2RH9A

Tryptophan synthase complexed with igp, internal aldimine, ph 9.0
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
254
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryptophan synthase complexed with IGP, internal aldimine, pH 9.0.
rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 95
structure length 254
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2rh9A00
3RK8A 4A2SA 5KZDA 4IMEA 1UBSA 3CU2A 5F2GA 2C3ZA 1OX4A 2YW4A 3LXAA 3TDFA 4WX2A 4UFIA 1KFKA 3TROA 4NQ1A 4ZQOA 3S5ZA 4OGZA 2NWRA 1U83A 1QR7A 5D03A 3SW6A 4UC5A 2X1TA 4FNQA 1EA0A 2PE4A 4RKAA 5AHEA 1FDYA 1R46A 3EX1A 4IMCA 2WQPA 2Z2UA 3CIXA 3W72A 2VC6A 4M7TA 5LGXA 3NQFA 1H7WA 3LGEA 5F2LA 3QEZA 3MI6A 4GJ1A 4JTHA 3NDOA 4LRSA 1QFEA 1W54A 4CCEA 2GOUA 4Z0SA 4E2DA 3PSWA 3QSTA 3ZWSA 2TMDA 4BWLA 4E0CA 2CLEA 1O60A 3GDMA 1ICPA 4N9EA 3B4UA 3BVJA 2QCDB 3Q37A 4WUIA 3U2OA 3GAKA 4QAIA 3IGXA 3LCIA 3W2NA 3QM3A 2V0TA 1OFDA 4RR4A 1GTEA 2FPVA 1P1XA 3PY2A 5HULA 3W7LA 1W8SA 4PH6A 1SQ7A 3C2VA 5LSMA 4LRTA 4ONVA 3P60A 1DORA 1J2WA 4OV9A 5DLCA 2W0UA 4K6AA 4K38A 2ZRUA 5K9DA 1W3TA 3HGJA 5D2TA 3NNTA 4JXCA 3KRUA 5LGZA 4BI5A 1QMLA 1LCOA 4RK8A 4YWIA 1OFOA 2RH9A 5E93A 1A5CA 2A21A 3PVFA 1OF6A 2ZA1A 3P5YA 4IX0A 2A5HA 4DBDA 1G6CA 3F4WA 3FJ6A 4DBEA 2YGYA 3LI0A 1YTKA 5G5IA 3R13A 3O8AA 5FEZA 3W7KA 3W1AA 4YCOA 1FCQA 1JRCA 3KRSA 3SECA 4FXRA 3W7CA 3C8FA 1K03A 4JX4A 1C29A 2JKAA 1T0OA 3GZ3A 3O07A 3TAOA 1HUVA 4K37A 3SFKA 1Y0EA 4HN4A 3QMTA 1JQVA 2B7PA 2HTMA 2XN2A 3IVUA 4WY0B 3T7VA 5F1UA 1AL8A 1GT8A 5HWMA 3EXRA 3W7NA 5C55A 1OYBA 5FESA 4K8EA 2HS6A 4AHQA 4H6KA 3BARA 1TB3A 2YR1A 4EF8A 3UXAA 2QCLA 4O14A 4NNAA 3MO7A 3GR8A 2YYUA 2VFEA 3LRMA 4MVAA 1DVJA 3DFTA 4LUJA 4Y6GA 2EAWA 3U8GA 2YX0A 3GXTA 5U4NA 5DXXA 5CSSA 2X2GA 4MJZA 1EPXA 2E6FA 4LWWA 4KWVA 4N2YA 3GKAA 3PAJA 3GXPA 2CZFA 2ZZ3A 4BF9A 2QUVA 1TREA 5I3JA 3B0PA 3A5FA 1X6UA 1XI3A 3KXQA 3MWAA 3QJAA 1O94A 1L6YA 2DZTA 5D2WA 5HMSA 3A22A 3W7PA 1L2UA 4ZQNA 4UCGA 3LHTA 2Y62A 1SW7A 3G24A 1SZGA 3W1XA 1LORA 2QDGA 4UNLA 3LX9A 3QF0A 3DENA 3EB2A 3GB6A 2NZLA 3JRKA 3TXZA 3HG5A 1B3OA 4GUGA 3OG3A 2ALDA 2DZWA 1O5KA 1SO5A 3G3MA 1JR1A 3ELFA 2P10A 2A6LA 1GVQA 5D30A 3BW4A 4MFEA 2RDTA 3A23A 4JNMA 4WJEA 2YXGA 4ZQPA 1RD5A 4KFPA 3W7EA 2GUUA 1AW1A 2TSYA 5HR7A 1GTHA 2Y89A 2ZTKA 3P61A 4L4MA 2ZRYA 3MHFA 2VEKA 1MXSA 4ML9A 1TJRA 4X2RA 4K8HA 1TV7A 3HGOA 3W7QA 3L5AA 4LVFA 3NL6A 1VR6A 3TR2A 1WA3A 2QDHA 4ICNA 3M5VA 5AN7A 4RXGA 4LVGA 5BMWA 3W23A 1W37A 4IMDA 1W56A 2VEPA 3TV8A 2ZA3A 1OFQA 8TIMA 4MKNA 4HNNA 3NXFA 1ZFJA 2Y88A 3QYQA 2E6YA 5C5YA 1Q6OA 2A7RA 1AK5A 1G7VA 2QCEA 1TO3A 2AGKA 1KV5A 4JTUA 3EEGA 1NF7A 1R2SA 4G1KA 4A29A 1OX6A 3TIMA 3W7MA 3KVKA 5KINA 3NAVA 5HINA 4LNYA 2QJGA 3STEA 1ME9A 5G2IA 4Y90A 4NZJA 1RQEA 4HPJA 4LS0A 1R2RA 5J5DA 2H3BA 2HMCA 4AWTA 3LHZA 1J4EA 4MPQA 2FJKA 3OVRA 4Z1DA 4RCXA 3LBCA 5AHLA 1SW0A 1TV8A 4IQLA 3PG9A 4MZ8A 2Y7FA 4FNPA 3UYCA 4MY9A 4AAJA 3NQ6A 1TIMA 2Y70A 1T96A 4WY0F 3C2FA 4JYDA 3NQDA 3TC6A 1N7KA 7TIMA 2PRMA 3R8RA 1OG0A 5G2HA 3HMJG 4S2BA 4IWWA 3BGGA 4JTJA 1X8FA 2E1DA 4HNTA 4NT0A 4FO4A 5CPOA 1EP2A 3C3NA 1SZFA 2E77A 3HPXA 2QAFA 3NYZA 2QR6A 3TSMA 1FWNA 2DP3A 4FX8A 1V7YA 4RZ6A 3TW7A 1T8XA 3T44A 2OJPA 3PC0A 4L4LA 2XN0A 3GR7A 4UTTA 4MIMA 2PCQA 1FXPA 3TNOA 1QOPA 3CT7A 2NX3A 1WOAA 1D9EA 2R91A 1X7FA 4WD0A 5KTLA 4UFKA 2NLIA 3USBA 5GVJA 3SZ8A 5BMXA 3NQ7A 3PB0A 4AWSA 2FTPA 4TU1A 3GKFA 4A3UA 4Q33A 1F2JA 3MW7A 2JKEA 4LVBA 5I3KA 5LNWA 3DI0A 4CQAA 5DCEA 1KTCA 2ZZ4A 3I65A 3NGJA 2VFGA 5D33A 4OE7A 3DGRA 1OHLA 2XN1A 2VFIA 3L21A 3W1NA 3CPRA 4M19A 4ADSA 1XXXA 1GWJA 1V5XA 3C0JA 1AG1O 1LLZA 5AHNA 2V81A 1N8FA 1G4EA 2YZRA 3EWYA 3WJWA 3W87A 1RQBA 3W1MA 1LM1A 3UZJA 3LTYA 4QQ3A 1DJNA 1KTNA 1JCLA 1GYNA 3W2MA 1VHNA 5D05A 5DCDA 1GEQA 3V1PA 4UTWA 4FIRA 2E5DA 1LP6A 4W9TA 5FEXA 3G1YA 1W31A 4QNEA 3TFXA 2NWSA 2YFOA 1VHCA 4OBTA 3BPWA 3ZR4A 4N4PA 3O63A 1W5OA 5HNRA 3CM4A 1UB3A 1EB3A 3LHVA 4NJHA 5CGQA 1IXQA 4N9DA 4GUJA 4LTSA 3BV4A 3UWVA 3EWWA 4X22A 3IGSA 4IGHA 3W7OA 1OK6A 2IQTA 3PUEA 1JCXA 2EKCA 2F7FA 3FS2A 2PRHA 3GNDA 4XTDA 3EKLA 3L9CA 2GQAA 1YDOA 1O95A 5F4SA 2FDSA 5BRBA 5FEWA 1OFEA 5HR6A 5D2YA 4XBSA 1TPVA 3VKJA 1XDLA 2GPTA 3LI1A 1KW1A 4JN6A 3INPA 1SFJA 1NFBA 1EWDA 5EMUA 2VELA 3NO5A 2H8XA 2G95A 3PBYA 5HUOA 1K8XA 2QCGA 2GVGA 3M16A 3B0VC 4LV4A 3WJXA 4LC8A 2G97A 1OF8A 2E5CA 1I2PA 3MP4A 4M5PA 1JUKA 3M6YA 5C2XA 2ABAA 5MHBA 1LBMA 4DEFA 4OHQA 3GDLA 1F7BA 2V2CA 2J9XA 4IJBA 3I68A 3C6CA 4O11A 2DORA 3KVMA 1H1YA 4GC4A 1TRDA 3M5XA 3C2OA 1W1ZA 1YDVA 3ZS4A 1ZCOA 2RHGA 3LRLA 4Z08A 1KLYA 5CSRA 1H62A 4XQ6A 4XWUA 3IV3A 3BGJA 5D2VA 3TJLA 1GG0A 4ADUA 4DO4A 2LLEA 1A50A 1FY6A 4PA8A 4UTUA 2ZTJA 4R7JA 3LTSA 3STGA 1FWWA 2GVLA 1KBIA 4PL1A 4RZ5A 3I7SA 1L9WA 3LCWA 2QCNA 4JX5A 3EKZA 5E1QA 2QCHA 1Q45A 3DFSA 1PV8A 2P1FA 5AHIA 4JICA 2VFDA 4JTEA 4O50A 3MBDA 5KITA 4UTWC 4R33A 1WYIA 4E2BA 1SPQA 3W2UA 1SZNA 4MFDA 5J5RA 5EKYA 4XZ9A 4ZVJA 1SO3A 1K7FA 4IMFA 4XKYB 5KMYA 4O19A 3S5NA 1H7NA 3H55A 3VI2A 4O15A 1ZJIA 1G67A 3DBPA 3G1VA 1IXNA 4LOCA 3AO0A 3PR2A 1TPDA 1LLWA 3GLCA 3LCXA 5AHMA 3FYPA 3QZEA 2ZYFA 3SI9A 3NR0A 2JGQA 1ZAIA 1I2NA 