2RH9A

Tryptophan synthase complexed with igp, internal aldimine, ph 9.0
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
254
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryptophan synthase complexed with IGP, internal aldimine, pH 9.0.
rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 95
structure length 254
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2rh9A00
1K7XA 4YL2A 1IXPA 4IXXA 4Z1CA 6TIMA 5AFDA 5G2IA 1FQ0A 3PR2A 1SO5A 1BWLA 1C9DA 2YPIA 1GVRA 1LLZA 1QO5A 1EIXA 2BTMA 4JDBA 5D33A 4AHOA 1VZWA 4O50A 5U4NA 1OX4A 4FO4A 3MYPA 3BG5A 3P67A 4O12A 1VLWA 2QCFA 3GXPA 2ALDA 4IX2A 4UIOA 1H1YA 2X2GA 1W3IA 4R53A 1A5CA 3LCGA 1KM5A 4XZ9A 3UYCA 4AEOA 3GX9A 4TMCA 3SI9A 3GYEA 5DBTA 2J9XA 4WY0F 2I9EA 4AVFA 1XBXA 2HMCA 3NR0A 2WOQA 1TQJA 5AC6A 4MKNA 4BK9A 1GT8A 1RV8A 2A7NA 1Z42A 3HPSA 2ZCGA 4GUHA 4LVBA 1VS1A 2QCCA 3GKAA 1WOAA 3Q94A 2H90A 3W07A 1QPOA 1TPFA 1WBHA 4AF0A 4FIRA 4IUOA 5HMSA 3CM4A 1H7WA 3RMJA 5AYYA 2ABBA 4NX0A 4I7UA 1W31A 3T4CA 3B05A 3I7SA 3MBFA 4N02A 4YCPA 3P7YA 1OYBA 4Q33A 3STGA 1KV8A 3BGJA 3S1UA 2FPTA 4O1BA 4M6PA 4OQVA 3IIPA 3TFCA 1VJIA 3N19B 1LRQA 5GVJA 4CCEA 5K9CA 1E51A 1ONRA 1ME8A 5F1VA 5G1TA 1K8XA 1B9BA 5AOUA 4FXRA 2Z6JA 5D37A 2X1UA 4QM1A 2BXVA 1G4SA 1C29A 3EWBX 3KOFA 3QW4B 3EWXA 3A9IA 3OG3A 3EWYA 4MY9A 1X8FA 5LZLA 3NQFA 1H61A 1ZAJA 3W2JA 2NXIA 1B3OA 3HIJA 4MUZA 3KFTA 5EBUA 3NM1A 2A5HA 3T40A 4N2YA 4UTUA 2P10A 3NQAA 4D2JA 4BWLA 2RFGA 1OYCA 2I14A 1TQXA 2YR1A 5I3JA 3O15A 2FB3A 3L65A 1H51A 3W3OA 1SSGA 1KFCA 3LV5A 1PV8A 2V2HA 3M41A 1JCJA 1IF2A 4NNAA 3UXAA 3L5MA 3NPVA 3MI6A 8TIMA 4RJEA 3P8IA 2XN1A 1SU5A 5FEZA 2JGYA 3W1QA 1EUAA 4S2CA 1LZOA 3M44A 4LV9A 5CSSA 3W7NA 1OJXA 2QEZA 3PBYA 1DV7A 1FBAA 5H2ZA 1Q6RA 3BGGA 4UXDA 3IVUA 4UMBA 3MHFA 3U8GA 1LROA 4NT0A 2NUXA 4DO5A 4MIMA 1WQ5A 4KFPA 3W1XA 1K3UA 3NQCA 2HTMA 2NZLA 4O13A 5G4WA 1PE1A 1KM1A 3CIXA 3CWNA 5D32A 1AK5A 1MO0A 3LRMA 3EKZA 5KZEA 3G0SA 1N55A 2H3DA 3E9AA 3KRSA 3MBDA 3GXNA 3G24A 3PS7A 5CPLA 5LGZA 2QDGA 3TSDA 4WQ6A 1OX4B 2QDHA 3CWOX 2CZDA 3B0PA 3PC0A 3TE9A 2BSLA 1F2JA 1YDOA 1CW2A 3VCRA 1JCNA 4Y96A 1SR9A 4KWVA 1AW2A 2VKZG 2DZUA 2EKCA 5D2YA 1QPRA 4OWGA 3RLVA 4JTFA 1QO2A 4UNKA 5HUOA 4PA8A 4AMAA 4K36A 4M19A 4K7VA 1JCLA 5G1YA 1XUZA 2YYTA 4UMAA 1A5AA 3DFNA 1IXQA 5K4ZA 1N8FA 1YTKA 2NX9A 3LHYA 3N9SA 4JY8A 1NFBA 2G97A 4ZQPA 3EEGA 3N34A 2ZTJA 3I7RA 1G4EA 2P0OA 3WJSA 3TROA 4JEQA 1TTIA 2R14A 2QCMA 5LGXA 4UCGA 5T26A 3NZRA 4GWEA 2NV2A 5D2VA 2WV8A 3L9CA 3HPZA 2ZRYA 4LRTA 1SQ7A 4E2BA 3HO8A 2AAMA 1QFEA 2NWRA 3FFSA 2QUVA 3BG3A 1ZENA 3IIVA 3GNNA 1TPC1 5I3KA 3U6WA 4DBDA 3BVJA 1LBFA 5D02A 3E02A 1LLWA 1XM3A 2GQ9A 4Z1AA 3DFOA 3FYOA 3W71A 1OF8A 1R2TA 1TMHA 4LTSA 2DZSA 1S3HA 3W7OA 1X6UA 4DO6A 3QYQA 4JS3A 2VEPA 1BWKA 2A6LA 2GQAA 5DXYA 5CZJA 3QZEA 1R46A 2A7PA 1Q6LA 1MSSA 1XDLA 4XKYA 1TRIA 4AWUA 3I68A 3ABQA 4A2SA 3QPYA 4FNSA 1VGAA 2ZRXA 1OFAA 3S8HA 4OV9A 5C5YA 1FY6A 2QCLA 3PBUA 1EUNA 3DFPA 1ICSA 2ABAA 2OT1A 4S2BA 3KRUA 4K8EA 2V8ZA 2VENA 1H50A 3O6DA 3UNDA 3NGJA 3G1AA 1PCWA 1DORA 1RZMA 2H6RA 1W5QA 4Y8FA 2GJLA 5AC7A 4HNTA 3A24A 1LP6A 3W1PA 3W1RA 2J24A 4IPIA 4EF8A 5DCEA 1TTPA 4RKAA 2ZRVA 3Q37A 4FHAA 3KX6A 2CZFA 3L68A 3ZWSA 4HN4A 3DKJA 3G22A 2O7QA 1PIIA 4EOUA 3M7WA 1FWWA 4ZMGA 1I8JA 4O4VA 1TV8A 3DHDA 2PRMA 3AO0A 5DELA 1W1ZA 1FX6A 2NUWA 2E09A 2QCGA 5CGQA 1OHLA 4DF2A 3W7MA 3QC3A 1G7VA 3AJXA 1TREA 2DZWA 4MYXA 5CZSA 1LRTA 3E49A 4AHPA 3RK8A 3EB2A 4A21A 3QMRA 2E5DA 5J5RA 1P4CA 3NZ1A 1HTIA 5HUPA 2A6NA 1MZHA 5G2WA 4DELA 1FCBA 2V2CA 3U2OA 3NQMA 2H8XA 2G95A 4DXVA 4H4IA 1G6CA 3TC6A 3STCA 3EX2A 3TAKA 1WA3A 3IIOA 4O1AA 5K9DA 2VFGA 4Q32A 5F1UA 3DENA 4IMCA 1W0MA 3WK1A 3NM3A 3CTLA 4FF7A 3TXVA 4AHQA 2QAFA 3M16A 1YTEA 4R33A 1JVNA 5K2ZA 1KM6A 1NSJA 2HS8A 2ZRWA 3VNDA 3W72A 1F05A 5LNSA 5BRBA 4NQ1A 1HL2A 4O57A 2VEMA 4AWSA 4L4LA 1A5SA 1DOSA 4O8RA 1MEHA 4N9BA 1KTCA 1VH7A 4QNWA 3GK0A 4JTLA 2FQIA 2BX7A 4HPXA 2DJXA 4WY0A 3DFQA 1JUBA 1A5BA 5IM51 3P60A 3CEPA 3W7DA 4JTGA 4JICA 2QKFA 4GUJA 1OYAA 2B0MA 2YFOA 4JDYA 1GVQA 5G5IA 1B57A 4E2DA 1D3HA 1LBMA 1QR7A 4PH6A 1XDMA 3DI1A 1DL3A 3M47A 2ZZ3A 3TFXA 2Q8ZA 3G8RA 5AN7A 2Y7EA 1KLYA 2NLIA 1XXXA 2QCEA 4QSHA 1JUEA 1JCMP 3KAOA 4ML9A 3PY2A 2PC4A 3TR2A 3SGUA 1VYPX 3C0JA 2JGQA 3FJ6A 4LU0A 1F74A 1XFBA 5F4XA 1LBLA 3HB9A 3QMTA 3LCLA 3UWVA 4C1LA 4MYAA 1VRDA 2R91A 3G1YA 1OFQA 3W7CA 2QR6A 2FLIA 2PE4A 3PB0A 1LDCA 3GXTA 1GZGA 2Y85A 1IXOA 4UUIA 4OV4A 4Z0JA 5C6MA 4BR1A 1PHQA 3PSVA 1SPQA 3W7HA 4JTKA 5I3IA 4MLJA 5LNRA 3W74A 4MJMA 2CFFA 5IBXA 1OK6A 3C6CA 5K9XA 2OZ0A 3JR2A 3UXDA 1WV2A 4XTDA 5I3FA 1UUMA 3P5ZA 1UJPA 1G4TA 2C16A 4NXKA 3OA3A 3O6CA 3PUEA 4YWIA 4AB4A 1I2OA 3LHUA 2ZYFA 1U5JA 1XCFA 2E6AA 1UBSA 3W22A 3IRDA 1JCXA 1VCFA 3NOEA 1G67A 2VEIA 4FEZA 4NNCA 1TO3A 4AXKA 1VYRA 1JUKA 1VCVA 1OABA 3TMLA 3HGRA 4LV4A 1MEWA 5D09A 1KTBA 1PHWA 2CZEA 3W7PA 3W75A 2WO5A 1EPXA 4DPPA 1DBTA 4A22A 5LHFA 2V5LA 4K38A 3WJZA 2WSQA 1TJRA 4BI6A 4NU7A 1VR6A 4NVTA 3SJ3A 4FX7A 1HFBA 3FKKA 3DH7A 3GDTA 3HG2A 3LHVA 3P82A 1TPEA 1TPUA 4RR4A 4EIVA 3G8EA 2CLKA 1OX6A 1HUVA 2VFDA 5TIMA 4ZZ9A 1GOXA 1K7FA 5FEPA 3EX3A 1BEUA 