2R24A 3UWEA 1TR9A 3F5KA 3TN5A 3UA3A 3VOGA 2LLEA 1GOWA 4GFSA 4XTDA 3LBCA 1KM0A 1YXDA 4HKPA 3ZMRA 3AXKA 4JY9A 4LAOA 2PGWA 4LGXA 1XG4A 5AC5A 5HMEA 1AZ2A 5EMKA 3QXBA 1XD1A 1XBZA 1XBVA 2YB1A 3IJ6A 1E15A 4JS3A 2ALDA 4QLJA 5AZ1A 4CNUA 2UY3A 1G69A 1FXPA 1OK4A 3GVQA 7REQA 4M19A 3N2CA 4QROA 4MPQA 4A4AA 5D05A 2FZDA 1AJ0A 3STPA 2XIIA 1JI2A 5D9NA 4I7UA 1KRAC 2YL9A 1MUWA 3WEZA 1PX3A 3CUJA 2PCQA 4URIA 2BWGA 1HXJA 3WCZA 1G4EA 2V6AA 5KZEA 4P7OA 2ZRZA 1NH6A 5M03A 3Q94A 5KEZA 4ZR8A 5DFAA 1DOSA 1L8PA 1TCMA 4YTUA 4Y9MA 4GY7A 1XYZA 1LOSA 3SUWA 4NNAA 2ZDRA 3BOFA 3BZJA 3N4AA 2Y85A 4K68A 1M3UA 1WKEA 3G24A 4C7DA 4LX4A 5D2XA 3A64A 3VGGA 2PTYA 4HNTA 1KLZA 1GW9A 1M5WA 4Q8MA 1XKJA 1BYCA 1LL4A 4NILA 4BA0A 2E8YA 2OO6A 3BJTA 5I3HA 1H50A 3DI1A 1RH9A 3H8AA 1ONXA 3REQA 3ITTA 1T7LA 3IUIA 3WK3A 1MXDA 4O1BA 1JNDA 4ZCWA 3GKFA 5AVNA 3ZLGA 2CYGA 4OHQA 4P7RA 2EG6A 2GK1B 2JQXA 8XIMA 1TJRA 4RKAA 1QI2A 3VCRA 3F4CA 4FNPA 1SO6A 4N0RA 3TLQA 2NQ9A 3N04A 4E4PA 1MMFA 4GKTA 4UOJA 2J88A 1C90A 5J5RA 1H7WA 2BG5A 2PDNA 1RSCA 3BLPX 5CBIA 2OQLA 4Q8QA 3T44A 4TOQA 6CGTA 2KAUC 4YTSA 4I9MA 1QWGA 1OINA 2JE8A 4WKFA 2VO5A 5HWMA 1NTHA 4OGZA 2J75A 5DO8A 1FUYA 2XYLA 3CWNA 4G56A 5GQBA 4MG4A 4BI6A 2QJNA 2PDXA 3L0NA 4YXGA 1F4HA 2ZWZA 1RBLA 4ZO7A 4J3SA 3U48A 4PUWA 2P0OA 4F0RA 3BE7A 3ENLA 4LTSA 3W1UA 2POTA 3O6CA 3QMTA 2W92A 4NG3A 2XJ7A 2EPLX 3V5CA 4FO4A 4HQVA 4QHRA 1ZY9A 1VIZA 4FOJA 1OABA 4Z1DA 3IJ7A 2OKOA 4C91A 4MADA 4WIWA 3CZJA 4H7CA 4XZMX 4WLCA 5MF5A 1W37A 4NJGA 3MI6A 1RCOB 2GGJA 2W4XA 1EDGA 3HF3A 1CLXA 2HXTA 3WJWA 3AJXA 4GUHA 4JQ4A 3EKGA 4JICA 1WBJA 1B1YA 4NIRA 4H9XA 3MWAA 5DANA 2GYIA 3NO1A 1KXHA 2QCCA 1JYNA 4XX6A 4LEFA 1JUBA 1GQLA 2W91A 3VC6A 1R9ZA 2V9DA 2Y61A 