5CZJA 2WOQA 2D73A 3OIXA 4MLRA 2G5WA 1H50A 3TE9A 2J9YA 4BR1A 4H3DA 4H4IA 3P7YA 1DKWA 1VLIA 2NUYA 2EPHA 1NEYA 2J24A 1ZALA 3NL2A 3NQCA 1GJPA 5G1YA 1S5TA 3PUDA 3HPZA 5C54A 4FIQA 3L0NA 3W22A 4HKPA 2C0AA 3QFEA 2YW3A 2CLHA 3KOFA 4U4MA 1CX9A 3BG3A 1F5ZA 1EUAA 1IXPA 1JJKA 3W2KA 2DZXA 2JBMA 1MEHA 2YCEA 4HT3A 3N9SA 2BZNA 5AC7A 3W7HA 3P74A 4NJKA 4GFSA 2DU2A 2R14A 3NL3A 5DY2A 3M9YA 5DXYA 1L6SA 1TSIA 1LOQA 1PHWA 2QAPA 1QCWA 1G69A 1H61A 1TV5A 4GNJA 3UPWA 3IIVA 1TTPA 1K8YA 1ML1A 4JX6A 4POCA 2ATMA 4MY1A 2RDWA 1GG1A 3N2XA 4BWLC 3G1DA 1WV2A 3FFSA 3QC3A 1GYLA 3UY8A 4HNVA 3LERA 3SR7A 5K2ZA 1K02A 5U7SA 1XC4A 3O06A 3R12A 3PF3A 3T78A 1FX6A 1VGAA 3L5LA 3N19B 2B7OA 4O57A 2CLFA 1KTBA 2CZDA 4UIOA 3LV5A 3M5ZA 1I2RA 3HG4A 1I45A 1PL9A 4UTMA 1KA9F 3S6DA 3N14A 3M47A 2PC4A 4YMZA 4AF0A 3NG3A 2ZCGA 1ADOA 2GVJA 3VCRA 1FWRA 5LHEA 3LXCA 1WBJA 1LROA 4Z1BA 3EX4A 3N34A 1TPB1 2CZ5A 2OT0A 1SFLA 4R34A 3IVTA 3IRDA 1YTDA 5SWUA 1FXQA 4N9CA 3L0KA 3W07A 1JCJA 3GIYA 4HNUA 1IIGA 4Z0JA 2NXIA 4GUIA 4PTNA 2C18A 2O7SA 3P84A 3A21A 1XUUA 1ZAJA 3HQ1A 1G4SA 4K7YA 3TW6A 3IIOA 3TAKA 3NZRA 1B4KA 4AEOA 4CNPA 1JQXA 1PHQA 3N3MA 1DJQA 3CC1A 2ZDRA 4UXDA 2NX9A 3OHIA 3U6WA 1PCWA 4AHPA 3DZ1A 1XBXA 1TPEA 2V5LA 2BSLA 5LNSA 4DXVA 4NU7A 2XFWA 2DZVA 3W7JA 5HQEA 2NV1A 2GJNA 2VOMA 1BEUA 3PM6A 1TPH1 2Y63A 1F6KA 3A9IA 4MOZA 3TK7A 4MYXA 3A5VA 3S1UA 3KRZA 1QPRA 2HSAA 1OFPA 4DPQA 2CW6A 5AOUA 2TRSA 3T40A 3L0GA 4AHOA 3G1HA 4UFLA 3BLEA 3PG8A 1W3NA 4DF0A 2W79A 3MI3A 4PEKA 4Q32A 1HL2A 3T4CA 3L2IA 1VCVA 2A6NA 2NX1A 1XL9A 2GJLA 3B06A 2E6DA 3EWXA 2H6RA 3NPXA 1KM4A 1OJXA 1H7RA 2Q8LA 3NQMA 4YL2A 4BK9A 1B4EA 4HPXA 4WQ6A 4IXHA 1MEWA 3E9AA 3RNDA 4AB4A 2RFGA 3NQGA 3LB0A 2J27A 4QNWA 3DI1A 4C1KA 1AMKA 4LC6A 3LHWA 3M1ZA 4RJEA 2P0OA 3DXIA 3NPVA 1JCNA 2FB2A 1Q6QA 4MUZA 2VEMA 4O1CA 1KV8A 4FB7A 1T99A 4ZZ9A 3VFLA 2WJZA 3QPZA 5IBXC 1YXYA 3TJXA 5BNKA 4ORIA 1LRTA 2CFFA 1EEPA 4E38A 1JCMP 1JRBA 5F2MA 1KM0A 3DKLA 3QSRA 1P0KA 4GE8A 2X1UA 3L65A 1K3UA 5CZSA 1S5VA 1S3HA 3PUOA 1JUBA 2FLIA 1VC4A 5LNUA 4KFNA 5KZEA 3H53A 2C13A 3ZFHA 5D09A 1GVFA 4FF7A 5A5WA 1M7OA 2Z0IA 1GPWA 2V9DA 2WNZA 1XUZA 4EVZA 1I8JA 4K36A 2Y61A 1CW2A 2Y7GA 1KM5A 3C56A 3W1PA 4GBUA 1C8VA 4PC8A 4UNKA 1P5BA 3L67A 4AF0B 4QJ1A 4FX6M 3WK0A 5C6MA 3P81A 4LV9A 4LT9A 2RKXA 5AFDA 3MP5A 3DH7A 1JULA 3MP3A 3NZ1A 4QIUA 5L6UA 2X30A 1KFCA 2Y85A 3OVQA 3UWYA 5F2IA 3GNNA 5BW6A 3JR2A 2V30A 1O4UA 5FI8A 3QMSA 2V82A 1DOSA 1ZAHA 3W9ZA 3BW2A 5K9XA 1G7UA 4UFJA 2OZ0A 3RF9A 1XKYA 3TX9A 3CIWA 2ISSA 3FLUA 4O4WA 3RU6A 3DFNA 3O05A 3FYOA 4MZ1A 1UUMA 3G1AA 5TBOA 2H90A 1KFEA 1YPFA 3DAQA 3TFCA 1FCBA 1GOXA 4JYFA 5F4WA 3BK0A 1TCDA 3SSJA 4WY0A 3FEMA 3G3DA 4RV8A 1GZGA 4MLJA 4NXSA 3NPWA 5FF4A 2Z6JA 1TPUA 4AWUA 1H7OA 1H7XA 4Y8FA 1MO0A 2A4AA 5TIMA 3PULA 2A7PA 4PL2A 5F1VA 1LDCA 1VPXA 3IEBA 3O6CA 4UFMA 4CNNA 4P61A 3EX3A 3NPUA 1FWTA 1R30A 4TMCA 2I9EA 4AVFA 2YFNA 2W6RA 5CZ0A 4U28A 3WK1A 4A2RA 3MMTA 4GRSA 4ADTA 4Y9AA 3VE9A 4UTLA 1QPNA 4UTHA 1HTIA 1ME8A 3TC7A 3WJSA 1E51A 4FNRA 2AAMA 4NNCA 2OX1A 4CLMA 1M7PA 2DZSA 3W74A 1TTIA 4UTJA 5G1TA 4OU1A 1TMHA 1IGSA 3NM1A 1TRIA 4CCDA 3S42A 3DKJA 3BLFA 3G18A 2Z1BA 5CZTA 5BOOA 2BXVA 5I3HA 3BG9A 1IF2A 2OMAA 4X3ZA 3IGUA 1I2QA 3P82A 2ZFAA 1H7PA 2C1HA 2TYSA 2ZRXA 1H51A 4ALDA 3TMLA 4TO8A 3FIGA 1VRDA 3SIZA 3STFA 1MZHA 1OYAA 2YYTA 2OCZA 2EHHA 3NQAA 5HWJA 5HUPA 1VZWA 4QM1A 4M6VA 1QO5A 3W88A 2B7NA 1MSSA 3QRHA 4O0KA 1BKSA 1ME7A 5LKYA 1DV7A 2ZZ1A 3C61A 3F4NA 2C14A 1MEIA 1A5AA 4RZ4A 2QEZA 3S5OA 5FF3A 1GQNA 2V2DA 3E0IA 3ATZA 1YDNA 1XBZA 1OABA 1OVDA 3W84A 2X1SA 3P67A 3MJYA 2B0MA 4NX5A 3QH2A 3W1LA 4UFHA 4N4QA 4IMGA 1SUXA 2HS8A 1SSGA 3CEPA 3UZ5A 2YSWA 3IVSA 2G96A 3TUUA 3YPIA 4CQ9A 2DZUA 3MI2A 5CPNA 1D3GA 2VFHA 2E68A 4LS2A 3EWUA 4IPIA 1DL3A 3MHGA 3N9RA 3OVPA 3QQ0A 1W3IA 3BO9A 1WX0A 4FNUA 1L6WA 3W75A 1VCGA 1JUEA 4LY8A 1NVMA 1VH7A 2Q8ZA 4RXFA 1YYAA 5EA9A 3GXNA 3W76A 3G0SA 1W0MA 3CB8A 3DFPA 4O4VA 1X1OA 4O17A 5DELA 5AHFA 3HG3A 3MHUA 3G1FA 3IIZA 4K7VA 5E0KA 5EY5A 2A2IA 1WAUA 4RLIA 4B5NA 1UASA 3W3OA 2DJXA 4N6FA 1R47A 3OEXA 2C6QA 4XTIA 1SZEA 2CZEA 3DFOA 1VS1A 2E6AA 1TYGA 3TKFA 4I7WA 4S1FA 3C4UA 3W2LA 3G0UA 1YXDA 4JDYA 4GXMA 3NQVA 4JTFA 3W86A 1OK4A 2F84A 3EXSA 1TTQA 2OT1A 1KM2A 4OWGA 1AL7A 3UXDA 4NVTA 1Q6LA 3W7IA 5AC6A 3W70A 3BG5A 1UUOA 4DQWA 3H54A 5EBUA 3S9YA 5HJLA 4LS1A 4UMBA 1YTEA 4WZHA 2GQ9A 3QW3A 2A1YA 1OX5A 1FWSA 1TTJA 1GVOA 2Y6ZA 3SGZA 1TPFA 3EXTA 3EWZA 1SW3A 5D04C 2WKJA 5EL1A 4PCFA 5AYYA 3S0CA 4ZQRA 1VQTA 4HSNA 1B9BA 1HFBA 2I14A 1ZENA 2ZZ5A 1OFRA 2ZZ6A 3F1QA 2WV8A 3CWNA 1SO6A 1X1ZA 3RLUA 4NXKA 2FFCA 1YPIA 2V5BA 3BW3A 2YDAA 4O1AA 1Q3NA 1HG3A 2JKPA 3ABQA 4A21A 2PURA 2QUUA 4MJMA 2CU0A 4XUGA 1Z48A 4O54A 4LVAA 4N9BA 3W71A 4IOTA 3HGRA 1K7EA 4MY8A 3QQ1A 1XFBA 3TQKA 1EUNA 5CKSA 1PCKA 3WK3A 2ZRZA 3M41A 3PBWA 3ABOA 3FOKA 5EPDA 4O8RA 1ICQA 3B04A 1KM1A 1KFBA 5FF7A 2DZPA 3PSVA 4UR8A 4O53A 1PVNA 4HSOA 4NJGA 4YXGA 4FNSA 3Q94A 1SU5A 1SO4A 5KSWA 3HF3A 4Z1CA 3OBKA 3B0UX 4XBKA 5K9CA 3G1XA 3C52A 4S2CA 4CCCA 2VEIA 3FA5A 1O5XA 3AJXA 3TQVA 2QCFA 4PFMA 3RLVA 3M44A 4LVDA 3UWWA 3CQ0A 3EX6A 4P2VA 4HIBA 3SGUA 4GUFA 1SR9A 