1SW0A 3MI3A 4UTTC 4ZQCA 4OT7A 5L9FA 1FWNA 5HR7A 3Q58A 4HKPA 5U7SA 2YW3A 1G4PA 3G0XA 4TU1A 3LTPA 2YCEA 2ZRUA 3QH2A 2RKXA 3OVQA 3SR7A 2QJHA 3BO9A 3BW2A 1LYXA 1QOPA 2PRHA 3B0UX 2A4AA 2TRSA 5I3HA 3LCIA 3DGRA 2B4GA 3PUOA 3PBVA 3R12A 4CNNA 4MY1A 4KFNA 1RQBA 5D03A 2C3ZA 4PL1A 1Y0EA 3R2GA 2QCNA 1EP2A 4N9CA 1A50A 1W8SA 4JX5A 4FNUA 1JQVA 4GUIA 4JX6A 4LUJA 2PRLA 2OX1A 3S9YA 1WDWA 3W1MA 3TNOA 3M5YA 4RV8A 3QSTA 4RZ5A 3MP4A 1VQTA 2XFWA 1T96A 3P81A 1CX9A 5K3VA 2R94A 1FWSA 3GDKA 3PAJA 4MPQA 2DZPA 1QOQA 3PWAA 3TX9A 1F76A 3QQ1A 4UTTA 1EWDA 1L9WA 3EWZA 1EB3A 4MFDA 5LSMA 3FLUA 2ZZ5A 3LHWA 1DQXA 2ISSA 3L0NA 4YXGA 4AWTA 3ELFA 3SFKA 5F2LA 3NQ6A 2V82A 2WSRA 3O06A 5DXXA 4ZVJA 2CLIA 4MVAA 3NQGA 3LV6A 3F03K 5H91A 1GG0A 1U83A 1W54A 3LCXA 4XQ6A 3CPRA 1VCGA 3IIZA 1I2RA 4N4QA 5FF0A 1FXQA 2VC6A 1NF0A 3L2IA 1WYIA 4ORMA 3NNTA 4LVGA 3HF3A 3LRKA 3W2KA 3IVTA 3C2FA 2Y7FA 2WNNA 4JTTA 3SGZA 1X7FA 2R8WA 4FIQA 4UTIA 1NVMA 3T44A 3TMQA 1RVGA 2NX1A 3LLFA 2QCDB 2YW4A 3JRKA 3WK2A 3O05A 1I4NA 3DAQA 1TTQA 3OIXA 4DF0A 1FXPA 3TIMA 1LORA 4LUIA 5D30A 4UFHA 1B4EA 2B7QA 4LVDA 5LNVA 4GXMA 3N3MA 1KBIA 4HPJA 2E68A 4ADUA 1TPH1 4YLWA 5AYZA 3W2UA 4HNUA 1ZJIA 3L5LA 2Y6ZA 3H54A 1FDYA 4QIUA 3W6YA 3DXIA 4RCXA 3TQKA 2ISVA 3B8DA 5AHNA 3UWQA 1KV5A 3OEXA 3EX6A 4FNRA 3LXCA 3W2NA 1YPFA 3EWWA 5AHEA 2DZVA 1YLVA 4Z0SA 4BWLC 4UFMA 2GVLA 1D3GA 4JTUA 5CPMA 1R2SA 2VELA 1F5ZA 3W73A 3OBKA 3PG9A 2E77A 3NPUA 4O15A 3W7LA 1XKYA 1OVDA 4ZL1A 2WJZA 2W6RA 1V7YA 4ADTA 2VFHA 2E6YA 1SUXA 3ATYA 4O0ZA 1AL7A 5TBOA 1EA0A 2RDUA 1JR1A 4O19A 4LNYA 2GQ8A 3KVKA 4TIMA 1ME7A 3KHJA 1TYGA 2GPTA 4RLIA 4QAIA 4R7JA 4A2RA 2AGKA 3SECA 3C3NA 1UASA 3BW4A 3PF3A 2XN0A 4JIPA 3LI0A 4FNTA 3W7EA 4OU1A 5F4WA 3C2RA 4MZ1A 5G4EA 2JBMA 1O4UA 1OX5A 3NL5A 3KVMA 4MOZA 3GAKA 3G1VA 3UZ5A 2J88A 3UY8A 3RNDA 3INPA 4JTIA 3E0IA 5KZDA 3QEZA 2ISWA 4GUGA 5D2WA 1RQHA 1DVJA 2XN2A 1B4KA 4Q4KA 5CZ0A 3TDFA 3GNDA 3KRZA 4GNJA 1KW1A 4GBUA 4WJEA 2VXNA 3SY5A 2H3BA 1JCYA 3C2VA 4G1KA 1OFOA 5HJLA 4MY8A 2ZA3A 3QW3A 1CI1A 5HWJA 4OBTA 3W1AA 4QISA 3NQ8A 3P5YA 5EA9A 3KXQA 1QPQA 4ADSA 3C2EA 4Y90A 2P1FA 1L2UA 4JX4A 2CW6A 2ZZ7A 3W1NA 3LCFA 2Y61A 1IIHA 3LX9A 3TCEA 1Q6OA 3QF0A 1TPWA 3IGSA 4UTLA 3NQ7A 3HGOA 3M9YA 2A21A 3TXZA 4DEFA 1W3TA 4WXYA 4DBEA 3V1PA 2C15A 5BOOA 3TSMA 2FDSA 1AW5A 4LC8A 3CEUA 3HQ1A 3S1VA 3LBMA 4RXGA 5AHMA 2Z2UA 2C13A 4PEKA 4J9JA 2E5BA 4HHPA 3G3MA 5E0KA 4CNOA 2OCZA 4O52A 5IBXC 1H63A 2QCDA 3M5XA 1L6YA 2J9YA 3W7IA 3FS2A 2ZZ1A 4O18A 3VFLA 3BLIA 1J5TA 1SFLA 4PCFA 3R89A 1XC4A 4UTWC 3O16A 3W86A 4ICNA 1W5MA 3LB0A 5DN1A 3K30A 4RZ6A 2X1SA 3S42A 4UTWA 3C52A 3EXRA 4BI7A 1V5XA 3RFAA 1JRCA 1R47A 4N9DA 3TH6A 1H7OA 4LC6A 3WJYA 3C2OA 5F4SA 5C2XA 1F6PA 1SFJA 2EPHA 3R13A 1S5VA 3TJXA 2A0NA 3EX4A 3G1DA 4ZQMA 3V75A 4NX5A 1YXDA 5HR6A 1S5TA 1DJQA 4JN6A 4RZ4A 3VI2A 3TQ0A 1QNVA 4H6KA 5LKYA 3WJXA 1TB3A 2D73A 2YZRA 2DP3A 3TA6A 1AW1A 4WUIA 3BK0A 4XUGA 2CU0A 1Q45A 3NQDA 1WAUA 3CU2A 4GUFA 2VFIA 1BTMA 3OVRA 1T99A 4XKYB 1MXSA 1DQWA 3ABRA 1EX5A 4Z1DA 2ZA1A 5AHLA 4OHQA 3Q2DA 5ABTA 1F73A 2JKAA 1Q6QA 1OG0A 1GVSA 3P61A 4IX0A 1G7UA 5F2MA 1KM3A 3STEA 5AC8A 3NXFA 5FEWA 1GPWA 4O17A 3NA8A 1W5NA 3I65A 1W3NA 1ZCOA 2FTPA 3EWUA 4HSOA 3GDLA 2NXHA 3ATZA 2KZHA 2BZNA 1IXNA 4O11A 3F4NA 3CB8A 3L66A 4O1DA 4UR7A 4FX8A 2YX0A 4NUWA 1KFKA 2J27A 3A5VA 4JD4A 5MHBA 3LTYA 2VEKA 2X16A 4UTJA 1BKSA 3L21A 4CQ8A 1H7RA 3SIZA 3W7RA 3W2MA 5DY3A 3QPZA 1WXJA 2Y62A 4JTHA 2GVGA 1UCWA 2V9DA 1YPIA 1THFD 2C6QA 2E6DA 3TV8A 1OK4A 3PULA 2IQTA 4CQ9A 1W5OA 3TJLA 4UR8A 5BNKA 3IEBA 5CPOA 3SW6A 2TYSA 3FJLA 3MYOA 1TJPA 4S1FA 3QM3A 5D2TA 4NXSA 4O4WA 1P5BA 5AB3A 4GE8A 4DPQA 2X30A 1ML1A 4NJJA 3BV4A 3PSWA 3TKFA 2Q8LA 1VYSX 1XBZA 4AH7A 4MZYA 4XWUA 4HNNA 1P1XA 5LNWA 4IMEA 3C56A 1VC4A 4JYEA 2A7RA 4U28A 1YXCA 3ZS4A 4XBKA 2B7OA 3LOTA 1GEQA 4LS2A 3W85A 3UPBA 3HG3A 2WKJA 1QPNA 2YFNA 3HPXA 3P62A 5BW6A 1H1ZA 2ATSA 3WFAA 4NJKA 3RU6A 3UD6A 1P0KA 3MUXA 4K8HA 1HO4A 2FPYA 2WPBA 2EHHA 2C18A 4MLRA 1SZEA 3G0UA 2Y70A 4WXZA 3QSRA 1LM1A 4YCOA 4LS1A 5LHEA 4N9EA 3HOJA 1LOLA 4N4PA 2EAWA 3VE9A 4YMZA 5LNUA 4KFOA 4RK8A 1W56A 4MJZA 5DLCA 3NAVA 1WX0A 3W84A 4QNEA 4IPJA 3O8AA 1M5WA 3SSJA 5AHIA 5FF3A 3IIXA 1YXYA 3GZ3A 2ZBTA 3ABOA 1NAL1 4FNQA 5KTLA 4BF9A 3STFA 3MW7A 1VPXA 3MP5A 5FF7A 2OMAA 4O10A 4EF9A 2GOUA 1DKWA 3GAYA 4JIQA 4IWWA 4IGHA 1SZFA 1F7BA 1IIGA 3FA5A 1O5KA 3R8RA 1H7NA 1IGSA 4LWWA 1KM2A 2CLLA 4AAJA 1LTDA 5FEXA 2A2IA 4UTKA 3GDMA 3WK0A 2G96A 3FIGA 3L0KA 2YDAA 3N73A 5G2HA 5J5DA 1HO1A 1O95A 4JTEA 3IVSA 5F2GA 1ZFJA 2ZZ6A 4LVFA 2YSWA 4H3DA 4P61A 3I7QA 1ADOA 4UTHA 2E6FA 1HG3A 3SZ8A 4ORIA 4WD0A 3A22A 3BW3A 5AYXA 2CWNA 4I9AA 4R34A 1VLIA 4K39A 5EL1A 3UZJA 3UPWA 1OFDA 1T8XA 3BPWA 2ZFAA 3TC7A 5K7JA 3DHFA 3MI2A 3MJYA 4O14A 1WBJA 3MP3A 4FNPA 3I6RA 3NDOA 2EF9A 1QMLA 4O0KA 3NL6A 7TIMA 1VHNA 5L6UA 1GQNA 4A29A 4WZHA 5EKYA 3NQ2A 2VFFA 4N6FA 2WSYA 5F2IA 1GWJA 3A21A 3N2MA 4ALDA 1EWEA 5CZTA 4X2RA 2ZRZA 3B03A 4UTMA 2GVJA 4Z08A 2V5BA 3B06A 3H53A 3UWWA 1GVFA 1K7EA 3O1NA 4K7YA 3W87A 2UV8G 1ALDA 1ZAHA 3GR8A 3LBCA 1O60A 3O6YX 2C0AA 3PM6A 1AG1O 3WJWA 1ME9A 4TMBA 2Q3OA 5C55A 3GKFA 3W70A 3GB6A 