1MYRA 4XV0A 3WQGA 5KZ6A 5IFPA 3KVMA 2WSQA 3F2BA 1EF3A 1OT2A 3MVIA 3M43A 1JF5A 3NYDA 1WV2A 2F6UA 4LJ3A 3ZO9A 1K70A 2CBJA 3PPCA 3M6YA 4HMEA 1CDGA 1KBIA 5CZ0A 1T41A 3BWWA 3W00A 3WBWA 4C6CA 4ADSA 2A79A 1QNPA 2J7HA 3V0UA 3NIYA 4GBDA 1UH4A 1XYMA 4ERIA 2V30A 3AMLA 3WDRA 1I2QA 4AEOA 1Z7AA 4Q32A 4IISA 5E1QA 3CK5A 4INFA 1RJPA 3A22A 3UNDA 4FA3A 3ZSSA 1E0TA 1ISWA 1FWRA 1UMYA 4AZBA 5LNWA 4YU1A 1LWJA 4I5XA 5C71A 4UCGA 5C70A 2YCKX 3WNLA 3VKDA 1XLIA 4B9YA 4ZGYA 3BZGA 2ZXBA 2CLIA 4DB7A 3DEQA 4TMBA 3UA4A 4FSAA 5E70A 1UR1A 2C1GA 4DRSA 4D6GA 1EA0A 4Q4KA 3IV3A 1E51A 3CB8A 3LCFA 4C6JA 4XZ9A 4V27A 4AZHA 1GEQA 2I17A 2H6RA 3SUTA 4Q33A 4J3VA 3WF1A 2J8FA 4C6PA 5EU9A 6PTDA 3SCSA 2DPEA 3C2YA 1EA9C 1K3UA 1MFUA 1K77A 3E2QA 4H9VA 4MY1A 4RE2A 1UPMB 1JIBA 4H8NA 3UP8A 4MJ4A 1A3XA 4KCWA 3TAKA 1QNSA 2OEKA 2PLJA 1XDJA 4O13A 3B06A 2GGGA 4UZUA 1K1DA 3U5UA 3W6LA 2GUUA 1M7PA 3VZZA 1PTDA 2YXGA 5KINA 1EIXA 3N25A 2HPIA 2CCRA 2X2YA 4CD6A 3B8SA 1E9ZB 3PVFA 2F6XA 1ZSXA 3GTXA 2JF7A 4OUEA 3W1AA 5F2MA 4CCDA 1AQFA 4MDOA 1VCVA 3O06A 2Q8XA 1B4KA 5FKYA 1Q4NX 1LQAA 2E68A 1OYCA 3TQVA 1CGVA 2NT0A 1PYMA 6TIMA 3PBYA 3WJZA 1VBGA 3HQNA 4FXRA 3FGCB 3JR2A 7TAAA 4DZIA 1GVEA 1IF2A 3CUHA 3ZJ7A 2NV9A 1LZOA 2EPHA 3F1QA 2Z2UA 1BXCA 1FY6A 4G9PA 3K4DA 4QQ3A 1YEYA 1BYAA 5LA0A 2QXWA 2A6LA 1SMAA 1HJQA 2CWXA 3WD4A 3VDHA 2OO0A 3AC0A 3KTSA 1I8JA 2FHBA 1R0MA 3PZOA 4AZ7A 4CQBA 4JTGA 4L64A 3EB4A 4PSRA 3SSZA 4F0LA 2O0TA 4MOZA 1X6LA 3EZ4A 2V2HA 1YPFA 1YXYA 2ISSA 4MGGA 3U2OA 2E1WA 4GVHA 5FEWA 4J3UA 3FGCA 2FTWA 3MDUA 1B3XA 3AYSA 5JBDA 5FF2A 2DZUA 2V69A 4YIWA 3VNLA 1ADSA 1R7AA 2QGYA 4JN7A 2D73A 3TNBA 4Z2LA 2D22A 4MZ1A 3WH9A 4AVFA 4FNQA 1B3OA 3ZWSA 3LPPA 4HCDA 1QW7A 3G0XA 5E6YA 