2CLKA 4I9AA 3SY5A 1W5PA 1KFJA 1FDJA 2VKZG 4GUHA 4EF9A 3QMRA 4M7SA 1LZOA 3WK2A 1TPC1 2VXNA 3UPBA 1OFBA 2WSRA 3EX2A 1LRNA 2B7QA 1NAL1 3LCGA 1XCFA 5FF2A 2Z6IA 3W1UA 4QITA 3D0CA 2ABBA 3MYPA 3B03A 3P8JA 3E12A 4JTTA 3E49A 3W83A 3NQ2A 4JTGA 3LLDA 4Z1AA 1S5WA 3CEUA 1ZY9A 5KZMA 2ZA2A 2ISWA 2ZZ2A 1B57A 3NEVA 3N73A 1PIIA 2BWGA 3TSDA 1VYPX 4JY8A 1TJPA 4C1LA 5D32A 1AW5A 5CPLA 2ZBTA 3I7RA 4OT7A 1DBTA 2CLLA 3WJZA 1EX5A 6TIMA 2NUXA 3LBMA 4PODA 3S1WA 4UTTC 1QO2A 3L66A 4J9JA 3ZWTA 4JTKA 5IM51 1THFD 4UTIA 3DHFA 4TMBA 4YLWA 4ZMGA 1FBAA 2RDUA 4JYEA 4FX7A 3L5MA 1YXCA 2J88A 2A7NA 4JEQA 3W7RA 3VE7A 4OQVA 2CLOA 3L68A 1KBJA 4JDBA 3UWUA 4JD4A 1C9DA 3NA8A 4JTIA 3R2GA 2TPSA 3THQA 1LYXA 1EWEA 4JY9A 3E96A 3PBVA 3BLIA 4JIQA 4TR9A 4WXZA 1M5WA 1F74A 1I2OA 1WXJA 3EWBX 4FHAA 1QPOA 3CHVA 1K8ZA 2WPBA 5AB3A 4O0ZA 2ZRWA 4DF2A 5CG7A 1GVSA 1A53A 3HJZA 3O6DA 2H3DA 3LHUA 1KM3A 1BWLA 3TCEA 5LZLA 1VJIA 3UNDA 3GX9A 4XKYA 3NQEA 1IIHA 1AW2A 5K7JA 3KX6A 2EF9A 3TH6A 1HO1A 3FKKA 3LLFA 2WSYA 3GYEA 4N02A 4KKXA 3KVLA 3Q2DA 3FJLA 5AYZA 4UUIA 3I7QA 5F4XA 3S5YA 1WDWA 1A5BA 4O10A 1VCFA 1P4CA 1CI1A 3W73A 1N55A 2ZQ0A 3W6YA 1TQXA 4O18A 4BI6A 3TSBA 4AMAA 3ATYA 1KM6A 2NXHA 2V2HA 1FCUA 5DCBA 5D37A 1RPXA 3O16A 1LBFA 4IX2A 3HOJA 5I3GA 4JS3A 3S1XA 4ORMA 4ZQMA 2V8ZA 4O12A 5ABTA 1WBHA 2I1OA 3B8DA 4RX0A 4TIMA 3P62A 4FNTA 3W1TA 4NJIA 3PB2A 5K3VA 4JGDA 3C2EA 4K39A 4MZYA 4TX9A 2DJLA 3STCA 1Q6RA 5IBXA 2R94A 4O16A 2JGYA 4N6EA 3RFAA 5FEPA 5DBUA 2QUTA 3UD6A 3LRKA 4CNOA 5LNVA 1FUYA 5I3FA 4FXSA 1BWKA 2FQIA 2UV8G 5I3IA 5AC8A 4LU0A 3DU0A 3UQNA 5T26A 5K4XA 3IIXA 4O1BA 3CLMA 1ZNNA 3GAYA 4UTKA 1LRQA 5CPMA 2JK2A 2QJHA 3LCLA 3NOEA 3W1RA 2WSQA 3F03K 4JR5A 4BI7A 3RMJA 5L9FA 4NJJA 1OYCA 1VLWA 3M43A 3UY7A 1ZHAA 3KFTA 4UMAA 3NQ8A 3O1NA 2VENA 2AQWA 1OFAA 2O7QA 3HG2A 3B05A 1KFLA 1G4TA 1PE1A 2Q3RA 4M6QA 3SJ3A 3W7DA 1W5QA 3TU9A 3LXBA 1FDZA 1SSDA 6ALDA 2BTMA 3Q58A 4DELA 3KVJA 1UJPA 2VFFA 5G4EA 1D3HA 2J6XA 3IIPA 3MBFA 3S8HA 1M6JA 3QW4B 4O1DA 3A24A 2CLMA 1VYSX 4QISA 3THAA 1Z44A 1QDSA 3UWQA 2ISVA 3HPSA 3MUXA 4LW7A 3KHJA 3PWAA 1A5SA 1WOBA 1ICSA 3V75A 4GWEA 3HO8A 1TPWA 4Y96A 1LTDA 2ZRVA 1QAPA 2QCDA 4X9SA 4AH7A 1LBLA 4O52A 1U5JA 4DO5A 2X1RA 3FKRA 3TQ0A 2GQ8A 3CTLA 1F6PA 3NVTA 1VYRA 3NL5A 3S1VA 3QPYA 3LDVA 3LV6A 2B4GA 4DF1A 3MYOA 4WOZA 2C19A 2YPIA 4IPJA 3VNDA 2FIQA 1OX4B 3W7GA 1I4NA 2NUWA 2QCCA 1NSJA 1J5TA 1W5MA 5H91A 3HIJA 5TQLA 2X16A 4JTSA 1JCYA 1BTMA 1EIXA 2BLEA 4MYAA 4DO6A 1NF0A 1TQJA 2A85A 1ONRA 3R5EA 2NXGA 5DY3A 1YADA 1YLVA 4EOUA 1F73A 3DHDA 3N2MA 3P80A 1RR2A 3LCFA 5G4WA 3M5YA 3GK0A 4EWND 1EP1A 4KFOA 5LNRA 1H60A 3GVGA 3ABSA 3P5ZA 2NV2A 1HO4A 5K4ZA 3O6YX 4R53A 1RV8A 1PS9A 2C16A 1LOSA 4IUOA 3GDTA 5A8GA 2C15A 2CLIA 3GDKA 1IXOA 4BFAA 4UMCA 5FF0A 3PBUA 5LHFA 5DN1A 5G2WA 3E02A 3HB9A 1DHPA 2Y7EA 3KAOA 4AXKA 1EP3A 4JIPA 3W85A 3O15A 1GVRA 3ANYA 1F76A 2ZZ7A 1K7XA 1DQXA 3G1SA 1UCWA 3JS3A 2BX7A 2R8WA 4YCPA 4NZFA 4O13A 1QWGA 1QOQA 4UR7A 2PRLA 3DFQA 2Q3OA 4A22A 1RZMA 3T55A 5HWNA 1ALDA 4HHPA 1FCVA 2QKFA 2FB3A 3HBLA 2WNQA 5AYXA 4FEZA 3PS7A 5D2XA 3P8IA 1H63A 4CQ8A 4I7VA 3TMQA 1G4PA 4JTLA 4Q4KA 4NUWA 1Z42A 1XBYA 3C2RA 1F05A 2WNNA 2QCMA 4D2JA 2FPYA 1RQHA 2QF7A 3M0ZA 3M7WA 3TA6A 4O28A 5EYWA 5D38A 1XDMA 2E09A 3W1QA 1JVNA 3HGSA 3LTPA 3WFAA 2H8ZA 3LCHA 4NNBA 2CWNA 5DBTA 2ATSA 4I7UA 4QSHA 3UWZA 2EGZA 1QNVA 3LHYA 4EIVA 4IXXA 4KWWA 3G22A 3I6RA 4DPPA 4WOQA 3GDRA 1RVGA 3NM3A 4NX0A 4WXYA 1WQ5A 3LOTA 5H2ZA 3W2JA 1DQWA 1QPQA 3CWOX 1LOLA 2A0NA 4ZL1A 3R89A 3G8RA 4OV4A 1W5NA 3K30A 2E5BA 1FQ0A 4ZQCA 1XBVA 2Y7DA 3WJYA 1H5YA 2WO5A 1XM3A 3LM7A 3TXVA 2J9ZA 3G0XA 4M6PA 1R2TA 1Z41A 1P0NA 3ABRA 2FPTA 5D02A 2QJIA 4LUIA 2KZHA 3OA3A 3G8EA 1H1ZA 1KLZA
chains in the Genus database with same CATH superfamily
3RK8A 3QOMA 4HN8A 5F2GA 2IKHA 4HZ7A 4BCEA 4M81A 1XD0A 2CBJA 4KIEA 3ORWA 5AZ0A 1JGIA 4C7FA 4KW2A 1QI2A 3HPAA 3QHOA 4LGXA 5FSDC 4UC5A 2X1TA 1ZB5A 4K2SA 4FNQA 3TOPA 1XDJA 1EDQA 1FDYA 9XIAA 3CIXA 1XGEA 2XH7A 2Z1KA 3NQFA 1H7WA 3POCA 2GWNA 3QEZA 3MVTA 2W27A 1W54A 1TWIA 4NRSA 1OINA 1CEOA 3ZWSA 2TMDA 3GDMA 3RLHA 2XWDA 3FHQA 4GIRA 3ENLA 2GK1A 3BVJA 3N6QA 4P7OA 4NRRA 2HVMA 3IGXA 4ZO9A 1UPMB 1OFDA 1BSIA 5HULA 3WNOA 1BD0A 4PH6A 2NT0A 5LSMA 3P60A 5LIYX 1RALA 3ARWA 3VUSA 5DLCA 2W0UA 4C90A 4DJDC 8CGTA 2ZRUA 3A3WA 5D2TA 3PZMA 4B5XA 2AMGA 2OEKA 1M68A 1UR9A 2D0HA 3KM8A 3JUGA 3VOIA 1PO9A 2AMXA 3OODA 3ZLFA 3CNYA 2A5HA 4IX0A 3T0DA 1B54A 4GHRA 4LNCA 1O1ZA 3FJ6A 4DBEA 4M6UA 4NP7A 2YGYA 1YHTA 3A4WA 4ZOBA 3R13A 2PC8A 3O8AA 4PCSA 2GGJA 2NSXA 4YCOA 1FCQA 1JRCA 3PP7A 3SECA 2FZBA 4LAKA 4IPLA 1GEHA 3BAWA 4U5IA 2DVTA 2XM2A 1HUVA 3P0WA 3SFKA 2VGGA 3MB9A 3VD5A 3EEZA 1DIDA 3IVUA 4GQRA 1QNOA 5F1UA 1BGGA 4C6LA 2WCSA 4LAUA 3W7NA 4B9ZA 1FH7A 2VGBA 3L4VA 3ABXA 4TV6A 4OBRA 3UXAA 4H9VA 2QCLA 2VT0A 4O14A 3GR8A 1R3RA 3DFTA 4LUJA 1VEOA 1B3YA 1E1CB 2WCGA 5U4NA 5DXXA 4I5RA 1UZDA 3BICA 2BNJA 4MJZA 4LWWA 1CGVA 3PZNA 1TREA 1QW7A 4RW3A 3B0PA 2BP1A 2QNEA 3QJAA 2DZTA 1EGVA 3WQ6A 1FRBA 4WDUA 3LHTA 2Y62A 3G24A 1MXDA 1PKYA 4R5EA 5HJYA 3DENA 1KXTA 2ALDA 1HJUA 3G3MA 1M01A 3ELFA 2A6LA 5AVHA 3LN3A 4I6VA 