2RDTA 5FF2A 3O63A 3MHGA 2F84A 2RDWA 4UC5A 2WNQA 3W7KA 4IMDA 3EKLA 3M6YA 5FI8A 1EEPA 4MFEA 1N7KA 3W1LA 3S0CA 2C1HA 4NJGA 4PL2A 5D2XA 2Z6IA 1PVNA 1RPXA 3NYZA 1I2NA 2TMDA 3T7VA 1P0NA 4XTIA 2FB2A 2A85A 3G1HA 3W7GA 4IJBA 1SW7A 2B7PA 4LW7A 3FYPA 2Y88A 5TQLA 4QITA 2WNZA 3USBA 3GVGA 4O53A 3VKJA 4I7VA 3G1XA 1TTJA 3FEMA 1R30A 4O54A 2Y89A 4X3ZA 5I3GA 3EX1A 3P80A 4PTNA 3THQA 4PODA 2NUYA 4A3UA 3HGJA 2QJIA 2X1RA 1ZY9A 2GUUA 3C4UA 3LXBA 3G1SA 2A1YA 1YADA 3S6DA 5C54A 3S1WA 2ZA2A 3T55A 4QJ1A 3KVJA 1AL8A 2V30A 1KM0A 1EP1A 1RR2A 3LHTA 3W23A 3G3DA 1TCDA 2Z1BA 2Q3RA 5CG7A 1GTHA 1GG1A 5DCDA 1H7PA 3DI0A 4NNBA 5DBUA 4DO4A 1YYAA 4LOCA 3A23A 3KVLA 5HINA 4BI5A 1K02A 2O7SA 5D04C 4IQLA 3TK7A 3L0GA 1RD5A 2OJPA 4K6AA 2YGYA 1TPB1 5HWMA 4CQAA 4JXCA 1R2RA 4ZQRA 1NEYA 4PFMA 1SO4A 5CKSA 2J9ZA 3TQVA 5HULA 3UY7A 3DKLA 1QWGA 3BLEA 4M5PA 3DFTA 1ICPA 3IV3A 3TU9A 3BG9A 2E1DA 3L67A 4K37A 4MZ8A 3CT7A 4FX6M 4OE7A 4CNPA 3TAOA 2CLOA 4HIBA 1S5WA 2V81A 3W7JA 1TV7A 1LOQA 1KLZA 4EVZA 3E96A 1OFEA 2YYUA 4Y9AA 1G69A 1Q3NA 4GJ1A 2ZZ2A 5KINA 4Z1BA 1JJKA 1SO6A 2OT0A 3P84A 1H7XA 3GLCA 3M5VA 4ONVA 4E0CA 3LRLA 4E38A 5EYWA 3NG3A 4HT3A 3BLFA 2ATMA 3LCWA 4RX0A 4HNVA 3W1UA 2FIQA 1ZHAA 3NQVA 5EPDA 1KFBA 1L6WA 3CLMA 1W5PA 3N9RA 3QMSA 1KM4A 2G5WA 3S1XA 1YDVA 3HG4A 5D05A 3TW7A 2QUUA 1KA9F 2DZXA 1OFRA 5DCBA 1QAPA 4TR9A 1TIMA 4U4MA 1FDJA 4W9TA 3ABSA 2X1TA 1TPDA 4CLMA 4GC4A 3S5NA 5FESA 2GJNA 3P8JA 4UFKA 1A53A 3GIYA 3M1ZA 4N6EA 5KMYA 4OGZA 2W0UA 1ZNNA 3MHUA 3GDRA 2DJLA 2QUTA 4HSNA 3HBLA 2LLEA 4UNLA 1FWTA 4WY0B 2ZTKA 2W79A 3W76A 2Y7DA 2BWGA 1SO3A 3D0CA 2Z0IA 1H62A 1PCKA 3ZFHA 3CQ0A 3NO5A 3WK3A 3DU0A 3TW6A 3HG5A 1YDNA 2BLEA 2VFEA 3CC1A 2RHGA 1EP3A 4PC8A 1NF7A 3OHIA 5E1QA 1XBVA 3HGSA 5A8GA 4B5NA 4M6QA 2FFCA 4WOZA 1DHPA 1KFLA 2E5CA 5EMUA 1PS9A 3PBWA 4KKXA 1KFJA 1OF6A 4IMGA 4RXFA 4JTJA 3RLUA 3W1TA 4I7WA 1JRBA 1AMKA 1SW3A 4KWWA 4DF1A 5CPNA 1UB3A 1FCVA 3NQEA 5K4XA 3QFEA 3NVTA 4XBSA 5AHFA 4P2VA 2QJGA 3UWZA 5SWUA 3QJAA 3IGXA 1J4EA 3MO7A 3NEVA 4CCDA 2DZTA 4UFLA 1K8ZA 1SZGA 2AQWA 4POCA 1SZNA 1WOBA 3ANYA 4O16A 2I1OA 5HWNA 3S5ZA 3E12A 2F7FA 1XUUA 2ZDRA 3PB2A 3LI1A 3F1QA 3ZWTA 4C1KA 3B0VC 3PG8A 1L6SA 1I2QA 3M43A 4ZQNA 1TPVA 3W9ZA 1FCUA 1XI3A 3LLDA 3R5EA 2V0TA 1RQEA 3ZR4A 3DFSA 3YPIA 4NJHA 2ZZ4A 3DZ1A 1J2WA 1TV5A 4UMCA 1KTNA 5CSRA 3TSBA 2TPSA 1O5XA 4EWND 3W83A 4CCCA 3LGEA 1Z44A 2Y7GA 1KFEA 3A5FA 3IGUA 4NZJA 3LDVA 2H8ZA 2C19A 3QQ0A 3TUUA 1Z41A 4X22A 2FJKA 3QRHA 2TSYA 4NZFA 1FDZA 1Z48A 2PURA 1ZALA 1XBYA 2CZ5A 2J6XA 3W7QA 2PCQA 3PUDA 4M7SA 1LCOA 4FB7A 3T78A 5HNRA 2QF7A 1DJNA 3EXSA 3MMTA 1C8VA 2EGZA 5KITA 3N2XA 2WQPA 2V2DA 3H55A 1M7PA 3MWAA 1QDSA 4IOTA 4LS0A 3JS3A 2B7NA 3CHVA 6ALDA 3F4WA 3LTSA 1I45A 1OFBA 1X1OA 3P74A 5BMWA 1JULA 4JY9A 4DQWA 3N14A 3UWYA 3OVPA 3GR7A 1H60A 3G18A 2JK2A 4TO8A 1SSDA 4AF0B 3O07A 3B04A 4JYFA 1KBJA 1H5YA 4LT9A 1GYNA 3LM7A 4GRSA 5A5WA 3S5YA 2CLHA 3L5AA 1TSIA 3FOKA 4IMFA 3CIWA 2JKPA 1X1ZA 1LRNA 3NPXA 1QCWA 1T0OA 3C8FA 2RH9A 2DORA 3RF9A 3VE7A 1GJPA 4LRSA 3NL3A 1M7OA 5FF4A 1MEIA 1D9EA 3S5OA 3FKRA 5KSWA 1FCQA 2CLEA 4L4MA 1W37A 3LCHA 3W88A 3LXAA 1ZAIA 3C61A 4UFJA 2CLMA 1O94A 3UWUA 4WOQA 4IXHA 4JR5A 2NWSA 1GTEA 2NXGA 3EXTA 3W2LA 2VOMA 3UQNA 1LOSA 4UFIA 4X9SA 4Y6GA 4O1CA 4JGDA 3PVFA 4NJIA 1VHCA 5BMXA 5KZMA 2Y63A 3LERA 4LVAA 5DY2A 1FWRA 1GYLA 4LY8A 1XL9A 1PL9A 1JQXA 3BARA 1K03A 4ZQOA 1I2PA 1F6KA 2NV1A 3NPWA 4GFSA 4M6VA 5EY5A 1YTDA 4O28A 4QQ3A 2FPVA 4JTSA 3NL2A 1K8YA 3B4UA 1TRDA 4JNMA 2HS6A 2YXGA 1OFPA 3LHZA 3M5ZA 5HQEA 1M6JA 1FUYA 1UUOA 3THAA 2QCHA 4M7TA 4FXSA 2ZQ0A 2DU2A 2C14A 2HSAA 4TX9A 2NX3A 3M0ZA 5E93A 3HMJG 4BFAA 1GVOA 4WX2A 4JYDA 3HJZA 2QAPA 2CLFA 2JKEA 5D38A 3DBPA 3G1FA 1ICQA
chains in the Genus database with same CATH superfamily
2PGFA 2OFJA 4IXXA 6TIMA 1BGAA 1DJWA 4RW5A 4MJ4A 1SO5A 1JPKA 1UH3A 3AICA 1EIXA 2BTMA 3GO2A 1E0UA 1OQFA 1RCOB 3CQHA 5DX7A 2I17A 4UWMA 1PSCA 4B5UA 4IX2A 4DJDD 1H1YA 3ARRA 4R53A 7ENLA 3LCGA 3CQJA 3GSMA 4I3GA 5JBFA 3F2DA 4FR1A 3GYEA 2VHLA 3IJ6A 1B31A 2I9EA 3B8TA 1DIDA 4G56A 3VKAA 2WOQA 4C5ZA 1MW0A 1NP0A 1S1RA 1FHDA 1GT8A 2A7NA 4AX7A 3ENLA 2ZCGA 3FN9A 4M1BA 1EJTC 3GBEA 4MWAE 3Q94A 4M6UA 4LY4A 3WENA 3W82A 3W07A 2XVGA 1QPOA 3BH4A 3VX0A 5FJPA 4AF0A 2GWNA 2X0YA 4ZO9A 3CM4A 5HATA 4ZTYA 3RX4A 3VGGA 4XO7A 4GQRA 4HZMA 2BGNE 3B05A 1VBHA 1XLEA 4GY0A 4N02A 1T5AA 3U48A 1LT8A 1NARA 2ZUTA 3N19B 1RCQA 4KESA 4ZB5A 1E51A 5BYWA 2QDDA 2YOCA 1P0BA 1DWJM 2ZE3A 1XF0A 4KBXA 3UR8A 4ES4A 1TX2A 1RD6A 4L1WA 1GVEA 4LANA 1K77A 1AQMA 2NVDA 2DV0A 4GVHA 5ECVA 1H61A 1ZAJA 2MUCA 1YNYA 2ZIDA 1HKVA 2WBKA 3I3DA 4Y9MA 4DWDA 3JVAA 3R0UA 1F07A 3NQAA 3LMZA 4HN8A 5HOSA 1TQXA 4H2CA 3O15A 4CD6A 2G4JA 5CG0A 1K1DA 4QG8A 1JCJA 1VIWA 3BURA 3AYRA 3BANA 1CGXA 1XG3A 2DZBA 3MI6A 4V2XA 8TIMA 3P8IA 4KWUA 2WHJA 2XN1A 5A6BD 1SU5A 5H6HA 1D2KA 1OD8A 1LZOA 3W7NA 4FALA 2DW7A 5C8BB 2QEZA 1MYRA 3PBYA 1DV7A 1ZB5A 4PMXA 3BGGA 4NT0A 1P6WA 4KFPA 1K3UA 3NQCA 4P7QA 1PZ0A 3CIXA 4ENLA 1CXHA 4L6DA 4EPKA 2PDUA 4L1XA 5LGZA 1B3YA 4WQ6A 2Z1XA 3UVIA 2ZXDA 3L7RA 1EGVA 1J2BA 3ZM8A 1M7JA 4PUMA 1F2JA 1QWKA 5EGRA 1TFVA 3GFYA 3N2BA 