3VGHA 3L4TA 3BG3A 3CASA 4A29A 3KZSA 2WSKA 3L4VA 1R30A 1D3CA 3RU8X 1KTNA 4UBPC 1V0MA 5DF0A 3BAWA 3LTSA 1AK5A 4PB3A 2WNNA 4EF8A 3OGVA 3C8FA 3FAXA 2EG7A 2NSXA 2Y5EA 1UH2A 2CWNA 5JXQA 4UOQA 3FOKA 3VILA 3VOHA 3VXGA 2DFAA 2VFHA 4W8LA 4DJFA 5E9XA 3W29A 4MB3A 5XIAA 1A5MC 3N6HA 3A21A 1WUEA 1BSIA 4EANA 3B0UX 2PZ0A 5I77A 5LNUA 3AQUA 1UKPA 3RUBL 3UY8A 4RX0A 2PTXA 1JZ7A 4M6VA 2ZRYA 4QDWA 5B7ZA 2VR2A 1EJRC 4DBEA 4R3UA 2PDJA 2D23A 3UXLA 1UC4A 2YPIA 3NDYA 3AMGA 2P8CA 4GI6A 1CGXA 3GIYA 3TQKA 5PTDA 1LYXA 2WMFA 2MANA 4CU7A 1UIPA 2W62A 4I7VA 4W87A 1NP0A 3P82A 2GUYA 2XTKA 1C92A 2OLAA 2V5LA 3CH0A 3EDEA 3E96A 5AC4A 3CQJA 3THCA 2VOTA 2QJJA 1GVYA 2HZGA 5H8MA 4B4HA 4UMBA 2WZHA 2J77A 1U5JA 3EOUA 2VZTA 4GWEA 1UOZA 5SWUA 1A0EA 4IFOA 1OX4B 1WO2A 1G67A 1KWGA 3OZYA 3J7HA 4AC1X 4K37A 3AAMA 4QNEA 3VIHA 1VBJA 3DC8A 4LS2A 1UC5A 3USBA 4LW7A 3NOEA 1MW3A 1EHAA 4FZIA 4LNYA 3PG9A 2GPTA 4ZO6A 3KCOA 2VDHA 1ZHAA 2PU1A 3W6MA 4UCFA 1AUSL 2VZUA 1XW8A 1DP0A 2C1IA 1EZWA 3CZGA 1WB0A 4C65A 1X8FA 2NV1A 3QYQA 4S3FA 4HN8A 2CFFA 4NVTA 4GGHA 3KLLA 2RJHA 4OE7A 1OX4A 5I6SA 1TE6A 2HE8A 5DLCA 4PMZA 1W1B1 2J7DA 3TJ4A 2FTPA 1DIDA 3DHPA 1JCMP 3UR7A 2VKZG 1R3WA 4A3HA 2Z2BA 2J13A 3UYCA 3NXFA 4UFKA 1K02A 3GXMA 2G0WA 1SJAA 2UZ9A 4B2DD 4Z0JA 2WQPA 3BJSA 4IT1A 5CJNA 1Q4WA 2DU2A 4Q6JA 4DO5A 4AQLA 4J2MA 4ERAA 1HIZA 1L2QA 4AZ5A 3JU2A 1WX0A 2OFJA 4DNMA 4EXBA 1EQPA 4EP8C 3ZYZA 1ZZMA 2Z1XA 2WC7A 2JEQA 1UD5A 4KCVA 3M46A 7PTDA 1UD3A 2PU0A 2WHKA 3EWBX 4AWEA 1E0UA 5LXEA 3MU7A 1Q6OA 2G3MA 5DT7A 4IQDA 4BEUA 1EJWC 1K6WA 5HINA 3AWOA 2PP3A 1MW0A 2VFFA 3S3GA 1A0CA 4XKYA 5LA1A 2YA2A 3VD9A 4ICCX 1EJXC 4KEVA 5FOOA 5D38A 3IV8A 2QVNA 4EK7A 1FWBC 2BTMA 3O7UA 1VYSX 5G2HA 3WJYA 4TTGA 