4WJEA 5CC7A 4LB3A 1AW1A 3BSGA 3UXLA 4O8AA 4JL2A 4W7VA 1GTHA 4D6HA 1ZTVA 2ZRYA 3BCDA 2GL5A 3PJUA 1MXSA 4QG8A 4ML9A 4X2RA 3H2CA 3W7QA 3FNDA 2WQDA 3L5AA 4XZBA 1EZ2A 5EMKA 3TR2A 5I3DA 2ZWYA 2QDHA 1J0YA 2PDNA 4ICNA 4RXGA 3E0FA 5BMWA 2Z1XA 6XIAA 3CT2A 2BOFX 1W56A 2VEPA 3UETA 4FOUA 4FOJA 4RDYA 4HNNA 1Z8AA 1X1NA 3I3DA 3WUGA 1SM9A 5CCZA 1EOKA 5JBFA 2CETA 1DWAM 4UCFA 1AK5A 2QCEA 3LS9A 3N1AA 2AGKA 1KV5A 1QW9A 4G1KA 1OX6A 3OVGA 3W7MA 2OWXA 3WD4A 3N18A 5HINA 1K6WA 1ME9A 3S3GA 1UH2A 4NZJA 3VGFA 3Q45A 3BSHA 1LG1A 2WAGA 1J4EA 4DJFD 2FJKA 2EQDA 3C3UA 1SW0A 2OYKA 4N7QA 1V3JA 1AODA 2PWEA 2Y7FA 3W01A 1B5TA 4AAJA 2Y70A 3FN9A 4NZCA 3WIJA 1ADDA 4QR6A 3F7JA 3NQDA 4DBSA 1P6WA 3N6HA 1R3QA 1OG0A 3BGGA 4FS9A 3V5CA 1X8FA 3GS6A 4NT0A 4FO4A 1EP2A 3B9DA 4AD2A 2FH8A 2WHKA 2HQAA 3NYZA 3TSMA 4GZEA 1FWNA 2DP3A 2FTWA 3KCJA 4RZ6A 2IS7A 3PC0A 4IIDA 4IZGA 4U2YA 3UPMA 4GXPA 3NXLA 1RK6A 5I23A 2FTYA 2BMBA 2NLIA 5GVJA 2ZE0A 3PB0A 4AWSA 4PTXA 5I78A 4TU1A 3GKFA 4A3UA 5LNWA 4NZ1A 1JCTA 3I65A 5AC4A 2XG9A 3CTTA 1RY8A 1OHLA 2XN1A 2WXDM 3I4EA 3W1NA 1XXXA 1GWJA 2OWWA 1K6AA 2VHLA 3M46A 3WL0A 4ZODA 1LLZA 5AHNA 3WJWA 1G4EA 3W87A 3W1MA 1LM1A 3PJXA 4PN2A 4GI6A 1JCLA 1XSIA 2G50A 1MDRA 3U2CA 5D05A 5DCDA 1GEQA 3T0BA 3V1PA 4UTWA 4FIRA 2E5DA 3WY1A 1BYBA 4OUEA 3G1YA 3VX0A 3WQDA 3ZR4A 4K3ZA 2V3GA 3T07A 3R6IA 3DYPA 1GOWA 3IGSA 4IGHA 5T8GA 1OK6A 4HA4A 1IWPA 2F7FA 3GNDA 1POJA 3OO2A 3MUZ1 1O95A 4DI8A 5BRBA 1GQLA 1R9YA 3GHRA 3BLPX 4ZOCA 3CV2A 1IR1A 1M7JA 1RCQA 2GZXA 2GPTA 2O4QA 1DE6A 4JN6A 3R10A 3VC5A 3WQFA 4H01A 1SFJA 3UP8A 5EMUA 2VELA 3NO5A 2OEMA 5HUOA 3VDBA 2GVGA 4P8WA 3WJXA 1A5UA 1HJWA 3MP4A 4S39A 4Q8NA 3GU2A 3LG3A 1B90A 1NU5A 2PAJA 1LBMA 4DEFA 2V2CA 3BWWA 3UVAA 3I68A 4B92A 2DORA 1W3JA 1W1ZA 3EB3A 3ZS4A 3EDJA 3C2YA 1EDGA 4XQ6A 1PJ9A 1SR0A 3IV3A 1Q4NX 4PCTA 3VDAA 3P93A 5GJMA 1FY6A 1CXIA 1KRAC 3T2OA 3ECQA 3AI0A 1RH9A 2UY4A 3I7SA 1SMAA 2QCNA 3ZR5A 3EOSA 5E1QA 1ITCA 2P1FA 1F4HA 5HMFA 4JTEA 4RE3A 5KITA 3FXYA 3MDWA 3EMZA 3KBVA 4OIFA 1QI5A 1FWGC 4A8RA 4MFDA 4XAFA 1E1CA 1KR0A 1HNYA 4O1EA 1K7FA 2W4XA 5KMYA 2NQZA 3NZQA 3V16A 1KXHA 3ARUA 1ZBWA 3H55A 3LY0A 3VI2A 2Z2AA 4RPPA 2V38A 1IXNA 4CU8A 3GLCA 2YOCA 1WNOA 3PZQA 5AHMA 1R0MA 5TAOA 1RCXB 1O6IA 4J3VA 4LYRA 3NR0A 1Q2SA 5D8WA 3PNUA 1RBOB 3ARXA 2QJMA 4G8TA 1GOIA 3IACA 3K2GA 3TE9A 2RUSA 5FIPA 2GDQA 2J9YA 2O9OA 3L2LA 1NOFA 3WZ0E 3ALFA 2EPHA 1NEYA 3URBA 1WZKA 3DDMA 3NQCA 1GJPA 5A1AA 3SCRA 1S5TA 2BXZA 5A6LA 2ACUA 3OP2A 5C54A 4JKLA 4HKPA 2FMOA 5C9RA 3QFEA 3VA8A 2YW3A 2QDDA 4U4MA 2DZXA 1BVNP 2ZADA 2YCEA 5CGMA 3N9SA 2BZNA 2HISA 3AFBA 3M6DA 4DRSA 3NL3A 1F07A 5DXYA 4TVCA 7A3HA 1IT8A 1LOQA 3VKCA 2HE8A 1G69A 1ZQ5A 1MRQA 1ML1A 3VD9A 5ABFB 4XO7A 3N2XA 5AYIA 3QC3A 1UD2A 5A6TC 4Q8OA 4HCHA 1OD8A 1K02A 2XSBA 4XX6A 3GD6A 1Y7VA 2P88A 3NSNA 4ZE5A 3BJFA 3PF3A 2QGYA 1NFPA 1O1HA 4AIEA 4J2MA 2IKIA 2XFFA 4AYGA 3BAKA 4UTMA 1KA9F 3N14A 2H9AB 4AF0A 4MNMA 5CH9A 4JIIX 4UQEA 1XSKA 4FLSA 4H2HA 1KD0A 4Z1BA 1FWEC 3EX4A 1UA3A 2HWGA 2OT0A 4B91A 4R34A 4PMYA 4ZO8A 5E6YA 3L0KA 3W07A 3CGTA 3W0KA 5FSEC 1AH4A 1AA1B 3AXHA 1W9BM 2VDHA 3FAXA 2NW0A 1EGMA 3GFYA 2VMFA 4WJ8A 1XUUA 3HQ1A 3JZEA 2EG6A 2ZICA 3TW6A 4JNYA 3P2VA 3SN1A 3MVIA 4H9YA 3NZRA 2A3HA 1TWSA 1SJAA 1V79A 4UXDA 3QN3A 4ZTXA 3OHIA 4JAWA 1PCWA 1XLKA 4JKMA 4AHPA 2XISA 4IFKA 3M0YA 3WELA 3DX5A 3T08A 4NASA 2BSLA 3T8LA 2XFWA 2DZVA 2PDUA 3G6MA 1OZMA 4S3FA 2I57A 2ZXAA 3VKKA 3WQWA 2BODX 1PYMA 1BEUA 2Y63A 1F6KA 3A9IA 3VIHA 4CKQA 3A5VA 3S1UA 2OQYA 5AKQA 3G2GA 1HKKA 4UFLA 4LX4A 7REQA 3GG7A 3CBWA 1K77A 4HPNA 1JAEA 1VCVA 4MDOA 2H6RA 4FR6A 3VIGA 1KM4A 4I90A 1B4EA 2PUZA 2PLCA 3VNYA 1MEWA 2I5IA 2ACRA 1LUCA 2FGZA 2RFGA 3WQ8A 3NQGA 1QASA 1T40A 1O68A 5C2CA 3WLPA 1AMKA 4LC6A 2EJ1A 3WH6A 4YTSA 3M1ZA 3WQPA 2OB3A 2FB2A 1CPUA 4O1CA 1KV8A 4FB7A 5H8UA 3VFLA 2WJZA 2OOFA 1EYWA 1ZRQA 1EEPA 4NI3A 3HV9A 5F2MA 7TAAA 3DKLA 1NDYA 1VF8A 1K3UA 2CBIA 4YVPA 3CUGA 5IRPA 2VX4A 5KZEA 4MDPA 3N2CA 3WSUA 5D09A 3VXGA 1W32A 1I1XA 4RDZA 2WNZA 3AS3A 3H8AA 1I8JA 3C0QA 2FYMA 4DYEA 2ZUNA 1FA2A 2E8YA 1ZJAA 1CW2A 1Z6KA 3C56A 5H6HA 3W1PA 1PZ3A 4GBUA 3F4DA 1XRTA 1ITXA 4INFA 4I5UA 3DHPA 3U2EA 4WKHA 1P5BA 3L67A 4HVXA 4AF0B 3FVDA 3TP4A 4IUGA 4ZE4A 3P81A 1JZ6A 5AFDA 1Z3NA 3K4WA 4G7EA 5BYWA 2EEXA 5G4HC 5CBIA 3NZ1A 4D8AA 2YBUA 4X63A 1KFCA 3WH8A 3HJEA 2WK2A 3QMSA 1TG7A 2P76A 3W9ZA 2I9UA 4UFJA 1C7TA 4AUBA 1LLOA 3RU6A 5BROA 3DFNA 2HBVA 2A3BA 3AQUA 1XLLA 2XIBA 3TJ4A 1KO0A 1UUMA 2D20A 4B90A 2BHYA 2WZIA 4GI8A 4KEMA 3BK0A 3VOCA 4GJJA 1W1YA 4AEEA 1R8LA 3GNXA 4UQCA 2JQXA 3QHMA 4BQ4A 4HU8A 1FHDA 4WK9A 4NXSA 1NP2A 4PMOA 3TWAA 1X98A 4L64A 3EPNA 4RUBA 3WMLA 1EO5A 1XH1A 1BXCA 1U2YA 1QNPA 4CNNA 1FWIC 1UBPC 3NPUA 5ABFA 1E9LA 1FWTA 1R30A 4AVFA 3M0VA 5A8MA 3GVVA 4ML4A 2W6RA 4U28A 3N17A 1J0KA 3U5YA 3HA1A 3TC7A 4QAWA 3SRHA 1E51A 2MUCA 4KRZA 2OX1A 4L9ZA 1IZJA 1XW8A 2XTKA 1TTIA 4UTJA 4OU1A 1E6QM 3NM1A 1TRIA 4PRRA 3S42A 2QPSA 4GO8A 2Z1BA 1XIMA 1EC7A 4PUEA 3K5XA 2Q09A 4LAOA 4LANA 2ZFAA 1H7PA 4PUDA 2ZRXA 2CESA 4H8HA 2ZC1A 1V77A 2WANA 4FK9A 3TMLA 5I2UA 4KESA 2YYTA 4GO9A 5CZKA 2OSWA 4AISA 1IHIA 1BGAA 1BWVA 1E43A 4RNIA 