3W6MA 4Y96A 3W27A 4RUBA 3WF2A 1F8IA 2A3EA 4JTFA 1Q6GA 4F8XA 1XYZA 3N9KA 3GY1A 4K36A 4XG1A 4WDXA 4K7VA 3PZOA 3P93A 2YYTA 3SIMA 4UMAA 3DFNA 3VNIA 3N9SA 2ZTJA 1G4EA 3TROA 4JEQA 2JQXA 1AUSL 3MUY1 3N6QA 1V0LA 2YL5A 5LGXA 4BHYA 3OB8A 1UD8A 5T26A 3NZRA 1UZ4A 3CMGA 5D2VA 1H0GA 3HPZA 4W5ZA 3VIFA 2AAMA 1GPFA 1XX1A 4IFRA 1TE6A 4DBDA 4Z2GA 2PDPA 1ADDA 3FYOA 4LTSA 1S3HA 3W7OA 1Q2RA 3IUHA 5DMLA 2EEXA 5FCZA 3CAKA 2BVDA 1EJRC 3W81A 1EO7A 4IFOA 3WLOA 1WDDA 4U2YA 4BF5A 2XFRA 1TRIA 3BAJA 3QPYA 1UWUA 2ZRXA 4IFKB 4OV9A 1FY6A 1XP3A 2QCLA 3QHMA 4DBUA 4S2BA 1W1B1 4L64A 4BF7A 4G2DA 4ZOBA 3TYCA 3XIMA 5A3HA 4FOKA 2OR2A 3NGJA 4J3WA 1DORA 1RZMA 2H6RA 1W5QA 4W84A 3W1RA 3Q37A 4IP4A 4C6FA 4O0QA 3ZWSA 2EG7A 4GCAA 4EOUA 1SJBA 3PNZA 1FWWA 2VC5A 4B4FA 5FJTA 1JFHA 2YZ5A 1TV8A 1ONWA 4J3ZA 2QCGA 5CGQA 3WD4A 5M03A 3LU2A 2DZWA 1LRTA 3E49A 3QN3A 3QMRA 1PXGA 5J5RA 2DDXA 4B90A 3II1A 3OQ8A 2VC7A 2H8XA 4DXVA 3AS3A 2NQ9A 4XZMX 3TC6A 4GQGA 4J40A 4L4PA 3STCA 5K9DA 3KZPA 2XIOA 2FHCA 3C8NA 3MSDA 4FF7A 2XGIA 4AHQA 3LLXA 3OLIA 1GQIA 1LUCB 2QLYA 1V3JA 1ITQA 2ZRWA 3RDKA 1HKJA 5FAGA 3UR7A 3ONBA 2RAGA 5IHSA 3AIRA 5LNSA 1W91A 4ILSA 3EYPA 4NQ1A 2VWTA 4AWSA 1A5SA 4MAVA 1VFMA 1MEHA 1S38A 4DJDA 5KZ6A 2XSXA 3V16A 4JTLA 2BX7A 4WY0A 3IJDA 1JGMA 1E0TA 3A4JA 3OYXA 4A8LA 5G1MA 1B0IA 3BJSA 3CEPA 1EXPA 1IT7A 4US6A 3R79A 2QKFA 5IXEA 1OYAA 2G41A 1B57A 5A69A 4RNJA 3PP7A 2Z27A 3TFXA 2Q8ZA 3G8RA 3P3BA 4R9OA 2NLIA 4F9JA 1V0KA 5M3WA 4QSHA 2OSXA 3O0FA 2VO5A 4X61A 2PC4A 1E6ZA 4FR6A 1DE6A 2HVMA 1F74A 1S2CA 3R25A 2XM2A 4PN2A 2F2KA 2C79A 3W7CA 2PODA 1M3UA 2FLIA 2PE4A 3PB0A 1GZGA 1O68A 4UUIA 5CGMA 4OV4A 4Z0JA 1GW1A 4Q8TA 1DIKA 5A95A 4CNSA 2ACSA 3USZA 1ZUAX 2UY2A 3GUGA 5IBXA 4PMQA 1OK6A 3UFYA 2A3HA 3C6CA 4YTUA 3VD9A 1ZBVA 4E3VA 3UXDA 4XTDA 5A2AA 1UZ1A 1OT2A 1JDFA 3VOHA 1YX1A 4AB4A 2A3LA 4GKLA 3ARYA 1Q13A 3LHUA 3ARVA 1U5JA 1UBSA 3KDOA 3M0IA 4NNCA 3REQB 4J3TA 4ZGYA 3QLLA 1JUKA 1VCVA 1OABA 3HGRA 5D09A 1KTBA 3WMSA 2CZEA 4B5TA 3RRXA 1E6XM 3V5CA 3W75A 4K38A 2QS8A 2BNJA 3WJZA 3SN4A 4BI6A 1YW1A 4HU8A 4BZYA 2VYOA 5C9ZA 3VZYA 3LHVA 1TPEA 4RR4A 3VMOA 2E28A 4XIAA 3BCDA 4DY1A 5FEPA 2O9PA 3WBAA 3EX3A 1YDYA 3FVDA 4UTTC 2YXOA 4A8RA 1FWNA 5HR7A 2NQJA 3SCRA 4HKPA 5U7SA 2YW3A 2IXVA 2ZRUA 2CYGA 3KRBA 2RKXA 2QJHA 3BO9A 1LYXA 2X0HA 4NZ3A 3BAKA 2W66A 4C6JA 2V3FA 1J93A 3PUOA 3PBVA 1XRTA 3VXGA 4CNNA 3E38A 1RQBA 2G37A 1O7AA 1Y0EA 1XGZA 4N9CA 4F0LA 4HBKA 3EA3A 3NSXA 4FNUA 3URQA 1J0KA 1YKWA 3OOQA 3TNOA 4RV8A 1AFSA 3CV2A 2QIIA 4GYKA 2XFWA 3QR3A 1T96A 3NYDA 1AJ0A 4M51A 3QYSA 2IPJA 5I06A 1CX9A 3TZFA 9XIAA 5K3VA 1KGWA 3HTWA 4NZ4A 2DZPA 1QOQA 4DAFA 1KRMA 1F76A 4LAMA 1S2TA 4UTTA 1EWDA 1Q4NX 3ZJ7A 3EWZA 1EB3A 4MFDA 3FLUA 1CXEA 4YXGA 1GORA 3UZXA 4C6KA 5F2LA 3NQ6A 3SO7A 2VCCA 2WNWA 2V82A 1UWSA 2WSRA 3A3WA 5DXXA 1UP2A 1E71M 4ZVJA 4P7LA 3LGGA 4AZHA 3NTYA 3F03K 3TR9A 5H91A 2JEPA 1GG0A 1U83A 1W54A 4N7QA 4XQ6A 3CPRA 4IGSA 4DB7A 1JG9A 3RITA 3L2IA 4EXQA 4K8GA 5LIKX 1NWTA 3HF3A 1V0MA 3IVTA 2BXYA 2Z1SA 4QE4A 3T8LA 2C1GA 2R8WA 4UTIA 3RCMA 1NVMA 2NX1A 3WBEA 1E0VA 1RXOB 5CGTA 3AWNA 1EQPA 4P8WA 1R3VA 2Z2BA 2VRKA 5PTDA 1B4EA 3K46A 4C6MA 4LVDA 4JL1A 2E68A 3SRHA 4ADUA 1TPH1 3W2UA 1ZJIA 4GJIA 1XYLA 3W6YA 2Q71A 1E56A 4RCXA 2IXUA 1OCBA 3PPFA 3KOYA 1F9CA 1RBAA 1US2A 3R43A 2POZA 4DNHA 3AIEA 3KL5A 4FNRA 1XH0A 2G4FA 1ZTVA 4IG2A 4IUGA 2O9RA 1BPLB 3SQMA 1YLVA 4JTUA 2VELA 5GNYA 3SQSA 1JD9A 3PG9A 3AZSA 3HM7A 2XHYA 3WFZA 4ERIA 4LF2A 4GZEA 5FJIA 1QNQA 2AKZA 2E6YA 3ATYA 1A5MC 1E9LA 3EDJA 4GIRA 2Y4SA 3FSUA 2XIQA 4A3QA 1P6CA 3D5HA 3F2CA 1D7KA 3BAWA 1RJQA 1ME7A 4ZBCA 4GZJA 3CASA 1WDSA 4MGGA 4RLIA 4A2RA 3SECA 1NJJA 3C3NA 3PTQA 3LK6A 4DJED 4JIRA 4PCSA 5F4WA 2JBMA 3G1VA 3UZ5A 3KHDA 3INPA 1A3WA 3QEZA 3VMPA 1JI2A 3APGA 4GUGA 2ODOA 3TDFA 4XSLA 1PDZA 3N3TA 1U2YA 2J8GA 2J78A 3SY5A 2VXNA 4W89A 1UP3A 2P50A 3M0KA 4KETA 3XINA 1CI1A 3AZRA 3QOKA 4QISA 1QPQA 3C2EA 3T08A 1XH1A 1OIFA 4JX4A 2ZZ7A 3GTHA 3T07A 1C8YA 4YTQA 9XIMA 3N4FA 4UTLA 3IGSA 4H41A 3VM5A 3HGOA 1MNZA 1EJXC 3UT0A 2YLLA 2PDYA 1GYMA 1W3TA 4WXYA 3UBPC 4BS0A 4DWSD 1AW5A 2Z00A 4LC8A 4RXGA 3OGRA 4PEKA 2E5BA 4HHPA 4IHCA 2OCZA 2WC7A 4DN1A 3TYUA 4F0MA 4BCEA 1H63A 4W85A 5AYIA 3BAXA 4IFKA 1L6YA 2Y0FA 3ZSSA 3FXYA 1J5TA 4FXFA 3T1GA 2AQOA 3R89A 1IEQA 1DXFA 1ZRQA 3O16A 3W86A 5E9AA 3K30A 4Q4SA 5XIMA 3RO8A 2ZDSA 3WDRA 4R27A 4N9DA 4CKQA 1H7OA 4LC6A 3C2OA 1ISYA 4W87A 5B7YA 4Q6XA 2ZE0A 8A3HA 3NURA 2A0NA 3G1DA 2E8YA 4BQ2A 1QHZA 1S5TA 3RX3A 4N42A 1QNVA 3EZ4A 4ZO7A 3BTNA 2PTWA 4JFTA 4OBSA 4Q8UA 3H6OA 2XFFA 2DP3A 2J7BA 1Q6EA 4RDYA 3EPOA 5ENLA 5C71A 1GOQA 4W7UA 2CU0A 3I6EA 1E4LA 1T99A 4B3ZA 1KQYA 1MXSA 1ESWA 3ABRA 3TYZA 3ISIX 3RN6A 1VENA 3KCOA 3ZSTA 2OQHA 2ZA1A 5AHLA 4OHQA 2Z1KA 5ABTA 1HP5A 4M81A 4ZOAA 1WUEA 3T0AA 1PIFA 3WO8A 4GI6A 3U2EA 4GLEA 3NA8A 1W5NA 2PWFA 3GDLA 3ATZA 3GRIA 3PPCA 5CC5A 4O1DA 4QGCA 1CTNA 1E0XA 3GXDA 3M4HA 4JD4A 3LTYA 4FS9A 3L21A 1CCWB 4CQ8A 1XIDA 2WMKA 5DY3A 3W2MA 4H9MA 3QPZA 5HQLA 3OLEA 2GVGA 4OFCA 2V9DA 1BHGA 1THFD 3GNPA 4XBJA 3T2OA 2ANUA 4MWAA 4PGLA 3VA8A 2W67A 1Q7ZA 3B9NA 2IQTA 4YVXA 1ECEA 3VD5A 1DEDA 5CPOA 1EJVC 4NAFA 