1E0XA 3LX9A 2GQAA 1UG6A 5HNUA 1NEYA 4GVFA 2FTYA 4R7OA 4N4QA 3DI0A 4GNKB 2DQXA 4FNUA 2ODOA 2WC3A 1EUAA 1X97A 4PCSA 3DG6A 2J8TA 1VEMA 4O1CA 2GOUA 4QQUA 4NAEB 2BHZA 3E6EA 1OD8A 3V35A 4NZCA 1TWWA 2NWSA 3DAQA 4YYFA 3I3DA 1HL2A 3WFAA 2HTMA 2FB2A 1NP2A 2NLYA 2VRQA 3AALA 2GOKA 1HKWA 4UQ9A 2WJZA 2QPSA 4Q8TA 5ABTA 4CNOA 5A2AA 3NZPA 2I7GA 1TCDA 2PDFA 4F2BA 4GHRA 2V63A 3ICJA 3WF4A 3TJIA 2TMDA 4Y6GA 3HZ3A 2QCNA 3W2KA 3VUPA 1US3A 1C93A 3LI1A 1DWIM 4NNCA 2WO5A 1W3LA 1OGSA 3CUFA 3ZJKA 4L7ZA 3EMCA 4DWSB 1LWHA 2G37A 4O0ZA 1K7FA 1O1ZA 1AQHA 5K2ZA 5IBXC 4A3UA 3WK1A 3CYJA 4LPCA 1VC4A 4QITA 2R1PA 3D3AA 4WJ8A 3G6MA 2QVHA 4DF1A 1CLKA 3TTYA 4XZNX 5K4ZA 3VNZA 4C6MA 1MWOA 2DP3A 3DHDA 3IGHX 1Q6GA 2ZVRA 2J7CA 3DESA 4H6RA 2DUXA 4HCHA 4YTRA 1Q6QA 3B40A 2ACSA 4US5D 2Z28A 4CNTA 5T9BG 1F76A 1BQCA 1RK6A 1LWIA 4AMAA 5CKSA 3FCPA 2X16A 3HG5A 3W7OA 3DYPA 4IG2B 1IIHA 4EIVA 3WLSA 2FFCA 2FVKA 4N6FA 4NYUA 1UKOA 3FA4A 3TN4A 2DDXA 3WF0A 1GW1A 1F8MA 2OJPA 4PULA 4FIRA 3O3RA 3WJSA 3MMTA 3USZA 1WYIA 1HT6A 1GNXA 1ZP3A 4QP0A 2BY2A 3S5NA 1G01A 4DWSA 5DRCA 3W4RA 2R1LA 2DGAA 5G1TA 4N4PA 3D0CA 5JIWA 1RLCL 1RD5A 2XFRA 2C18A 2Q6ZA 2DY3A 2QIWA 3LGGA 2WWDA 3A23A 1VPQA 4ERGA 4JYDA 4H6KA 1GZJA 2B4GA 4PRWA 1GJPA 3B4UA 3IIPA 4DN1A 1JVNA 1YPIA 1WZAA 1JAKA 4PFMA 1GG1A 1OFAA 5I02A 3OEXA 1KTCA 3NZQA 3DFTA 3NVDA 3LHWA 1H41A 2C0AA 2WMIB 5DELA 1V6UA 3A13A 4NI3A 2PSNA 3R10A 4S3JA 2RDTA 2V0TA 4MWAE 3NSXA 4RXFA 3UWQA 1MO0A 2E3ZA 5AYXA 4AD1A 2FHCA 3L0KA 4GE8A 1UWTA 3HGRA 3W82A 1EDQA 3T6CA 2V67A 3O16A 1JCNA 3PTDA 3GKAA 3QKEA 3AROA 4MSSA 3VX0A 3W70A 4DVOA 5LKYA 3NQ6A 4E2BA 2OLSA 2VZVA 4CCCA 3S9IA 4KEZA 3WLIA 3DFOA 4PTDA 3IAPA 4N9EA 4HN4A 4TMCA 1DWJM 3WN6A 1L6WA 2WMIA 3T78A 