3SADA 2D2OA 2GJXA 1QO5A 2B7NA 1MSSA 3RILA 4V2XA 4O0KA 1ME7A 3E5PA 4P8UA 3WMSA 3FGCA 1GQNA 2V2DA 3E0IA 4H7CA 3B9OA 4ZSUA 1OVDA 2X1SA 3AYSA 2B0MA 4P8XA 7CGTA 3QH2A 3MCMA 1SSGA 4DJDA 1XLHA 2YSWA 3IVSA 2G96A 4CQ9A 3MI2A 2QQ6A 1D3GA 3L4WA 4Q7NA 2E68A 3TYZA 4LS2A 3EWUA 1UWTA 3BJTA 3KDOA 2CWXA 1WX0A 4FNUA 3GG8A 3W75A 4Y7EA 5LXEA 1VCGA 2F2HA 3L4TA 1JUEA 1RJPA 2Q8ZA 4RXFA 3IJLA 1YBQB 1XYMA 3APTA 1JL8A 4IISA 1RK5A 4J5NA 1W0MA 3DFPA 4O4VA 4IJCA 2POTA 1BAGA 3HG3A 3MHUA 5AHFA 3IIZA 4K7VA 5E0KA 2A2IA 4ERAA 1WAUA 3RUBL 1Q6GA 4ATWA 4N6FA 1Y5VA 1WUFA 2C6QA 3S47A 4XTIA 1WPCA 4M3PA 5A6AA 1VS1A 4F2TA 3TKFA 2ODOA 4GXMA 3GFZA 3GNOA 1HF6A 1QI4A 4OWGA 3PBGA 1TWZA 3RPTA 1NDWA 1QBAA 5AC6A 4GYKA 3OB8A 3S9ZA 3H54A 3S9YA 5HJLA 2HPIA 1YTEA 3UR7A 3A3HA 2A1YA 4CN4A 3RCYA 1EJXC 2EPLX 4H04A 3U3HA 3VGGA 3R7MA 3SGZA 1TPFA 3EXTA 5B7YA 1FWHC 1HKVA 3MC5A 4ZQRA 8A3HA 4HSNA 3RDKA 1ZENA 4GK8A 4LAMA 2WV8A 4QQUA 1YPIA 3KHDA 1AH3A 2YDAA 3ABQA 4L9XA 4A21A 5A2CA 2PURA 4XUGA 4LVAA 4N9BA 3HGRA 1QVBA 4MY8A 2ISDA 2G4FA 3ABZA 4OTKA 2GGEA 3VUPA 5A8PA 4NYUA 4DZIA 1UP0A 1R5YA 3VNZA 2E8ZA 1UKSA 2I5GA 1YDYA 4Q8MA 4GH3A 3T42A 1KM1A 4MADA 3VNMA 1HL8A 3PSVA 2PCEA 2ACQA 1Q6DA 1RD6A 3TYDA 4UR8A 4CQCA 2TODA 1PVNA 4FLRA 4HA0A 3WQ4A 1SU5A 4MNKA 3KOZA 1EPVA 2REQB 3TYAA 3E2SA 1UQZA 2YLLA 4XBKA 5D9MA 2O0TA 3IARA 4JN7A 4KEZA 4CCCA 3FA5A 3TQVA 3AJXA 2OTDA 2QCFA 4A05A 1AVAA 1OWQA 4LVDA 1PEZA 1OIMA 4X0VA 4CVUA 1XIGA 3EZ4A 2JFEX 4I9AA 1KFJA 1FDJA 2VKZG 3H23A 1TZ9A 3CLWA 1ZL1A 3WEMA 2VC5A 5HMEA 1EF2A 1XCFA 4XV0A 3DG7A 3AYVA 3PZVA 3D0CA 3A4AA 5BXRA 2QMJA 3APGA 3VMOA 2VZUA 1YE4A 3XIMA 4Z1AA 3CEUA 5KZMA 1XIBA 4WCJA 4CD5A 4XG1A 2BWGA 1XS2A 2ZXBA 1VYPX 4JY8A 1WP6A 2R1KA 1J8VA 2X0SA 4C1LA 5C9UA 2NQ9A 1AW5A 2ZBTA 3I7RA 3S6TA 2CLLA 3HFTA 4MUPA 3WDIA 3SDOA 4TMBA 4YLWA 3NDYA 1FBAA 4JYEA 1L6FA 2J7EA 3GH7A 4GJIA 4C91A 4MB1A 3W7RA 4S3GA 5C0QA 2CLOA 3L68A 1KBJA 3UWUA 1QHZA 1IEWA 2E28A 4S3DA 2G3FA 1C91A 4GYPA 3THQA 3K13A 1ZBVA 3E96A 3PBVA 2OSXA 4TR9A 4JQ1A 1EJRC 1I2OA 4FHAA 1QPOA 3AICA 5AB3A 9XIMA 4H9ZA 2ZRWA 4O0ZA 4DF2A 1GVSA 1JXJA 4MMWA 1A53A 3LEPA 1QBBA 3BZGA 2HXTA 3GX9A 4IGSA 1XPYA 1IIHA 3OZMA 4IIEA 4PFHA 1IQ8A 4DB7A 1TV2A 1V3IA 1F9CA 3IJQA 2EG7A 3M0XA 3MA8A 1R38A 3GYEA 4TX8A 5JMUA 4IL2A 4UUIA 5F4XA 2P8BA 1Z9AA 4R9OA 1M41A 3LENA 1CXEA 3TSBA 1J0ZA 2NXHA 4AZIA 1PXGA 5HNNA 5LA2A 2ZUSA 3DEQA 3QKEA 3S1XA 3AYTA 1JZ2A 4ZQMA 3W26A 2V8ZA 4O12A 1W1VA 4A8LA 2I1OA 4RX0A 4TIMA 4ZA0A 4EE9A 4FNTA 2VWSA 3W1TA 5A6JA 5E09A 3SQMA 4C6QA 4K39A 3FGCB 1TVLA 4MZYA 4TX9A 2DJLA 1HKWA 4WIWA 4M80A 3RFAA 3UD6A 4MTVA 3W25A 1AJ0A 5I3FA 1BWKA 2FQIA 2NT1A 2UV8G 4LF1A 3RPDA 4JN8A 4ZB5A 3RN6A 3OZYA 4AZHA 3VM5A 1HKJA 4HBKA 3VKDA 1AD4A 1ZNNA 2BVYA 4UTKA 4GQ0A 3GR4A 2JK2A 1A0DA 1CXHA 4CD8A 3W1RA 4EXQA 3CZEA 5L9FA 3B4YA 4NJJA 3KZSA 3H12A 3KFTA 5TD4A 3NQ8A 1I9CB 3HG2A 1PZ2A 3B05A 3B8IA 4HZMA 1PE1A 5PTDA 3IANA 1FDZA 1VJZA 4DELA 4EACA 4MNLA 1D3HA 3PAOA 3DESA 1B3VA 1OIFA 1JPDX 3QW4B 4UB9A 1E4LA 4O1DA 4BQ2A 1GJUA 2CC0A 3UWQA 4OZOA 3M64A 4GGBA 5C9XA 2D2JA 4LY4A 2X7VA 3KTSA 1S2TA 3K8KA 4AH7A 1LBLA 4F79A 1XF0A 4WSJA 3TQ0A 5HA7A 1J12A 3CTLA 1U30A 1F6PA 3N2TA 2C0HA 5D9NA 3V18A 4HK5A 5A6BD 3B8WA 3NL5A 1XGDA 1S39A 3RIKA 1T6MA 2FIQA 4WDXA 3TW9A 4HOWA 1R7OA 3MDUA 4QHRA 2XINA 2OQLA 2DT1A 1ZUAX 1W5MA 4LALA 1JGMA 3H70A 1QNQA 1DJYA 3S2CA 4MYAA 4DO6A 1NF0A 5BXSA 2A85A 1PIGA 3UJ2A 2NXGA 1MW2A 2HZGA 1YLVA 2WBGA 3KOYA 3GK0A 1W9DM 2BHZA 4KFOA 4D6EA 5LNRA 3MKKA 3GUWA 3P5ZA 2VZSA 4NSBA 1V3LA 4GY0A 4PMDA 1LOSA 3KRBA 2CLIA 3E0LA 1IXOA 3PBUA 5LHFA 1MW1A 2PTZA 4Y8EA 3CZLA 4GCXA 1EP3A 3T0CA 3A13A 3O15A 1PKMA 5XIMA 4C6DA 4GI4A 1KQYA 1K7XA 1UCWA 4YCPA 4P7QA 1HP5A 1E4IA 3GWQA 3DFQA 3B3DA 2Q3OA 5HWNA 4KS0A 3VIFA 4NZ4A 1ALDA 4HHPA 4US6A 4D6FA 1MUMA 5AYBA 4F9DA 4GH1A 3REQB 3P8IA 4L4PA 4Z2JA 1H63A 1JEZA 4JTLA 4Q4KA 1LUCB 3KLLA 2PMQA 1UD6A 4XZHA 3NSMA 2WWDA 1RY0A 4HSHA 3AXKA 4D2JA 3WF0A 1RQHA 1K70A 4HYRA 4IT1A 1GOOA 5CPSA 5D38A 3URAA 1E6SM 1JVNA 2WWCA 2VO5A 3RJYA 1QI0A 4NNBA 5DBTA 1GUVA 3QY8A 1E6ZA 4AU0A 1A4LA 1J0JA 3WDJA 1C92A 3ITLA 2QUNA 4J3SA 4WOQA 3BQ5A 3NM3A 4NX0A 3LOTA 5H2ZA 4HU0A 1OEPA 4OV4A 1W5NA 4DUWA 1FQ0A 1CGWA 2WKGA 1ENUA 2XU2A 3V7PA 5H8PA 3WJYA 5I77A 4J3ZA 3EOEA 3LM7A 3VMNA 1GOQA 2J9ZA 1TZZA 5FJRA 3E5BA 1P0NA 3POHA 1UH3A 1CXLA 2QJIA 1UROA 4LUIA 3G8EA 4HPHA 5KZDA 4GX9A 4IMEA 1UBSA 1VEPA 5LA0A 3AIUA 1QHOA 2C3ZA 5ABHA 1M65A 2ZWZA 4GZIA 2E0PA 4WX2A 2YCLA 3TROA 4OGZA 3O0FA 1HKMA 3WBWA 5D03A 5HPCA 3SW6A 3ES7A 1S5NA 5EBAA 3UJSA 2PE4A 4RKAA 2OG9A 1TE1A 2O9PA 5LIKX 4JTDA 3W72A 4QROA 3PWGA 3LGEA 5F2LA 2YL5A 1QNSA 4EAMA 3GH4A 3WLRA 4GJ1A 4JTHA 3NDOA 1QFEA 5HJXA 2NQ5A 4E2DA 4QEHA 4BWLA 1O60A 1TJ1A 2WC7A 2VCCA 4GFIA 1B9ZA 3Q37A 3WD0A 3CPUA 2V0TA 4NI8A 4RR4A 3S5SA 3ZVHA 3PY2A 2R24A 1XIFA 3PPGA 3C2VA 4ONVA 4XK2A 3TWBA 1POKA 3UESA 4MGGA 1J2WA 4QJ4B 1GQKA 2HK0A 3VGDA 7XIMA 2BHUA 1W3TA 4JQ4A 4JKKA 3NNTA 1Q65A 3BC9A 4JXCA 3COTA 3J7HA 1FWFC 5DMLA 2XWEA 1QMLA 5JVLA 1OFOA 1A5CA 3BMVA 3AU6A 2ZUMA 4DBDA 1G6CA 4MF4A 1X96A 4NAEB 1K4HA 3DC8A 1QK2A 1YTKA 2BS9A 5J04A 3M0KA 3W7KA 3W1AA 