2R82A 1MDRA 4XSMA 1XLDA 3H8AA 4KEZA 3FJLA 1HL9A 3MYOA 5HK4A 4S1FA 4AZ7A 2X30A 1ML1A 3QHOA 4HHMA 1O5QA 3PSWA 1XBZA 1EO5A 1P1XA 2W5FA 3KBWA 1GQKA 1PTAA 1QU4A 1HJSA 1GEQA 4LS2A 3G6LA 4LB4A 3UPBA 2WKJA 2XINA 4HB7A 3BQ6A 1H1ZA 1LUCA 4F2BA 2PWDA 1HO4A 2P8CA 4MLRA 3L4TA 1FH9A 3F7JA 4MM1A 4DYJA 4LS1A 2I5GA 4JQ3A 5LHEA 3HOJA 1LOLA 4LAKA 2EAWA 4FF5A 3TYBA 1W56A 2ZC1A 5XINA 2A3AA 3F5LA 1TUXA 2HRWA 3W84A 4QNEA 5IFPA 4IPJA 2Z26A 3BJTA 1R86A 5CBJA 2QXWA 2QPUA 4BQ3A 2DVXA 2OMAA 2GOUA 1DKWA 3GAYA 2ZADA 3R8RA 4AAJA 1PUDA 1B90A 2A2IA 3FJ4A 1GQLA 3GDMA 4KEUA 1BF6A 2Y5EA 4AFYA 3AYVA 2G96A 3FIGA 3OGSA 1TWIA 3LD5A 4GH1A 4JTEA 3W26A 3WY1A 5F2GA 2YSWA 4H3DA 2BGSA 1PBGA 2E6FA 1AH4A 2ISDA 3SZ8A 1R3TA 4ORIA 4CCZA 5AYXA 1QRQA 3OZYA 4I9AA 4C90A 1VBUA 1VLIA 4M8UA 1R7OA 4OJYA 4YN5A 4I6KA 3EMCA 2SFPA 1T8XA 5K7JA 2HE5A 2NQLA 3DHFA 3MI2A 2HPIA 2PFHA 4FNPA 2GDVA 1ZBWA 2FTYA 3NL6A 3FY1A 7TIMA 4D6EA 1JDAA 5MF5A 4A29A 3BQ5A 2V3EA 1GWJA 4W86A 1FHVA 3WDHA 5TNVA 3GVVA 4X2RA 4UTMA 4Z08A 3VD7A 2D2JA 5HMEA 1HVQA 3VNYA 4OVXA 1U33A 5CC7A 4WGXA 4JCMA 2UV8G 3UJFA 4UQCA 4N0RA 3O6YX 2C0AA 4IIHA 4PBGA 4TMBA 3GKFA 4NRSA 3W70A 4NIRA 4D6HA 4TV5A 2RDTA 4HMEA 3SBFA 5FF2A 3O63A 4B5XA 3BLDA 4HCDA 4AXNA 3HURA 2GL5A 2I16A 3IJ8A 1N7KA 1GJUA 2PZ0A 4NJGA 4BEUA 2Z6IA 3SRFA 1F6YA 4MAZA 1RPXA 3T7VA 4WLCA 4XTIA 2PGEA 1XRVA 3OLDA 2C91A 4TTUA 3W7GA 3A3HA 1SMDA 2B7PA 4IZGA 4LW7A 2DUAA 3S2LA 4O53A 2E3ZA 2F6KA 2XVKA 1AJ2A 3WLRA 1DTUA 3FEMA 1R30A 2PS2A 2OXNA 3P80A 3THQA 3AUJA 4PODA 3NCOA 2DT3A 4XISA 3C4UA 3QY7A 2FZ8A 3RJXA 3T55A 3KVJA 1AL8A 1RR2A 4C7FA 2BHZA 2GGGA 4MWAC 1TCDA 2Z1BA 3APTA 2Q3RA 1WUFA 4I8YA 1GG1A 2QPXA 4LSBA 1EF3A 2W91A 3WNPA 1YYAA 3KVLA 1EBHA 3PBGA 1CBGA 4L80A 4BI5A 2O7SA 4C6IA 2ZICA 4IQLA 3TK7A 1QTWA 3L0GA 5GNZA 1TPB1 4I90A 1XQKA 3VABA 2X42A 1E55A 4A3HA 5CKSA 1IEXA 2VX6A 3DFTA 1MZRA 1ICPA 4GYPC 2E1DA 4L4OA 1P0EA 4HIBA 1LOQA 1NDYA 4EVZA 1FHUA 3E96A 3H22A 1Q3NA 3LMYA 4EX4A 1ZSXA 3MB9A 1WE5A 1HKKA 3GLCA 1A80A 3MKCA 2C1IA 3KEHA 2P76A 3LCWA 1UBPC 4RX0A 4GO8A 3W1UA 2PD5A 4QCEA 3EB4A 3NQVA 3SUWA 1L6WA 1WKEA 8CGTA 1BVWA 3CLMA 2PDKA 1W5PA 3N9RA 3OP2A 3F4DA 3S1XA 1YEYA 4Q7NA 2DZXA 1OFRA 1J96A 2ASHA 3VD4A 4O1EA 1FDJA 2XWEA 2XH4A 1V6UA 3QV7A 1UW9A 2F6XA 1WPCA 3GNRA 2CEQA 4GC4A 3S5NA 1NOUA 1EFZA 5FESA 1E72M 4U10A 3VIKA 3GIYA 1M9HA 4N6EA 2YDSA 5KMYA 1MRAA 5FJRA 1Q6FA 2XM1A 3AQUA 3LQLA 4CEUC 3AIWA 3HBLA 5D9OA 4UNLA 2WC4A 1FWTA 2OEKA 4LH8A 3WLPA 4IPLA 2W79A 2BWGA 3D0CA 4J35A 3WLHA 2F8QA 2IMRA 1PCKA 5JXQA 3P0WA 3WD2A 3DU0A 5FACA 1YDNA 2VFEA 4KT2A 1NF7A 1VP5A 3CUZA 3UJ2A 4CN1A 4WOZA 2ZX7A 2DIEA 5E6ZA 4GH3A 2O4QA 2FKPA 4I7WA 3K4WA 1J01A 1SW3A 2CIPA 4IQDA 4DF1A 5CPNA 1UB3A 4V27A 4XBSA 2B31A 1HIZA 1OT1A 3NEVA 4TX6A 4UFLA 3WF0A 5FOOA 2XFYA 2AQWA 1SZNA 3S5ZA 2YCLA 2F7FA 4GI9A 1M65A 3KBJA 5ECUA 2ZX9A 1OC7A 1REQA 3B0VC 1I2QA 5AZ1A 3BSGA 1XI3A 1YMYA 1NDVA 2VGGA 1J2WA 1TV5A 1PAMA 5I00A 3QQWA 3E5PA 4CCCA 4NZJA 4Q4MA 3QQ0A 1ISVA 4Y2WA 5CPQA 3DYPA 4TVCA 1FDZA 2OWWA 3XISA 1XBYA 4NZ5A 3W7QA 3WNKA 4KEVA 3T78A 1DJNA 3EXSA 4XIMA 4H6QA 2V3GA 4GQQA 5LIXX 5KITA 3MV11 5HNUA 1QDSA 3JS3A 4GC3A 1DWAM 3TOYA 3EDFA 3U9IA 4PEEA 3VDBA 3KUMA 2QVNA 3NO1A 5BMWA 1NQ6A 3CMFA 2JK2A 1Y5WA 3BZGA 3B04A 5C7VA 3ZOAA 2QZRA 4AWEA 4OTKA 3UG5A 2HBVA 4KERA 2RH9A 2ZUMA 3QFWA 2E9BA 4Q7IA 4GA8A 2KX9A 4L65A 4AZGA 5CXPA 3FKRA 1VBRA 4OIFA 1XV8A 4CD5A 4Z2IA 1ZAIA 2CZVA 4UFJA 3GYCA 4DAIA 1O94A 6TAAA 2BMBA 4M80A 3EXTA 4HNOA 1LOSA 3APYA 4UFIA 3HV9A 4JGDA 1NY1A 1IR1A 3CUJA 3LERA 4DJDC 1FWRA 4J1OA 2P0IA 4LY8A 1PL9A 1JQXA 3BARA 1BF2A 1I2PA 3ZO9A 1YTDA 2CERA 5HNNA 4QQ3A 2D1ZA 1HJWA 3QZ6A 3R0KA 1TRDA 1DYSA 3M5ZA 4JQ2A 4LCSA 1CLKA 3WLLA 5JIWA 2HCVA 5DQPA 5EB8A 1FUYA 3AWOA 3CHCA 5REQA 3G1RA 4FXSA 4RNIA 1V3LA 3GIPA 2FH8A 2V69A 3LNMA 4QQUA 3NZQA 2UZ9A 4JN7A 4NAEA 1V02E 1ICQA 4AY7A 3UR5A 1EGZA 1K7XA 1XW8A 2DH3A 4F2TA 1KRAC 4Z1CA 1VRXA 5CQ1A 4EP8C 3U7BA 2DZAA 1GVRA 1LLZA 3KL3A 4JDBA 2PBOA 4DM1A 1FP8A 1OX4A 2BDQA 5A8OA 3P67A 1WZKA 1DXEA 5DO8A 2CXGA 3NUKA 4UIOA 2EPMX 1W3IA 3JZUA 1A5OC 3UYCA 4AEOA 2YBTA 4TMCA 3NWRA 1LQAA 3CYVA 3WLTA 1JNDA 2OTDA 2X7VA 5AC6A 1A49A 3N04A 4I5UA 4BK9A 1L8PA 4JHZA 4W88A 1WDPA 4LVBA 1KXQA 5HNTA 1OSEA 1ZBKA 3UXLA 1WOAA 2J6VA 1TPFA 1AMYA 1IZJA 4XUYA 4JTRA 4IUOA 5HMSA 1H7WA 2ABBA 1WAWA 2PAJA 1EEXA 1UD2A 3G6MA 2HNHA 3STGA 4AEEA 1KV8A 1Z9AA 2FPTA 3THDA 4OQVA 3IIPA 3AXMA 3TFCA 5GVJA 4CCEA 5K9CA 2YIHA 1B3ZA 1ONEA 1ONRA 3UP8A 1K4HA 5G1TA 1AVAA 1WDRA 4QM1A 1G4SA 2ZKMX 1C29A 3TJ4A 3EWBX 3KOFA 3EWXA 5JUVA 1R38A 3OG3A 3EWYA 4MY9A 3NQFA 3W2JA 4E2VA 3NDZA 1B3OA 3RRAA 3HIJA 2UY3A 5EBUA 3NM1A 4QG9A 4N2YA 1EZWA 4D2JA 1GKQA 2YBUA 5BXSA 2MANA 1OYCA 2PF0A 2I14A 1SVDA 2PWVA 1WZLA 2FB3A 3L65A 1Q4WA 3W3OA 1SSGA 1KFCA 1PV8A 3M41A 3K8LA 3SM0A 3TTQA 4MNLA 4G1NA 1IF2A 4IL2A 3AXKA 3L5MA 2ISFA 3S2JA 2CKRA 3NPVA 2NSOA 1HJUA 2VX5A 3PWIA 1UWIA 5FEZA 3W1QA 1XSIA 1A0CA 2OSWA 5ABFA 4ECLA 7REQB 3OBAA 1FBAA 2XSAA 5H2ZA 4UXDA 4UMBA 1LROA 5A6MA 4DO5A 1W3JA 2Y8VA 1XFCA 4HK7A 2HTMA 2NZLA 4W93A 1PYFA 1KM1A 3HV8A 3RX2A 3CWNA 1AK5A 1MO0A 1U5HA 3EKZA 3AROA 3G0SA 3MBDA 