4HNNA 3LLXA 4UMCA 4S38A 1A47A 4W8AA 4RDWA 4HPNA 5EYWA 4XBJA 3PBGA 4WF7A 2BX7A 4S23A 3E0FA 4HIBA 1QW8A 3T2QA 4IF2A 3LCHA 2AMXA 3EGJA 5BCAA 2XZ7A 2VI0A 4PEEA 2V38A 3M5XA 1VCGA 4XVEA 1SJCA 4M6UA 1JULA 3W27A 4BK9A 1Q6EA 1XPGA 2WM0A 1F3WA 3PULA 4LOCA 5XINA 3BOLA 4FF5A 4NKCA 4GKLA 2NQLA 3B0YA 1NQ6A 4U2ZA 9RUBA 4LUIA 1FDZA 1O5QA 5FD0A 5M3WA 3RMJA 3BO9A 1Y7VA 3BAKA 3QV6A 2Z7KA 3BTNA 3VOFA 4QCFA 3GNNA 3R0DA 1W1VA 1E4NA 2YBTA 3CEUA 3QW3A 2J74A 3OHMB 4TV6A 4NUWA 3GBDA 5AC7A 4L6OA 4V33A 2DIKA 4ZVJA 2OEMA 3VIOA 3SY5A 1R85A 4QIUA 2PLCA 3A47A 3LSBA 3UZXA 4N9CA 3AHZA 3MW7A 4ONVA 3G77A 4BQ3A 2OEJA 3U2EA 5I7GA 2BZNA 1XXXA 3V0SA 1ISVA 1WXYA 3TK7A 3M7SA 3ALGA 3DGBA 4AWTA 3AYTA 4HOZA 3S2LA 2EG8A 1QUMA 1W1A1 1PCWA 1YDYA 3IWPA 4G1KA 4PCFA 5C7VA 5C54A 1DXIA 2PDCA 1I9CB 3QOMA 1K8CA 4DJEC 2H90A 1ISYA 1KM6A 1TX2A 3HV8A 3WLQA 3CV7A 3K30A 3L5LA 2PE4A 4GQQA 1RPKA 3BAJA 3SQMA 1EEPA 1TUFA 3DHFA 3TC3A 2NQ5A 3UJEA 4ES4A 2ZTJA 1KGXA 3W28A 3CT7A 3NFUA 3DERA 4XIAA 4HMNA 1UYQA 2O92A 1CI1A 3WELA 4C7GA 3MMDA 2ZC8A 1EXPA 1XCXA 4JX6A 5CAKA 1C8XA 2WVVB 6XIMA 3SCPA 1TREA 3LS9A 1JPIA 1JPHA 2VEPA 3LCLA 3TYUA 1PO9A 1AG1O 3S83A 4HJWA 3MHFA 3B0VC 4KCUA 3EOSA 1SVDA 5I09A 2YA1A 3PB2A 4DZAA 3NDOA 1AVAA 3FA3A 4MLRA 4M1RA 1VENA 3ZXWA 1Q65A 5F1VA 3QQ1A 1TB3A 3GNDA 4CLMA 3ORWA 1EPVA 2DJLA 5EMJA 3RPDA 2CBVA 2WVVA 3PFRA 3PFMA 1VYRA 1YX1A 1B0IA 1H7RA 4ORIA 3UG8A 4YWIA 2VENA 4F0KA 2EXOA 5BNKA 1E71M 4RR4A 3LN3A 2C8NA 1K9EA 5JBFA 1BGGA 5I06A 1XLLA 3AISA 1S3HA 4IGNA 3HMJG 1Z69A 3NXLA 3HO8A 3E3HA 3P74A 4Z17A 2JKAA 4NHVA 4RNIA 1TA3A 1GHSA 2B0MA 3W2UA 2KZHA 2AOSA 1YNYA 3LMYA 4YN5A 4D6HA 1ZL1A 1NWRA 1G9HA 3CT2A 3RU6A 3HPAA 2GVJA 4ALDA 2XFFA 3VKCA 2QUUA 1TWZA 