1L8PA 4FXRA 2J8FA 3C8FA 4F0MA 1K03A 1BQGA 4PB5A 4D6CA 2YCJA 1C29A 2JKAA 4KWUA 1L0PA 2WB5A 4LQ1A 3SAZA 5CPQA 3TAOA 1Y0EA 2B7PA 2HTMA 1WKEA 3CV1A 2OKOA 1AL8A 1GT8A 4E6MA 5C55A 1R3TA 4ERIA 2WVVA 1WKYA 2PU1A 4K8EA 3WLTA 2DIEA 5T91A 4AHQA 1HQTA 4B4HA 3K8MA 3ME3A 2YR1A 3WKZA 1QATA 3BV7A 1UP3A 1J5SA 2Y8VA 4OECA 1YNYA 3H4XA 3ARSA 1DVJA 1P0BA 3UBPC 4DNMA 3MCOA 2WMHA 2YX0A 3FAWA 1XYAA 4CCZA 2J7HA 4IGMA 4RDVA 2X2GA 2E6FA 4W7WA 4N2YA 3GXPA 2CZFA 3TEVA 2QUVA 4HNCA 1W3KA 1X6UA 1UC4A 1A49A 1GKPA 1O94A 2IKGA 1L6YA 5D2WA 5HMSA 4LAZA 1EJWC 1R87A 1S46A 3A22A 5EB8A 1L2UA 1ZZMA 4ZQNA 1SW7A 4A3QA 5BU6A 1LORA 1XIHA 1MUWA 5BOFA 2XIMA 3EB2A 1C3FA 3GB6A 3TXZA 3RO6A 2J7FA 3OG3A 2GJXB 1SO5A 4FAMA 1VBHA 2P10A 3LSBA 3LPGA 1N2VA 2PGFA 5D30A 3BW4A 4H7VA 3A23A 1KCKA 2IW0A 4R88A 4ZQPA 1RD5A 1OM0A 2TSYA 5HR7A 3ZT7A 5GJPA 5BU9A 3RHGA 2PA6A 1UWIA 4M1BA 3QTGA 4PB3A 1TV7A 3HGOA 1FWJC 3NL6A 1ODUA 1BYAA 1T41A 1VR6A 3NO3A 4W7UA 3TLLA 1CLVA 3CL6A 1EJTC 5A8NA 4DXXA 3OZPA 1W37A 2DZBA 3VIIA 3N3TA 3WUFA 1JDFA 4MKNA 3E0VA 3NXFA 3QR0A 2ZX6A 3CYJA 4DHGA 1G7VA 3U4FA 4H2CA 1NF7A 4A29A 3MUY1 3CZKA 3UYIA 3NAVA 2GJRA 1VFTA 3STEA 1K9DA 4HPJA 4LS0A 1R2RA 1JFXA 5J5DA 3GSMA 3ZT5A 5B7ZA 3BGAA 6CGTA 4A6GA 4QLLA 3OYZA 4Z1DA 3EWCA 3LBCA 5DFAA 4HJWA 5A3HA 4RNFA 3N15A 4DN1A 4A8NA 3TN4A 2ZC8A 3PG9A 4MZ8A 3N12A 1TUFA 9CGTA 3L4XA 2ZUUA 9RUBA 2OFJA 4LYPA 4MY9A 3SB0A 5BWAA 3FV9A 3MMUA 4JYDA 4QX4A 7TIMA 3DHUA 1Q5MA 3KCOA 4JFTA 3B8TA 3WQOA 4Q8UA 3LGGA 3BJSA 4B2DA 4DIAA 1V0KA 4R3UA 2W66A 4ECLA 2QAFA 2QR6A 3MCNA 4FX8A 1V7YA 2WJDA 3F5JA 1FXPA 1LJYA 3TNOA 2F6XA 2X0YA 3UW6A 1E3ZA 1WOAA 4X60A 5CLWA 1JZ5A 1D9EA 2R91A 5KTLA 4UFKA 1MNZA 4BY3A 3SZ8A 1X97A 2WVUA 4LVBA 3F2CA 1CBGA 1GJWA 4DAFA 4CQAA 1KTCA 2ZZ4A 1BF2A 4M82A 3CAQA 5D33A 3DGRA 3P3BA 4RL3A 4IIGA 3TONA 1XINA 1GZJA 3UNTA 3C0JA 3SUSA 2HVNA 1AG1O 2X2YA 3B8VA 1N8FA 2YZRA 4CUCA 2FH6A 3KLKA 1DJNA 2XUCA 4FXJA 3W2MA 3GBDA 1LP6A 1CDGA 1DP0A 4U3AA 3MTWA 4W9TA 4BJHA 2BY0A 2VC9A 3TFXA 2NWSA 4NL1A 1V3HA 1EHNA 4UOZA 1E1FA 4PUNA 5HNRA 3UZWA 3NUKA 1EB3A 2VCAA 5CGQA 4GI9A 1DTUA 4N9DA 4GUJA 2PDGA 3PZGA 4LTSA 2O4MA 3EWWA 3NQBA 2IQTA 1JCXA 2EKCA 1W2PA 1X8CA 1RJQA 4XTDA 3R0UA 2GQAA 3VU2A 5C70A 3CXOA 1TVPA 1OFEA 2J4GA 3KWXA 1TPVA 3T2QA 3LI1A 1KW1A 1Q6FA 3UT0A 1H41A 1UR0A 5H8MA 2D69A 4PMVA 4LUYA 1MFVA 2H8XA 4C6CA 1HJXA 4UOJA 1G5AA 2G97A 1OF8A 1F3TA 1I2PA 4GXWA 4M5PA 3M6YA 3AIBA 2WMIA 1B1YA 2WC4A 1F7BA 1P0EA 3C6CA 2WJFA 4YN5A 3O6AA 3KVMA 1VPQA 1TRDA 3C2OA 2Z1SA 1EX1A 3IRSA 4QE4A 4NIRA 4NG3A 1ZCOA 1J9YA 1EOMA 4AD0A 2RHGA 3VMPA 2LLEA 1A50A 2V3FA 2ZTJA 3AHYA 2ZDSA 2CKSA 3LTSA 1FWWA 1PB0A 3L4ZA 1MUCA 3S1GA 4YPJA 3KCLA 3EKZA 3DFSA 3EDEA 3LGDA 2GSHA 1PV8A 4JICA 4E3VA 2VFDA 1US3A 1SGJA 4AD5A 4O50A 4NKCA 4HHLA 2VURA 5ECUA 1SPQA 1EBGA 1TR1A 1SZNA 4PSRA 4XZ9A 1K9FA 2OWCA 4O19A 3S5NA 1F3WA 3NJ3A 3G1VA 3RX2A 3AO0A 3PUGA 2FGLA 3VCCA 3UG5A 4LUSA 3QZEA 5IDIA 2ZYFA 2ICSA 3SI9A 2JGQA 4P7NA 4AX6A 3OIXA 3STPA 1B31A 4MLRA 2WNWA 4HMDA 3EBVA 3LK6A 4DUXA 1FH9A 5EMJA 4NILA 1VLIA 3VNJA 2NUYA 3DCPA 1M9HA 1PUDA 1ZALA 3NL2A 1UG6A 3N4AA 1K9EA 1OGSA 1H1NA 3ZJKA 4V1YA 3W22A 3LM3A 4S3JA 1F5ZA 1EUAA 1C93A 3SQLA 5JBDA 3WG6A 3OGSA 3UWEA 3BTNA 5AC7A 3V1HA 4I6KA 3R43A 2DW6A 3AWNA 3CZ8A 3NVDA 4X2PA 3WF3A 4S3EA 3HN3A 1XYFA 1PHWA 3GXDA 2QAPA 2ACSA 1BXBA 1LF1A 3UPWA 2ISFA 2PGWA 1TTPA 3ITGA 4JX6A 4LUSB 1KCZA 4ZCWA 2F9RA 2ON3A 1YRRA 4POCA 2RDWA 4BWLC 1PBGA 3G1DA 1WV2A 3IJ7A 3BZJA 3LERA 3SR7A 3GRIA 3GTIA 1P43A 4ATLA 5FKYA 3R12A 3T78A 1VGAA 1SYTA 1FP8A 1QHPA 1E40A 2I17A 4O57A 1XKJA 1KTBA 2CZDA 1B3ZA 1PYFA 4UIOA 1B0IA 1C9WA 1I2RA 3HG4A 4JZ5A 1I45A 1PL9A 4JQ3A 3S6DA 3VNIA 1UD4A 1YQ2A 3NG3A 2GVJA 4PMNA 3RITA 3LXCA 1PZ1A 3SCPA 4ACZA 3IWPA 1WBJA 2QZRA 2QXWA 1N82A 1DPMA 2CZ5A 3IRDA 3CMFA 3UU0A 1UZ1A 4HQVA 1C8QA 1NDVA 5KEZA 1NY1A 3NWRA 5I79A 2QMKA 4Z0JA 4GUIA 5DT5A 1YX1A 3P84A 1G9HA 3TZNA 4K7YA 4DI9A 4E8CA 3D46A 3BOLA 1B4KA 1PHQA 4L1WA 1E55A 1KWGA 3ZXWA 3GHUA 3LQGA 4QTGA 2V5LA 1PX8A 5LNSA 3NSXA 3W00A 4DXVA 4NU7A 2YCIX 3UCQA 5HQEA 2WZMA 3OG2A 1EZWA 3CB3A 3WFLA 5REQA 4MOZA 4URIA 3BCJA 3TK7A 4MYXA 4REQB 2PD5A 2TAAA 4JHZA 2HSAA 4DPQA 3T40A 3L0GA 1IZKA 4B3ZA 3PG8A 3VTRA 3MI3A 7REQB 4F0RA 4LEFA 2A6NA 2NX1A 2GJLA 5FJTA 1TV3A 3NPXA 4RW5A 2VX6A 2Q8LA 3NQMA 4YL2A 3BAJA 5I5RA 4IXHA 3LSCA 4CGTA 4IGNA 3A47A 3GZAA 2G41A 2J27A 4HA3A 3DI1A 2QS8A 2QJNA 3GTXA 3WDRA 2P0OA 3DXIA 3NPVA 1JCNA 1UR2A 4UZSA 3LU2A 4Q4SA 4ZZ9A 2PDCA 5IBXC 4IFRA 3ARPA 4ORIA 1DE5A 4K8GA 4MPKA 1JRBA 1BHGA 1ZCCA 1P0KA 3Q65A 4EANA 3PJTA 4GE8A 5CZSA 3L65A 3B0XA 4DBUA 4LBSA 1JUBA 1VC4A 3A64A 4KFNA 1O5RA 3ZFHA 3CL7A 3SFWA 2EJAA 2V9DA 1ITQA 4L5ZA 2PWDA 4Q7BA 4EVZA 3AUOA 4K36A 1V08A 2VL4A 1C8VA 1LQ0A 4PC8A 3OJGA 3E0WA 3LPPA 3S83A 2WCAA 3WK0A 3L7RA 4YYCA 2I56A 3VOGA 1GQIA 4MHBA 3BAIA 3MP5A 1AQHA 3IK2A 3V3WA 1TUXA 1JULA 3MP3A 4QIUA 1DQUA 1O4UA 5FI8A 3FDKA 4G2DA 1N8IA 1CLKA 3BW2A 5K9XA 2OZ0A 3N2OA 3TX9A 3FLUA 1YIXA 2OXNA 4CU7A 2A3LA 2WM1A 2GGHA 3AIEA 3G1AA 4MJ2A 1V6TA 2H90A 1KFEA 1DJIA 3DAQA 3TFCA 1FCBA 4JYFA 1HXJA 4Z2GA 5MKGB 4WY0A 1PKLA 2PDMA 3FEMA 3H2FA 3WLIA 