2I7GA 5CPLA 3TSDA 1VPQA 4IQEA 4K1GA 3PC0A 5AC5A 6CGTA 4Y9OA 4XAFA 1G9HA 4H9TA 3LQGA 4CNTA 4WDUA 4DUXA 3PJXA 1AW2A 4PYSA 2VKZG 2FYMA 1J0YA 4OWGA 1Q6CA 1EJ7L 1S3TC 1V03A 4UNKA 4DZIA 2OSYA 4M19A 5JBEA 3M0XA 1GOWA 1OINA 3M0YA 3WH9A 1ZJHA 1A5AA 5K4ZA 4AY1A 1N8FA 3AS2A 1U30A 4ZQPA 4JY8A 4AEFA 1NFBA 2EG8A 2EPOA 3EEGA 5H8UA 3I7RA 3VTRA 1W9UA 2P0OA 4M29A 3WDIA 5D4YA 1TTIA 2WCSA 2QNEA 1E70M 2QCMA 3VIHA 1UD5A 2CPUA 3MDUA 4R9XA 1JGIA 1AQHA 5M2FX 4GWEA 2WV8A 2WWCA 2OX4A 3VK5A 3L9CA 3VX1A 3MANA 2XH0A 2ZRYA 4QRNA 1NIUA 5GQBA 1MI3A 3LPGA 3FFSA 3BG3A 1PKNA 2XDFA 1Q65A 1TPC1 3CUHA 5T91A 3T81A 5FL1A 4JIIX 5D02A 1POJA 4QR6A 2EJAA 2REQA 2XU2A 4HTYA 1R2TA 2DZSA 3GR4A 3V3WA 4JS3A 1BWKA 4R7WA 2GQAA 1C8QA 2Z4GA 5CZJA 1L6FA 1U1HA 3B9DA 1DE5A 4Q8WA 2VUYA 1TELA 1MSSA 1UQYA 4E6MA 3SRDA 4XKYA 3VZZA 4AWUA 1KCZA 1QW9A 1JAEA 5CSUA 1EDQA 4NHVA 4U3AA 1LJYA 1GVYA 3PBUA 3M0JA 1ICSA 3N2CA 1FWHC 4DHGA 1UKPA 2GJXB 2V8ZA 3UZWA 1TR9A 3WG6A 1KXVA 5B7ZA 4AZCA 1XLHA 4HNTA 1CXIA 4Y8FA 1LP6A 2J24A 4IPIA 4CN6A 2ZRVA 4FHAA 1CGTA 3FDKA 2NQHA 3WQOA 4X60A 1R3RA 4NILA 3SADA 3DHDA 2PRMA 3AO0A 4PMUA 2NUWA 4HJWA 3W7MA 1G7VA 2WMHA 4R88A 1A4MA 3AJXA 5LXXA 2PC8A 2EBNA 4Q8NA 3H21A 4A21A 1GJWA 2O92A 5FJUA 3CPUA 3DESA 2E5DA 3WQ6A 4YWSA 1OGSA 1P4CA 5HUPA 4P5UA 5G2WA 4B5WA 4A4AA 4ZEPA 3I4EA 3U2OA 3NQMA 2IS7A 2G95A 4PB5A 4PSRA 1G6CA 3OIHA 4HOZA 2WJDA 3EX2A 3BLOA 5F1UA 3DENA 4J2MA 2X0SA 1NOWA 1ENUA 4F0SA 2QAFA 3M16A 3EWDA 4GX9A 1KWGA 4IH3A 3PTKA 4X9YA 1NSJA 3UNTA 3O7UA 4KW2A 3BDKA 4KRUA 3CZ8A 4R5EA 2I56A 4I9MA 3W72A 1JL8A 1F05A 3JW7A 5BRBA 1I9CB 4H8VA 1W2VA 1ISWA 4N9BA 1BGGA 4QNWA 4DRSA 4LYRA 2DJXA 1KCLA 4EPEC 1TWSA 4WKHA 1RBOB 3LZ5A 5IM51 1FOBA 3W7DA 4JTGA 3BCFA 4JICA 2D20A 4H7ZA 5BZAA 1GVQA 2F38A 3F2BA 3VKCA 1D3HA 2RUSA 1PX3A 1QR7A 1PIGA 3PTMA 2V5CA 1XDMA 1DL3A 2GJRA 3VOCA 2J79A 1J10A 3WBXA 1XXXA 1GONA 1PWLA 2QCEA 4G7FA 1JUEA 2WZTA 4L6OA 1JCMP 4ZENA 4ML9A 1EBGA 3TR2A 3C0JA 3GVQA 1KRCC 3BOFA 3QMTA 2WJEA 3UWVA 5D9PA 1VRDA 3IAQA 1JZ6A 3GXTA 3TQPA 2OOFA 4AZBA 3LSCA 1GOOA 3W7HA 4ATLA 5I3IA 4MLJA 1NH6A 4MJMA 2CFFA 1AD4A 1HZYA 3JR2A 1EQCA 2HVNA 1UUMA 3QKEA 3B9AA 4WDTA 4H6RA 1UJPA 1G4TA 4YWIA 4WHBA 4JBRA 2WANA 3A4XA 3Q45A 1MQQA 2YXXA 2DUXA 1TVLA 1MW2A 2ZYFA 4DLFA 5FIPA 1JCXA 4XV0A 1LL7A 4QLLA 4HD5A 1XYMA 4V1YA 4IGNA 3ZMRA 1FFQA 3TMLA 1MEWA 3W7PA 1XYAA 2QYGA 2PDFA 2WO5A 3AMLA 5LHFA 3OVGA 4ZO8A 2WSQA 3AAMA 2P88A 3MSGA 4FX7A 2D69A 4KQNA 1UP0A 5EFFA 4OZOA 3VNMA 4D6IA 3HG2A 3P82A 2DSKA 3WQGA 4YHEA 1Z8AA 3NVDA 4KRTA 3HA1A 1UKQA 5TIMA 1XLAA 4ZZ9A 1VBJA 3UEQA 2GK1A 2WLYA 3K2GA 1KKRA 1GHRA 3PTDA 1POKA 5E6YA 1QUMA 4XD3A 1QNRA 3BW2A 2PRHA 3B0UX 4AUBA 2A4AA 3EKGA 1VFFA 3ARZA 3GU2A 1XLIA 3LCIA 1CGVA 4Y9NA 3STPA 1XD1A 1UWAA 3I3BA 2QPSA 1IV8A 3E0WA 4EACA 2QCNA 5LA2A 1A50A 3CPGA 1CENA 2Y5JA 2C71A 4GPNA 4GUIA 2BASA 1WDWA 3W1MA 2D2OA 1B2YA 4RZ5A 5LIYX 3W01A 1YBQA 2PU1A 4ML4A 4KIEA 3BOLA 4JQ4A 2R94A 1FWSA 3H2FA 3PWAA 4FSAA 4NAEB 1ZJBA 3MUIA 1B9ZA 1GKRA 4C6NA 2ZZ5A 3AHXA 4S38A 4ZODA 3W37A 1DQXA 3L0NA 3OO2A 2NQZA 4PMOA 3ELFA 2XJ7A 4IJCA 4J5NA 2WVVB 2E67A 1HGWA 4MVAA 2HXTA 3LV6A 4C6QA 2G8ZA 1XSJA 4GQBA 3E0FA 2BVWA 1VCGA 3IIZA 1I2RA 4W8AA 1FXQA 2XZ9A 1TJ2A 4BEQA 3H4WA 1AA1B 2WNNA 3SGZA 3UU0A 3MO4A 3A4AA 3LLFA 2V67A 2VGFA 3WK2A 3DAQA 3KBVA 1LORA 4JEJA 1HKWA 1P7TA 5I79A 3UPMA 1HJXA 4NASA 4UFHA 4XZNX 1RBLA 1Y8BA 5LNVA 4GXMA 4HPJA 4AVNA 1XLJA 3L5LA 5IOBA 3CBWA 2F2HA 3EEZA 3OLGA 3E6EA 1XLLA 3DXIA 4WEVX 2VX7A 2VT0A 3HQOA 3T0DA 3EDKA 2Y1HA 4IIEA 3EX6A 3MY9A 1Q8AA 3JUGA 3W2NA 2QMJA 1G01A 3DGBA 4H9ZA 2DZVA 2VR5A 4UFMA 5CPMA 4DZAA 1R2SA 3TVAA 5A8QA 3FDGA 3W7LA 1XKYA 3GC4A 2W6RA 2VFHA 1PPIA 3B8IA 1SUXA 1AL7A 2J47A 1EA0A 3WFLA 3K4AA 3I6TA 1JR1A 7A3HA 4O19A 4W4QA 3F4CA 4LNYA 3KVKA 2WLZA 1E40A 2PF8A 1GVIA 3KHJA 2BY0A 3D6NA 2R1KA 4X0VA 3OW1A 1UROA 3VIPA 4QAIA 2OOGA 2IPWA 4QTGA 4M3PA 3IK2A 3QGKC 5A6SA 3BW4A 3PF3A 3BXWA 1HVXA 3PZMA 4RE3A 4V28A 3W24A 3E3HA 2ZWYA 4FNTA 4LQ1A 4OU1A 3C2RA 5DT5A 1DP0A 3NL5A 2XIBA 4S3GA 3AI0A 2J88A 3UY8A 4F3HA 4JTIA 2ISWA 1XLKA 5FJJA 4LUTB 5H1WA 1QJWA 1RQHA 4Q4KA 3AFBA 3HZ3A 3KRZA 4P8UA 4GBUA 2J75A 3I3EA 4U31A 1Y65A 4M82A 3RJYA 3WKZA 5I3DA 4MNMA 4KIRA 2ZA3A 4GNKB 4H83A 5HWJA 3ZJ8A 5EA9A 3VIGA 4ADSA 3ARPA 2P1FA 1SFSA 3CZGA 4KWOA 3CB3A 1U1UA 4E4UA 4B16A 1IIHA 3LX9A 3QF0A 3NQ7A 2AAAA 1PZ3A 4QBXA 4RE0A 3TSMA 3V18A 4PUDA 1K6WA 4I6VA 3HQ1A 5AVHA 2PTXA 3LBMA 2Z2UA 3TONA 4J9JA 2VZVA 5BWAA 1R9YA 5AC4A 1XLFA 4H8NA 2EPKX 2VWSA 2WVSA 4O52A 1FFRA 2D2GA 1FWEC 2WZHA 3U5UA 1TV4A 2QCDA 2J9YA 4O18A 3C2YA 4I9TA 2PCEA 1UWQA 1FWBC 2XGBA 1Z32X 1SFLA 2C8NA 4ICNA 4LFYA 3QXBA 4JFUA 4A8IA 5I2UA 2X1SA 1V93A 5HAOA 2PDGA 1V5XA 3RFAA 1IT8A 2HQAA 2BGQA 1R47A 2BOEX 1F3XA 2QV4A 5F4SA 4C1NB 3E0VA 1XIGA 3URBA 1FH7A 2OZ8A 5BOFA 1JDCA 1WP6A 3KBSA 3TJXA 4GHRA 3S46A 4Q4RA 5J04A 1ZPTA 2OODA 4IJRA 5DMYA 1DJQA 4JN6A 1JPDX 4RZ4A 4QLKA 1DJHA 3VI2A 3TQ0A 3RUBL 1TA3B 2Q02A 2DW6A 1TB3A 4PB3A 1MWOA 2HZGA 2HXUA 3TA6A 5A2BA 1AW1A 2I5QA 1PDYA 3BK0A 4R3UA 4XUGA 2PWGA 2IW0A 3NQDA 1WAUA 5JQ9A 4GUFA 3RGTA 3OVRA 3M0HA 1DQWA 4F0RA 3RO6A 2E4TA 1EX5A 