1JD9A 1RUSA 3KBVA 3CZ8A 3IRDA 1A5AA 5C0QA 2A4AA 3W72A 4PMYA 3DUGA 5GNZA 4JPGA 3B8IA 3DFNA 4RNFA 3FYOA 3MYOA 2VWTA 3WQOA 1PTGA 1W17A 3GE7A 1P0BA 3PZ9A 5CPMA 5LIUX 1EX1A 3RO8A 5HMDA 3IAQA 2I16A 3G1FA 3U8GA 5LSMA 1E4LA 3H53A 1O5KA 1C29A 2Z6IA 2OMAA 5A6MA 3T9PA 4C1KA 1MW2A 2ZWYA 4IPPA 3H4WA 1KC7A 1AH3A 1WP6A 5LZLA 1SZRA 5AOUA 1IXOA 1XLHA 4AD3A 3AMDA 5C2CA 2YLAA 4C1LA 3ATZA 1RLDA 3ES8A 3OBKA 1VFTA 2OKTA 5DCDA 3WDHA 1E55A 3CEPA 2Q3OA 5AYYA 4YPJA 4L61A 2F7FA 2J9YA 4PMVA 3M0IA 3GDMA 1IEWA 2G41A 1BWLA 3M0HA 4N7QA 1XSJA 4LC8A 1TIWA 1XICA 3UXAA 3TOPA 3GIQA 3VOIA 2XSXA 5KITA 2WNQA 3H2CA 2HROA 3AIUA 3BGAA 2OODA 1S5TA 5E6ZA 2J9ZA 3VVGA 3UG5A 3PPGA 3C2EA 1J5SA 3EKLA 1VQTA 4NJHA 4AF0A 4H3DA 4Q8WA 3W86A 1WA3A 3WFZA 1V03A 2WMGA 2UY2A 4M5PA 1HTIA 4QCEA 2OTDA 3AZRA 1Y8BA 2UY5A 4TVUA 4QEEA 1HO4A 2G8ZA 1B3WA 3P60A 2C7FA 2V5CA 4W88A 4QX4A 2DT2A 1CEOA 1H7PA 1SZGA 4M6QA 4FHAA 2JIWA 1AW2A 3ES7A 4WR3A 1OT1A 5K9XA 4X22A 1KRCC 3WUGA 1W6TA 3RJXA 5A2CA 1LDCA 1OG6A 1PE1A 3ZVHB 4O16A 2ONEA 3U3HA 1U2YA 4XAZA 4GQGA 2NVCA 1OADA 3BSGA 1Z32X 4IOTA 3MZNA 5C9RA 4JNZA 3APTA 2PF0A 3QBUA 2GGEA 4H1ZA 4ML9A 3UCCA 3VD5A 4L1GA 1KWKA 4BEQA 2PPGA 3Q4DA 1T8XA 1XIGA 1ZP4A 2ACQA 1UKQA 2BVDA 3B8UA 1MSSA 3EOLA 1FKWA 1FTXA 1NIUA 4UNKA 2TYSA 4X0VA 3WLKX 4KFOA 5T26A 1S2AA 4JY8A 3WQEA 2WBKA 4JTHA 2GLKA 1WCGA 3GSMA 3UWYA 3E2RA 4A8IA 2W79A 3TIMA 2PLKA 4HHLA 4OBSA 2J7EA 1ZJHA 4XZLX 2Q8LA 3KEHA 4JYFA 4B5XA 3MP3A 5D9MA 1X96A 4BR1A 4OECA 1YE6A 3FKKA 2WVTA 4MNLA 4GGBA 3WMSA 3PAOA 2WOQA 1SFTA 1VGAA 5ENLA 4ZOBA 3A5FA 2HVOA 1CXHA 1D3GA 1HJSA 1Q7MA 3AIVA 3NVTA 2WVSA 3CUIA 2V3FA 4MB4A 3RR1A 1WZLA 3MUY1 1G7VA 4XK2A 2HNEA 3IARA 4CEXC 1WXZA 4J1OA 4JKKA 3PHAA 2Z2AA