1BFNA 2VX5A 4PUWA 1GZGA 3WUEA 2XJ7A 4MLJA 3QTPA 2Z6JA 3MJMA 1LQAA 1H7OA 4Y8FA 3WNMA 4KBXA 3PULA 3GTHA 2A7PA 5F1VA 5GNXA 1ISWA 1LDCA 4DNHA 3BQ6A 1GKQA 3R25A 2I9EA 4O1FA 3VPLA 2DEPA 4I8DA 3MMTA 2CCRA 2G0WA 4GRSA 4ADTA 4Y9AA 3VE9A 1IZCA 1QPNA 4UTHA 2PDBA 3RMEA 2Q6ZA 3R0DA 4IJRA 3BSMA 5E6ZA 1M7PA 4HTYA 4K1GA 4IQEA 2AQOA 5G1TA 1IGSA 1QK0A 4CCDA 3EOUA 5HXMA 1JYXA 3MSGA 4J27A 1D3CA 3BLFA 5CZTA 1OC5A 5I3HA 3GHSA 3MUIA 8RUCA 1I2QA 4ZXOA 3SRFA 2PDQA 3H4GA 5I0DA 1E5NA 4TO8A 5IFPA 1VRDA 1IYXA 3SIZA 1AH0A 2OCZA 1XRVA 4KQNA 5HWJA 3WBEA 3H7VA 7ENLA 5FACA 3VM7A 5HUPA 1WKFA 4KCVA 3W88A 1R86A 3AHVA 4IIFA 4JIRA 1BKSA 5LKYA 3U4AA 1DV7A 3F4NA 1MEIA 2J66A 3E74A 3CUJA 1BYCA 2VGFA 5FF3A 5C7VA 4CQDA 1XBZA 3P67A 3MJYA 3LLXA 4NX5A 3N2BA 4IMGA 3HFYA 2I7GA 4XD3A 2DZUA 3BLLA 4G7FA 2UY2A 2VFHA 3IUHA 3MV11 3JZUA 1VB9A 3O9NA 1S5MA 5D9OA 4IPIA 2B31A 4PMXA 1W3IA 3BO9A 3EKGA 5ENLA 3TN6A 1L6WA 1XWYA 3NEHA 1XJBA 1NVMA 4QBXA 1GKRA 1YYAA 4TV5A 3R4IA 5CBBA 3G0SA 3CB8A 4LPCA 4Q8TA 4PMRA 5DELA 4O17A 3WDPP 1DEDA 5C8BB 1PTAA 1Y65A 1E0VA 1XD1A 3ZT6A 2BGNE 2DJXA 3OEXA 6TAAA 3IGHX 4W4QA 1SZEA 4XAYA 3CQKA 4L6OA 2KX9A 1F3XA 1W1A1 2CZEA 4AZCB 3DFOA 3AJ7A 1IEQA 4S1FA 3C4UA 3W2LA 1YXDA 3NQVA 4JTFA 2HNEA 1KXVA 2VM8A 2E67A 4PCPA 2OT1A 1AL7A 4AZGA 3UXDA 4KETA 4NVTA 1Q6LA 4GVFA 3W7IA 3W70A 4AEFA 1KGXA 1XR2A 5EBUA 1JDAA 3AIQA 5CC5A 4WZHA 1KBKA 2V69A 1CNVA 2J8TA 3V0SA 1FWSA 4DXKA 1KB3A 1GYMA 3EWZA 5A94A 4H9XA 4DYJA 4IG2B 2NQLA 1UR1A 1S38A 2ZZ5A 5A2BA 2DUXA 4JCMA 2ZZ6A 4XO6A 1LT8A 1X1ZA 4N0RA 3RLUA 1M03A 4NXKA 1OCNA 2FFCA 4GZJA 1Q3NA 3WLNA 4W88A 1RSCA 1VFLA 3ES8A 2XH0A 4MJMA 4O54A 3GTFA 3E3HA 3W71A 3GNRA 1VBJA 3O2LA 1K7EA 1XFBA 1CZ1A 2V5KA 3WK3A 1XIDA 3M41A 2VC7A 3QR3A 2JEQA 4J4KA 3FOKA 5EPDA 4GBDA 4O8RA 4UWMA 4W5UA 1D7FA 1TFVA 4Q7IA 1TJ0A 1TZ7A 5FF7A 4PRWA 4D8ZA 1AUSL 2PP0A 4DY1A 4MAZA 5FAJA 1O5QA 2FZ9A 2QIWA 5KSWA 3TYUA 4DJED 4GYPC 4F0LA 4GD0A 3BANA 3G1XA 4AY7A 3C52A 2QLYA 1YPXA 4KCUA 5CC6A 3UJRA 2B81A 2DUAA 2VEIA 5DO8A 3RYSA 2VJXA 3RLVA 2WKLA 4JFWA 3CQ0A 2G3IA 1E6RA 4P2VA 3OGRA 3VIKA 1XRSA 4HIBA 3SGUA 2CLKA 1OADA 1W5PA 1QI3A 3K8LA 4GUHA 1V03A 3QMRA 1LZOA 3WK2A 2XYLA 1TPC1 2VXNA 2VEGA 2WSRA 3EX2A 2FKPA 4PRTA 1DWIM 1NAL1 3LCGA 2Z6IA 4LBRA 2ABBA 3P8JA 1ISVA 3SBFA 1GNXA 3W83A 3NQ2A 4D8LA 1ZY9A 1ISXA 3N73A 3BL3A 4U5KA 1EH9A 2C91A 1TJPA 5A8OA 5CAHA 4QG9A 1A5OC 1BPLB 3ZYZA 1AMYA 3F4VA 1EX5A 6TIMA 3L66A 4J9JA 3ZWTA 4F3HA 1KFWA 4TUFA 2A3EA 2PWFA 2J8GA 1RP9A 4ZMGA 2PTWA 2RDUA 3L5MA 3SRDA 4JTCA 2A7NA 4W8AA 3MSRA 2AKMA 5HK4A 3VE7A 4OQVA 4YWSA 1EXBA 2HROA 1ONWA 2VOTA 3GVWA 4HNLA 2TPSA 1LYXA 3FX4A 2DW7A 1I6NA 1JDDA 1F74A 3UA3A 1WXJA 1ODZA 1K8ZA 2WPBA 3OA5A 5CG7A 3SURA 1DWFM 3HJZA 3R58A 2PDFA 1BWLA 3M0LA 4V28A 3TCEA 3UNDA 1FWBC 1AQFA 4XKYA 1UC5A 3KBSA 5I07A 2YCKX 1JF5A 5K7JA 3TH6A 1HO1A 1MQQA 3FKKA 2D24A 1S2AA 2HV5A 1ZP4A 3LLFA 3W29A 1DXEA 3N13A 3KVLA 5HMDA 4FALA 3Q2DA 1JIBA 1EDTA 3GNPA 5AYZA 5EMYA 4M0XA 2YBVA 4ACYA 1SJBA 1VCFA 4FOKA 3W73A 4BEQA 3ID7A 4AW7A 4O18A 4BI6A 3ATYA 3W82A 5D37A 1G1YA 5XIAA 1XLDA 2OLHA 2L5HA 3O16A 4IX2A 1UPPA 4JS3A 2VVSA 2GSJA 4Y9MA 3N4FA 2XZ9A 3B8DA 4L1XA 4YS1A 4X0NA 1EBHA 4NJIA 4AY1A 3C2EA 4XBJA 4MKSA 4KWOA 5FOOA 1KNWA 5IBXA 1UKPA 1JFHA 4QLJA 1BF6A 4JIHA 4N6EA 4JBRA 5FEPA 2QUTA 3LRKA 1LWJA 4PYSA 2D0GA 4GCAA 4EPDC 5AC8A 4LU0A 3UQNA 1F4AA 2Z4GA 4KRTA 2E7FA 3QGKC 1GVEA 2Z29A 2OKTA 2HNHA 2HVOA 3CUIA 5CPMA 1MXGA 4XIMA 3QY7A 3R8GA 3LCLA 3NOEA 4J2PA 4JR5A 4EX4A 3VO0A 3MO4A 4PGLA 2ALRA 4UMAA 2DUZA 3H2MA 3KBWA 1BXNA 1RHCA 4GA8A 1G4TA 3EDDA 4M6QA 3SJ3A 3AHTA 4IQDA 3RRXA 3W7DA 3LXBA 4OUIA 3KDNA 3FSTA 6ALDA 3QHNA 2PFHA 2DY3A 3VVGA 2J6XA 3MBFA 3A4JA 2UY5A 4PBFA 4WRHA 5BCAA 3ANVA 2J25A 2OZ8A 3THAA 3B8UA 3C5QA 2O9RA 5H1WA 3UG3A 5M17A 1UR3M 3MUXA 4LW7A 3E6EA 2PEVA 1A5SA 1ICSA 2FZDA 3PPCA 3V4BA 3V75A 4YTRA 4GWEA 4HHMA 3VCNA 1H49A 1Q6EA 1LTDA 1QAPA 1HT6A 2QCDA 1WE5A 4O52A 4DO5A 1IEIA 4GY7A 2X1RA 2XIOA 2HCVA 1TVNA 3SN0A 2QPXA 2YL8A 5XINA 2B4GA 3T9PA 4HZ8A 1DIEA 4WOZA 4AWEA 3T09A 4IPJA 4MB4A 5TNVA 5JBEA 1OX4B 2D3NA 2QCCA 1NSJA 3TTSA 2DT2A 3HIJA 1AJ2A 3G77A 4W5ZA 5TQLA 2X16A 1VEMA 4JTSA 1EIXA 2BLEA 5C71A 4X61A 3WH5A 1TQJA 5DY3A 1HJSA 1F73A 3N2MA 3P80A 3QBUA 3OGVA 4DWSD 4C7DA 1EP1A 2QULA 1H60A 3UXKA 3GVGA 2NV2A 5K4ZA 4R53A 1XGZA 1IV8A 4LYQA 2QV4A 4UMCA 5FF0A 3I4KA 5G2WA 3CH9A 3BAXA 2Y7EA 2BVTA 4JIPA 3W85A 3AXXA 3AMKA 1XH2A 2BXYA 1M53A 1E9YB 2ZZ7A 3HPFA 1DQXA 1LL7A 2CITA 3BDKA 3JS3A 1VFHA 1QWGA 1K8CA 1ECEA 4FSAA 1QOQA 2PRLA 2XM1A 4A22A 1RZMA 4XZLX 1RA0A 2QKFA 3HBLA 3EA3A 3GO2A 5AYXA 2Z26A 2FVKA 4JEJA 4H6RA 4I7VA 4DM2A 2Y0FA 4A3YA 1G4PA 3PZIA 4NUWA 3WN6A 1Q66A 1XBYA 4AD4A 2R1NA 3C2RA 2F6UA 3T0AA 1F05A 3KP0A 5IHSA 2BVDA 2E9BA 4E8DA 4QDWA 3K1GA 1PX4A 2FPYA 2QF7A 2XDFA 3WL1A 1CB2A 4JTAA 3M0ZA 3M7WA 4O28A 1XDMA 3W1QA 2QF8A 3WFAA 2JALA 2ATSA 5FL0A 4QSHA 3UWZA 3LHYA 4IXXA 4PCNA 4AVOA 3G22A 3I6RA 1JDCA 2JIEA 4A35A 1GVYA 1RVGA 4ERGA 2PDIA 1KRBC 4WXYA 2PTDA 2INFA 1HVQA 2WM0A 3R89A 1M7XA 4TXEA 3S46A 2GQ3A 1XBVA 2PZNA 2PDPA 4AXNA 3LQLA 3TXVA 1RCOB 4M6PA 1R2TA 1Z41A 3IJ6A 2FZMA 4GQQA 1KRCC 2KZHA 