2ZX6A 4MKVA 1F73A 4ZB2A 3T4WA 2DUZA 2E40A 3GG8A 4JTDA 1OG0A 3WLJA 3VUPA 5BOEA 4IX0A 1G7UA 5F2MA 3STEA 5FEWA 1GPWA 1BXNA 1XD0A 4GZ7A 3VUSA 4DUWA 4O17A 3CMJA 3I65A 3KTXA 4GQ0A 3EWUA 2BP1A 2KZHA 1IXNA 3PZTA 3F4NA 4AISA 3ITCA 2YX0A 4H6EA 2QQ6A 3A5VA 3WF1A 4WSHA 2X16A 2ACUA 4UTJA 3LG3A 3C0LA 3W7RA 3W0KA 2Y62A 4DVOA 4IMAA 1JIBA 1H0IA 2C6QA 3Q67A 3VAVA 3PULA 1SGJA 5GPRA 4EAMA 2IPGA 1W5OA 3IEBA 3VOGA 1KBLA 2YL6A 2TYSA 2WXDM 1T7LA 1TJPA 4O4WA 1P5BA 5AB3A 3WNMA 3CV1A 1VYSX 2Z2AA 4ZFMA 4IMEA 3C56A 2GVYA 1VC4A 4U28A 1V3HA 4QP0A 3N1AA 1YXCA 3ZS4A 3WQ4A 4XBKA 1RLCL 1M1BA 2J8FA 3U4AA 1OCNA 3L4WA 4F4RA 3RR4A 3HPXA 5BW6A 4NJKA 3H4XA 3MUXA 3UA4A 5GJNA 2O9TA 4YCOA 1SMAA 3GDBA 4YMZA 3SUTA 1VJZA 3UA3A 2OEJA 1KBBA 4GYJA 5DLCA 1QI2A 3ARWA 4HCLA 3A12A 5I5RA 4UZSA 3SSJA 4E4FA 5FF3A 3IIXA 1SR0A 1YXYA 2X1IA 4FNQA 1NAL1 2HVOA 5FF7A 4O10A 2IKHA 1W3HA 4HHLA 3WQ8A 4JIQA 1KBKA 2GJXA 4IGHA 4RDZA 4MWAD 4B9ZA 1LTDA 4UTKA 2QGHA 1X7IA 1XR2A 3FEQA 1VFSA 3GNXA 4F79A 3N73A 4MTVA 3KP0A 1F61A 1ZFJA 4NY2A 1UOZA 2PI6A 4P61A 1OIMA 1ADOA 4UTHA 1HG3A 4LYQA 1NDWA 3N29A 5EBAA 5A2CA 4XO6A 1F3EA 4PUUA 3UYIA 4R34A 3G77A 3ZZ1A 4K39A 5TD4A 5EL1A 3UPWA 4IPNB 4PMRA 2ZFAA 3GU1A 3AHTA 3TC7A 3FGCB 1S2VA 3L2MA 4WVXA 3OU8A 1F4HA 3O2LA 2NVCA 1BKHA 3MP3A 3M7SA 3I6RA 1GZJA 2C0HA 2WSPA 4O0KA 2AOSA 3GHRA 2F6UA 3C3UA 1VHNA 5FA5A 5L6UA 2B81A 3GE7A 3FAXA 3H23A 4LBUA 4H9YA 5HPCA 1EDGA 4HMNA 2VQTA 1XIMA 1FWJC 4TTGA 3N2MA 2BY2A 4EAYA 2Z24A 2ZRZA 2VZSA 3IRSA 1FWFC 2R1LA 4TVDA 2EQDA 2ZVRA 1GVFA 1K7EA 3O1NA 4K7YA 3MZ2A 5CJNA 3UG4A 3W87A 1ALDA 3LBCA 3R58A 3RILA 3PM6A 1L2QA 3R11A 3LPOA 4DLMA 9RUBA 1XYFA 2PDWA 2JFEX 4JHMA 4HYVA 5C55A 4RDVA 3MHGA 1OEPA 4Q3MA 4UTFA 1TIWA 1O1HA 3B9EA 2WNQA 3W7KA 4HPNA 3E1F1 3SURA 1PTGA 3EKLA 3M6YA 8RUCA 1UKOA 2C1HA 1B5TA 3GG1A 2OLAA 4KCWA 2WCAA 1PVNA 4FOUA 3NYZA 1I2NA 1P0NA 4JKLA 4FZIA 4LAZA 3S6TA 4QJ4B 3H26A 2GGJA 5TQLA 4QITA 1XGEA 3GVGA 4I7VA 3ARXA 3G1XA 1TTJA 2Z28A 5I07A 4O54A 3DC0A 1EHNA 4PTNA 4L5ZA 4DXKA 2X7WA 3HGJA 1UWRA 1X39A 2QJIA 1DWHM 5HMDA 3CHDA 4Q8PA 4ERAA 3LXBA 5I77A 2HBXA 5DFAA 3G1SA 2A1YA 2ZUUA 1BRLB 5C54A 2ZA2A 3WN6A 3CZJA 4PRWA 4HZ6A 5CG7A 2PDHA 1Q7MA 4QS5A 1FHLA 1GGOA 4ZR8A 5LIWX 5DCDA 3PZUA 3AYSA 3D3FA 3OG2A 4AZ5A 4DO4A 3TN5A 5DT7A 3WQ5A 4QE5A 5HINA 1RK6A 4PCNA 1E15A 3SUSA 1B3WA 1K02A 2BFGA 1OG6A 1KR0A 4C6DA 1FRBA 4YTSA 1RD5A 4LALA 2YGYA 1VD6A 3CH9A 1EX1A 4HMDA 3OQEA 3REQA 2WC3A 2QW5A 4HMCA 2J9ZA 3OODA 5HULA 3H2OA 1QWGA 1LQ2A 1HJQA 1B3XA 3BG9A 1KR1A 3U4FA 4MUPA 4UOZA 1J6PA 4FX6M 2ON3A 1QOXA 1W1TA 2CLOA 1MNSA 2V81A 3W7JA 3T0BA 1W3LA 3VDAA 4Y9AA 2EPLX 2YYUA 3T6CA 1SO6A 4E0CA 1UR4A 5EYWA 1JD7A 3NG3A 3PWGA 2ATMA 4HSHA 2W61A 1ZHAA 2WYSA 2G3FA 1FWIC 5AECA 4K3ZA 2VD8A 3G2GA 3QMSA 2G5WA 1XLCA 5JMUA 4K1WA 4AD5A 3HG4A 2ICSA 3WMBA 3ZR5A 3TW7A 2GVEA 2VD9A 3VGHA 2VZOA 2QUUA 3WD1A 4GOAA 4XAGA 1D8WA 2O56A 4LEFA 3UR2A 2CNCA 4HNCA 4PRRA 3V0TA 5C0QA 3MS8A 4J3XA 3WL1A 3CYJA 1K9FA 5CBBA 2X8RA 5A94A 1K9DA 2GJNA 1A53A 3WZ0E 4OGZA 3MHUA 5LA0A 3GH7A 4PSPA 4HSNA 1VEMA 5FL0A 3DFHA 1SYTA 2GQ3A 4J4KA 4IIBA 1V6XA 2Y7DA 2W9MA 4AD4A 1EDTA 4QDWA 2DIKA 4G7EA 3IJIA 3ZFHA 3GQYA 3CQ0A 3WK3A 1J12A 3TW6A 1EP3A 1E6NA 1E1CA 3OHIA 5E1QA 1QNPA 1J0IA 2ZUNA 4JIHA 3CHFA 2WMGA 3UXKA 3PBWA 4KKXA 1KFJA 1OF6A 1FKXA 4L1GA 2DSUA 4JTJA 3RLUA 3RR1A 4KPLA 1UJQA 1FCVA 1G5AA 3NVTA 3GTFA 5AHFA 2ACRA 5SWUA 2YLAA 3ANUA 3WH6A 3M6DA 4MDPA 1YIXA 1MW3A 1QI5A 4D6JA 4AD2A 4POCA 3ANYA 4O16A 2I1OA 1GHSA 4GK8A 3TYEA 3M0LA 4C1KA 1UG6A 4PTVA 1L6SA 4GYFA 3T05A 1FCUA 3R5EA 5HXMA 3EOOA 3BLPX 1IHIA 4P7RA 5CSRA 3TSBA 2TPSA 1O5XA 3IJQA 1EGMA 1E5NA 1TWDA 3SCNA 3ABZA 2Y7GA 3A5FA 3LDVA 2C19A 1BSLA 1Z41A 4GIYA 4QXIA 4WDWA 1OGGA 1XGDA 1Z48A 2RJGA 4YIWA 2PCQA 2G3MA 3VGBA 1KO0A 2QF7A 2XIMA 3MMTA 2X40A 4C6PA 2EGZA 3L4UA 1HL8A 2WQPA 3KOXA 1CXFA 4IIFA 3S1GA 4WF7A 2OWCA 3H7RA 3MWAA 4LS0A 4DWSA 5JH2A 1BRLA 2RDXA 6ALDA 3WQVA 3W4RA 1NWRA 3HN3A 1JXJA 3NDYA 3BMVA 2PLJA 4UQDA 4DQWA 3UWYA 1H60A 3CK5A 1XKJA 3G18A 2R9RA 4GXPA 5EU9A 1SSDA 3RU8X 3UG8A 4JYFA 4PUEA 3ITYA 3LM7A 4GRSA 4KMQA 2CLHA 1HN1A 3FOKA 4DZ5A 1X1ZA 4UQ9A 4A35A 2R1MA 1NU5A 4H2HA 3CJPA 4DO7A 1QCWA 4IP7A 2DFAA 7CGTA 3RF9A 4OBRA 1GJPA 2ZOXA 3NL3A 1M7OA 3ARSA 5FF4A 5MKGB 2ZXBA 2CLEA 4I8DA 4Z1YA 4L4MA 4D1JA 1P43A 4A3YA 2P5NA 3C61A 4QCFA 1ODZA 4GISA 4IXHA 5CCZA 3FA4A 1BWVA 2FVMA 5I7GA 4Y6GA 4G7EB 4O1CA 5KZMA 5BMXA 3W00A 4FXJA 1JI1A 5DY2A 4ZQOA 2E25A 3NPWA 3ALGA 4GFSA 4LBRA 1KRBC 4FP1A 3SAZA 5M17A 1R9XA 3UG3A 3TLLA 1N2VA 2WB5A 1UA7A 1M6JA 3QPEA 1S46A 1R3SA 5IDIA 3BWWA 3MWCA 3UZZA 1UD4A 1SM9A 2HSAA 2FFIA 4TX9A 2NX3A 3M0ZA 5E93A 4BFAA 1NTHA 4RV3A 2WVTA 3UWEA 1IEWA 3CUXA 3HJZA 4B5SA 2CLFA 2HEJA 2JKEA 5D38A 4MWAB 3U2CA 2PDIA 3CUFA 2YCIX 1BYAA 2OQLA 3T42A 5GNXA 1RJRA 1IXPA 4P7OA 1JZ3A 2FDMA 3WIJA 5G2IA 1FQ0A 3SEPA 1BWLA 1XISA 3RLHA 1QO5A 1R7AA 5D33A 4O50A 2HV5A 1V77A 4H04A 1I0BA 1QK0A 1VLWA 4GMEA 3GXPA 3W38A 1M7XA 3POCA 2AQVA 3EOSA 3GXIA 2DQXA 3WX7A 1KM5A 4LPCA 5DBTA 2J9XA 2D23A 1UMYA 2FZDA 1XBXA 3ITGA 5MKGA 4LF1A 3LPFA 4MKNA 1MDLA 1Z42A 3HPSA 5FD0A 1VFUA 3VCNA 1VS1A 3PN8A 4CNUA 1VEPA 4DZHA 2H90A 5CZKA 3RMEA 3SSZA 5GJMA 4FIRA 1RH9A 3RMJA 3WYZA 1CXLA 3AS1A 4YYFA 2NV9A 5DMNA 2V38A 4D6CA 4RNFA 3MBFA 1XINA 3E74A 1ELSA 2IKIA 2QULA 4YCPA 2FGBA 3WF3A 1OYBA 4O1BA 2PTZA 4M6PA 4MHBA 4IL0A 1LRQA 1PKMA 4AC7C 5TAOA 5F1VA 1K8XA 3A4WA 1B9BA 3MQTA 2DSVA 4FXRA 2Z6JA 1E9YB 5D37A 3MMWA 2BXVA 3LENA 1RY0A 2OELA 3QW4B 3A9IA 4GNVA 1XLGA 2W63A 1X8FA 1QPKA 5LZLA 2GUYA 3LY0A 1NM9A 4FA3A 3LN3A 4HCHA 4MUZA 3KFTA 1NDZA 4KWSA 2A5HA 4JKKA 5H8PA 3FK4A 4F2UA 4BWLA 2RFGA 4WIWA 1L8NA 1UR3M 1XYCA 5I3JA 2HWGA 1DTNA 3V5OA 2BOGX 1ISZA 2V2HA 3H2NA 2PDLA 3VIMA 4NNAA 1E1FA 1DIOA 1W3KA 3IUIA 1HJVA 2PMQA 3NZGA 3CL8A 3LZ3A 1PX8A 1XSKA 3S9ZA 1EUAA 5CSSA 2G0WA 4PBEA 4GBDA 2VOTA 2Y24A 3ZVHB 6A3HA 1Q6RA 1K70A 4GGHA 4M1RA 1OGBA 3IVUA 2JE8A 2NUXA 1V7AA 4YVPA 4S3FA 3PBMA 2CCRA 3W1XA 4C6EA 5I24A 4DJEC 5G4WA 4HU3A 5KZEA 1N55A 2H3DA 3MCOA 3E9AA 4MNKA 3SN1A 3GXNA 3G24A 1A0DA 3PS7A 3GHUA 3CWOX 4UZUA 2OYLA 2CZDA 2VDIA 3B0PA 5A8NA 1CW2A 1XC6A 1JCNA 3WSUA 1TJ1A 1SR9A 3H24A 2EKCA 4XZBA 1QPRA 3RLVA 4O1FA 3UJSA 1QO2A 4YJ5A 2IKGA 1GQJA 5G1YA 1XUZA 2Y8UA 3TC3A 3E2VA 2G97A 4CD7A 2PP1A 3WJSA 1CWYA 5CSYA 2R14A 4XB3A 2BODX 3D3AA 4XD5A 3FGCA 4Y9PA 5CAHA 2NV2A 3VKKA 4J7RA 1SQ7A 2XWDA 4E2BA 1PZ2A 4JFVA 1QFEA 4A6GA 2I9UA 3BV7A 2NWRA 3RPMA 3IIVA 1W9BM 4PMDA 3BVJA 1ZL1A 1LLWA 3EDEA 1K8CA 2GQ9A 4Z1AA 2RGLA 4JQAA 3SCTA 2GLKA 1K4GA 1OF8A 1TZ9A 2QJJA 3UJEA 5C9WA 3N25A 3I10A 4UCFA 2A6LA 4WK9A 2NT1A 2A7PA 2DGAA 4AW7A 1FVPA 3HJEA 4LUSB 5BRQA 4DJFC 1XDLA 1VAHA 3LGDA 3I68A 3ABQA 4A2SA 4FNSA 1VGAA 1XLMA 3S8HA 1VEOA 5C5YA 3U3HA 1EUNA 3J7HA 2OT1A 2INFA 1IWBA 5JBDA 4QLJA 1Q66A 3VNZA 3AYTA 1ZU8A 3G1AA 1OWQA 4E4PA 1S2WA 5AC7A 3L12A 1S5NA 2GJLA 3W1PA 5DCEA 1TTPA 4RW3A 4DBWA 1S1PA 1CIUA 3RIKA 4YNGA 1TKKA 3KX6A 4AMCA 3B3DA 3L68A 2QDEA 4IPPA 4X0NA 1TVNA 2O7QA 1PIIA 2GSHA 3M7WA 4IP5A 4ZMGA 1I8JA 2QUMA 1W1IE 1OHLA 3FV9A 1EPVA 3QC3A 1PTDA 5T8GA 3SB0A 2CESA 1TREA 4MYXA 3E0LA 4AHPA 3WH7A 4KGJA 2XVLA 3S2NA 3AHYA 3H70A 3SGGA 3A64A 1HTIA 1X98A 1FCBA 1CGYA 3EB3A 1JPHA 2EO7A 2Y2WA 3TAKA 1WA3A 3IIOA 3WLQA 2VFGA 4IMCA 5BRPA 1PWMA 1W0MA 3WK1A 1EH9A 3NM3A 4TUFA 1JYXA 1E3ZA 4IM4A 2OLHA 4YYCA 3MV01 1YTEA 1KB3A 1EZ2A 1JVNA 5K2ZA 1JCTA 1BYCA 4E2OA 2HS8A 4H7CA 2A3CA 4GY1A 2BHUA 3U0HA 3KWXA 4C65A 1US3A 4JAWA 3KP1A 4ZA0A 1HL2A 4PCPA 4C60A 4O57A 2IQDA 3SY8A 1DOSA 1JXKA 4AVOA 1KTCA 1XH2A 3GK0A 2FQIA 4GG9A 3ANVA 3DFQA 1H41A 4HOWA 3WDJA 1JUBA 5C9RA 3P60A 1EOKA 1YE4A 4GUJA 2YFOA 1M53A 3FHQA 4E2DA 2CETA 1HT6A 1LBMA 2AL2B 4PH6A 1E1CB 3A47A 3DI1A 3M47A 2ZZ3A 4JTAA 1ECQA 3PY2A 2H9AA 5AKQA 1XFBA 5F4XA 3HB9A 3IPWA 4C1LA 2R91A 3G1YA 2Z1WA 1LDCA 1KWKA 3JZEA 1IXOA 3P0XA 3A6OA 3BAIA 4BR1A 1PHQA 3PSVA 1SPQA 1J9YA 3QVQA 3FHAA 4GVIA 3OYZA 4FAMA 3PFRA 5C2GA 4G8TA 1H11A 4YPJA 2OZ0A 1KC7A 2CITA 1QBAA 3WLNA 4J3UA 2WMIA 1EOMA 3PZQA 4H01A 4NXKA 3PUEA 3EAUA 2QUNA 3LS9A 2TAAA 1XPGA 3BJFA 4QE1A 1RAKA 3VIOA 1Q85A 2E6AA 2INZA 3IRDA 1VCFA 3VC6A 2VEIA 4FEZA 1TO3A 4DI9A 4LV4A 5LYRA 1GW9A 1DBTA 3CAWA 3BCJA 4NU7A 4W5UA 4IISA 4TX8A 4LNCA 1HFBA 4GINA 3SN0A 2EKGA 3GDTA 3VNJA 2OG9A 3QTGA 3TNBA 3KM8A 4ACZA 4ZOEA 5HPOA 4EIVA 3RYSA 5TF0A 3G8EA 2CLKA 1OX6A 1HUVA 2Z1VA 4L9YA 2VFDA 2QVHA 1GOXA 1K7FA 1JYVA 3GHSA 4ZQCA 1C7SA 3MI3A 4S3KA 1LWHA 2QT3A 3BOXA 3H2MA 1QHOA 4TU1A 3LTPA 2YCEA 2OGJA 3QH2A 1V6YA 3QLDA 5FSDC 3WMCA 2TRSA 5I3HA 3N2TA 1WXYA 6XIMA 3DGRA 4B3KA 3WUFA 1D3CA 3VILA 1YPXA 4MY1A 4KFNA 4AIBA 5D03A 2C3ZA 1QATA 2AL1A 2D3LA 4DUVA 1EJWC 4MB3A 1QI3A 4CGTA 1W8SA 4C6LA 3OBEA 4LUJA 5LXEA 1DWIM 2OX1A 3S9YA 3M5YA 3U2ZA 3KCLA 2FJUB 3QSTA 1R8LA 5ABGA 3WMLA 2XUCA 1SFTA 1VQTA 2ACQA 2GFTA 1OZQA 2GDUA 5A8PA 3IK4A 2VTFA 4MPQA 4Z42C 1AZ2A 3TX9A 3R4IA 4U2ZA 3QQ1A 1K9EA 4GGBA 3W02A 1UR1A 4AX6A 1L9WA 3W53A 3LUTA 5LSMA 4Z2HA 1NFPA 3SFKA 3DG7A 2WHMA 2VC9A 4GY7A 1YNPA 2P3EA 2VL4A 3ITTA 3NEHA 5HQMA 3P14A 3CGTA 4ZXOA 2VRQA 1GOMA 1R85A 5REQB 1Q7QA 3MA8A 5BXTA 4XD4A 3MSYA 4N4QA 5FF0A 2W27A 4NYYA 2VC6A 3SCUA 4JTQA 3EWCA 4LUTA 5EMKA 2D0GA 4ORMA 3IGHX 3NNTA 1ZP4A 4B4HA 3R6IA 3C2FA 2Y7FA 1E73M 3QV8A 2Y5SA 4JTTA 3BGAA 4FIQA 3TMQA 1RVGA 1UPPA 3JRKA 1I4NA 2VRJA 3O05A 4DF0A 2VZTA 1FXPA 3TIMA 3WNLA 3GM8A 1OD0A 4Z2KA 2GGIA 1MMFA 1TV2A 5E70A 3PJWA 4EK7A 1TVPA 3N3MA 1IWPA 4GIEA 1L6GA 4RDWA 4REQA 3H54A 4FLOA 1FDYA 4QIUA 3DG3A 3TQKA 4B2DD 3CAQA 3B8DA 1CEOA 1HXJA 3UWQA 2BY1A 1WDQA 3LPPA 1KV5A 3OEXA 1R3QA 4RE2A 2W4XA 1AQFA 3WCZA 5CBIA 4K2SA 1YPFA 3GFZA 5CLTA 1W9XA 3ERPA 3GXMA 4BWLC 2XH7A 2VDHA 3LNPA 4S3AA 3CAVA 2DT0A 3OBKA 2NQ5A 4O15A 4LXFA 2JF7A 2BOFX 5BWFA 4F0KA 3AMDA 4ADTA 3MPGA 3TJIA 3VINA 1Z6KA 1AZ1A 3THUA 4FMVA 5CC3A 1UYQA 4GX8A 7TAAA 1ZLPA 4AC1X 2CC0A 1PB0A 2GQ8A 5D9MA 3TN3A 1V3MA 3FX4A 4TIMA 1RP8A 1W17A 4ZE4A 1ITXA 4BQ4A 2GPTA 4GVFA 2FVLA 2QV5A 3H2CA 1UASA 4W8BA 2XN0A 5I78A 5E0CA 2JIWA 1C90A 4JIPA 4HP5A 1UH4A 4NL1A 3W7EA 4AYGA 4MZ1A 5G4EA 5A6TC 3UW6A 1OX5A 4MOZA 3GAKA 3WLSA 4HK6A 4L6HA 3RNDA 3E0IA 5KZDA 5C9UA 1IT0A 1TWWA 5CZ0A 1B4KA 4GFIA 5A6AA 3AUOA 1M03A 4U5KA 2WWDA 1RA0A 3N2OA 4PFHA 2NT0A 1KW1A 2UY4A 3KE0A 2H3BA 1EHAA 1JCYA 4G1KA 3CUGA 1HKIA 2QF8A 4L56A 3OPSA 1OFOA 2AMXA