3OHMB 4B5TA 2AQVA 4A2SA 1CECA 1XRFA 2YW4A 3TDFA 3UCDA 4UFIA 1KFKA 4NQ1A 5D8ZA 4WHBA 2NWRA 1NM9A 1QR7A 1VFUA 5MF5A 2PLJA 3TN5A 4S3AA 3UZYA 5I6SA 3AUJA 5AHEA 4C1NA 3ARQA 1R46A 3ZLHA 4V27A 5FJUA 2WQPA 4UQ9A 4ZO6A 2Z2UA 4ACZB 2QW5A 2VC6A 5LGXA 1RAKA 2Z1VA 3GDBA 1FWCC 3QOKA 3MI6A 4LRSA 1OY0A 5DMYA 3MQTA 1R9ZA 2YDQA 1QOXA 3QSTA 4D1IA 1XFCA 1ICPA 4HPGA 4AYSA 3B4UA 1S2VA 4IIBA 3BE7A 4WUIA 3U2OA 4MG4A 3GAKA 4QAIA 3LCIA 2Q02A 2OLSA 2WMGA 2VRQA 3CIVA 1W8SA 2DV0A 2UY3A 1SQ7A 2PLMA 3AZRA 4LRTA 4OV9A 1GCYA 2FGBA 5K9DA 2NVCA 1EIBA 3MUAA 4RK8A 4YWIA 3GU1A 5E93A 2A21A 2RJHA 1OF6A 2ZA1A 3P5YA 5EMLA 4TTGA 2NV9A 2QGHA 4Z2HA 4Q4OA 2YA2A 4R7WA 1JF6A 3E2VA 3EPMA 5FEZA 3GW3A 4V1XA 3KRSA 5BXPA 1UD8A 3TTYA 4L4OA 3KTXA 1S2WA 4JX4A 1T0OA 2POZA 3O07A 3QYSA 4XISA 4K37A 5FA5A 4ZEPA 2OR2A 4KGJA 3T7VA 3RM9A 5HWMA 1CWYA 3AIWA 1OYBA 3ALGA 3VIPA 4R27A 5FESA 2HS6A 4B2DD 2HRWA 1TB3A 2DH2A 1NWTA 4EF8A 1EYEA 3U5UA 3MO7A 4MVAA 2YYUA 1J18A 3H7RA 3U7VA 4Y6GA 5CPTA 2YDRA 3RM8A 2EAWA 3HTWA 5LIWX 3U8GA 5CSSA 3IJ9A 3C0LA 3GKAA 1EQCA 4BF9A 1V0LA 5FAGA 1XI3A 3KXQA 4XAPA 2X1IA 3EA1A 1A3HA 3JVAA 2VWTA 3IS4A 3GW0A 2ZKMX 4FXFA 3MU7A 3W1XA 4JIEA 3XINA 5T9BG 3OLEA 3RG6A 2QDGA 1X38A 5CXPA 4CD4A 3VGHA 3D5HA 1DJHA 2HPMA 2YL9A 3HG5A 1B3OA 4GUGA 2DZWA 1O5KA 1EJSC 4NZ3A 2J75A 2EXOA 3CS2A 3NFUA 2RDTA 3EA2A 2YXGA 2QHAA 4ZB2A 1H5VA 3W7EA 2E9LA 3KOWA 4L4MA 2Z1WA 3MHFA 3FHAA 4G5DA 1TJRA 4K8HA 2F61A 4Q4QA 3BOFA 5BOEA 3WQVA 4UQDA 3ZZ1A 1UWSA 1WA3A 1IE7C 3LD5A 5CAKA 1HJVA 3N29A 3F5LA 1L6GA 4X9YA 4LVGA 3RGTA 5J8LA 4F9JA 4DJFA 1CGUA 2XSAA 1Q63A 4BKNA 3TV8A 2ZA3A 1OFQA 8TIMA 3UZXA 5I00A 2VQUA 1ZFJA 1Q8AA 2Y88A 3QYQA 5C5YA 3OLGA 4CD7A 2PDJA 4AMCA 1B2YA 3EEGA 5IFTA 1R2SA 2YB4A 5HDRA 1W91A 4PMZA 5DQPA 1NARA 1EXPA 3MMDA 5G2IA 4Y90A 1RQEA 4QCEA 3AZSA 5REQB 1G94A 1C90A 2H3BA 2HMCA 4AWTA 2FVMA 2FHFA 4MPQA 4U33A 4MNJA 4RCXA 4W8LA 5AHLA 1DXFA 3TJIA 6PTDA 4C60A 1TV8A 1KR1A 5ABGA 4C6BA 2BVWA 2C1GA 3IAPA 4FNPA 2VGIA 4C5ZA 1DWJM 2DZAA 4B4FA 2OLAA 2W91A 1OG6A 1PX3A 3C2FA 2WC3A 2PGEA 1PAMA 3H4WA 3TC6A 1N7KA 2PRMA 3UG4A 3R8RA 4IWWA 4JTJA 1Z69A 4ZFMA 2E1DA 4HNTA 4H8VA 1TX0A 3T1GA 3C3NA 4IMAA 2E77A 3HPXA 4XUYA 4XD5A 3LZ5A 3N4EA 1T8XA 4L4LA 2ZX9A 2XPKA 4UTTA 4MIMA 1XV8A 1US0A 1QOPA 3CT7A 2GFTA 1XHGA 2NX3A 2WZHA 1XLFA 3B8SA 3WLLA 4Q6XA 2V3EA 2RAGA 1CYGA 1US2A 3II1A 3NQ7A 5I09A 1JG9A 1A3WA 1J6OA 2XHYA 5I3KA 1Q7MA 3DI0A 2QYGA 2DFAA 4LSBA 1V6WA 3GIPA 1MYRA 2DSZA 3NGJA 4C6FA 3W28A 2VFGA 3SUUA 4WJXA 1J0HA 2VFIA 4PZVA 3B9EA 3BLKA 4ADSA 1GK8A 4AZ6A 2XVGA 3ZMRA 1V5XA 1P0DA 2AAAA 3CMJA 2AL1A 1HL9A 1Q7ZA 4GIYA 4D6DA 2V81A 3EWYA 1R85A 3UZJA 3LTYA 2O92A 4QQ3A 1KTNA 2OX4A 2BY3A 1W1B1 1VHNA 1JYWA 3VGEA 3I10A 4C6OA 4PTMA 1WDRA 2J13A 3IJIA 2YFOA 3BPWA 4KMQA 3O63A 5D9PA 1E72M 1W5OA 1UB3A 4HK7A 4JFVA 1L2QA 4YTTA 3WO8A 3GC4A 4IL0A 1K9TA 4I3GA 4X22A 1XYCA 3PUEA 5CG0A 3FS2A 1LQ2A 3PTDA 4REQA 4DWSB 3EKLA 4OOZA 2PSNA 1YDOA 5F4SA 1KBLA 2FDSA 5FEWA 2ONEA 4UZUA 3TYCA 5D2YA 1PSCA 4XBSA 4BF7A 2HEJA 3VKJA 4AZ5A 2YLAA 3INPA 4H7ZA 2JF6A 4PULA 1NFBA 1EWDA 1X6NA 2G95A 1E6NA 2PLKA 1EO7A 5FJIA 5A6SA 3M16A 3B0VC 4LV4A 4CNSA 3IAQA 1JNDA 5C2XA 2ABAA 5MHBA 4WF7A 2CHRA 3GDLA 3CWHA 4IJBA 4HMCA 5JIWA 1NOWA 3FCPA 1IEVA 4EWJA 1H1YA 1YDVA 4Z42C 4XWUA 3BGJA 3TJLA 4DO4A 1FHLA 4IICA 4Z2IA 4R7JA 3STGA 1C8XA 1JYVA 4L61A 1KBIA 3ZM8A 4PL1A 1L9WA 1XQKA 2G8ZA 3LCWA 2INZA 4JX5A 4KH2A 2QCHA 4PE8A 3GC5A 3RCNA 1WYIA 1GHSA 4I9JA 4MB5A 1S2CA 3W2UA 4QJ5B 1YMYA 3RRAA 1SO3A 1PTDA 4IMFA 4XKYB 1W8GA 3UR5A 1CXKA 5DRIA 3R94A 4D72A 1YE6A 3KWSA 4O15A 3U9IA 1ZJIA 1G67A 2IPWA 3URQA 2WYSA 4LOCA 5I02A 1TPDA 1LLWA 1G0CA 4TQTA 1S3TC 4JNZA 4DJEC 3ARZA 2OOGA 3GBEA 3FYPA 3AIVA 1RBAA 2PZ0A 4UR9A 2G3NA 3GQYA 2I5QA 5CZJA 1IR2A 2D73A 2ZX7A 4F4RA 1MWOA 2G5WA 1KC7A 4AX7A 4BR1A 3MANA 1UW9A 3P7YA 1DKWA 6ENLA 5HBFA 3K46A 5LIUX 1AQ0A 2J24A 1JPHA 2VR2A 2YXXA 4H6EA 4FI4A 1ZJBA 1SJDA 3KOFA 1IXPA 1P6CA 2JBMA 3WD3A 2YIHA 2YXOA 4S3KA 1XIJA 3P74A 4H9MA 3P0XA 1V7AA 3CHCA 3R79A 2CBVA 1U1HA 4GFSA 5A2AA 5DY2A 1CLXA 3AXMA 1L6SA 2Z00A 1VP5A 1OCJA 1QCWA 1H61A 4QDPA 1TV5A 4GNJA 3SSZA 3IIVA 1K8YA 1UIPA 4CN6A 2PS2A 3AZTA 3BLDA 2ATMA 3CQHA 1GG1A 3UA4A 2V67A 1PZ0A 4TX6A 1JPIA 1GYLA 3OIHA 5EFFA 4HNVA 3OTRA 6REQA 5K2ZA 5U7SA 4LCRA 1XC4A 4Q6JA 4IFOA 1FX6A 3N19B 2VZOA 2ZIDA 1WCGA 3MMWA 3LV5A 3ZIZA 1CB7B 1Q85A 3W38A 1AQMA 1IGWA 4YMZA 2ZCGA 1ADOA 4QSFA 3VCRA 3M4HA 3VYLA 5A8QA 1YKWA 4R9XA 3N34A 2D3LA 1TPB1 2RDXA 4PSPA 4YTQA 1WB0A 4PMQA 5SWUA 3AHXA 4FR1A 4FZIA 2NSOA 4AC7C 1ZJHA 3GIYA 1IIGA 3ERPA 2NXIA 1TKKA 4L9YA 2C18A 3SN4A 4Z1YA 3A21A 4QGCA 1UOZA 4G6CA 4F0KA 1HN1A 2IUZA 2A3CA 3N3MA 1J10A 2ZDRA 2NX9A 5I7GA 3U6WA 4IPPA 3DZ1A 3HV8A 4RE2A 1MZRA 2BOGX 1EFZA 2BGSA 3MZ2A 4LJ3A 1U5VA 2GJNA 4M56A 3ARYA 3WH7A 4J3UA 3PM6A 1TPH1 5JIPA 3QGAC 3ZJ8A 1RLCL 2CW6A 1DXIA 2TRSA 5AOUA 3PANA 3U57A 3UJEA 3BLEA 1XLCA 4W84A 3T8QA 2D23A 1W3NA 4Q4MA 4DF0A 4PEKA 4Q32A 5TF0A 4V15A 3T4CA 3L2IA 1UOKA 3B06A 3FSUA 2E6DA 4F40A 1V02A 1K1DA 2CHNA 2P50A 4E4FA 4K68A 4BK9A 3E2RA 5D4YA 3E9AA 4XD6A 3RNDA 4B3KA 3F4CA 5CQ1A 1RUSA 4QNWA 3W37A 3USZA 4GIEA