2RHHA

Synthetic gene encoded bacillus subtilis ftsz with bound sulfate ion
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
304
structure length
304
Chain Sequence
ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell Division Protein ftsZ
publication title Combined protein construct and synthetic gene engineering for heterologous protein expression and crystallization using Gene Composer.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 108
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2rhhA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2rhhA01
1W581 5LP6C 2GVIA 3RB8A 3JAKA 3ZIDA 3R4VA 5C8YA 5IJ0A 5JVDA 1FSZA 1JFFA 4TV8A 3RYHA 1RQ7A 4IIJA 5CA1A 5KX5A 3JARA 1W5FA 1Z5WA 4ZHQB 5J2TB 3M89A 5EZYA 4I50B 3JAWB 3HKDB 1W5AA 2BTOA 1TVKB 3HKBB 1SA0B 5LYJA 4I4TA 5EYPA 3E22A 1Z5VA 2VXYA 2XKBA 4FFBB 3JAKB 4X20B 5JVDB 3VO9A 3RYHB 4ZHQA 4IIJB 4EI8A 4I50A 5JH7B 5EZYB 4DRXA 1TVKA 3HKBA 1SA0A 4EB6B 2XKAA 2VAPA 4O4HB 4I4TB 4IHJB 5J2UA 5M7EA 5EYPB 4B45A 3E22B 1W59A 4FFBA 5EIBD 1OFUA 3C8LA 4X20A 4O4JB 5LA6B 3HKCA 5JH7A 3WGMA 4EB6A 5IYZB 2RHHA 4YJ3B 4KWEA 4DRXB 5ITZB 4O4HA 4EI9A 4IHJA 3VO8A 1W5BA 2BTQB 3JATB 4LNUA 5J2UB 5CB4B 5JQGB 2R751 4O4JA 3UT5B 5LA6A 4E6EA 1TUBB 2VAWA 4ZI7A 3HKCB 5LP6B 5FNVB 3VOBA 5IYZA 4X1YB 4YJ3A 5JCOA 5LOVB 1FFXB 5CA0B 5ITZA 4O4LA 4O2AA 3JATA 4TUYB 5CB4A 2BTQA 5JQGA 3ZBQA 4LNUB 3RYCB 1W5EA 3N2KB 3UT5A 3JALA 5MN5A 2Q1XA 1TUBA 5GONB 1RLUA 4TV9B 4YJ2B 4ZI7B 5LP6A 5FNVA 2Q1YA 4WBNA 3VOAA 4X1YA 5LOVA 5LXTB 1FFXA 2VAMA 3N2GB 2R6R1 4O2BA 5CA0A 2RHJA 3RYFA 4TUYA 4O4LB 4O2AB 3RYCA 4O4IB 4HNAA 3HKEB 3N2KA 3JASB 5GONA 3RYIA 2RHLA 4TV9A 4YJ2A 3JALB 4U3JB 4F6RA 4B46A 3CB2A 5LXTA 3N2GA 4WBNB 4X1IA 4U39A 4O2BB 4M8IA 3RYFB 1RQ2A 4X1KA 5KMGA 3V3TA 4O4IA 3HKEA 3WGNA 5IJ9B 4HNAB 3JASA 4U3JA 3RYIB 5BMVA 4ZOLB 4I55B 3WGKA 4F6RB 5MN4A 4X1IB 5C8YB 5IJ0B 5JCOC 3M8KA 1JFFB 4TV8B 5KX5B 5CA1B 5J2TA 4X1KB 5IJ9A 5KMGB 2RHOA 3JARB 3WGJA 3WGLA 3JAWA 3HKDA 4XCQA 5MN6A 4ZOLA 3VPAA 4EI7A 5EIBC 5BMVB 4I55A 4DXDA 3ZBPA 5LYJB
chains in the Genus database with same CATH superfamily
5F1PA 1QIKA 1AVTA 1YI1A 2PZMA 4G09A 2OG2A 2PL9A 3IP7A 4BE4A 1SCKA 2ZSIA 3M6WA 3TK1A 2AZXA 3SDBA 4QOGA 2HSDA 2KG4A 4PTLA 3NNSA 3LV8A 3GOQA 1PK8A 5GWXA 2OFXA 3KQVA 1C7FA 4Q82A 5AKGA 4DARA 2PU7A 1T9HA 3RGGA 1CFZA 2FUNB 4F2DA 2O06A 5DTIA 1RE0A 1OIXA 2IDMA 1REQA 2V54A 3DAFA 4L02A 2XSZD 3MJ4A 4PCVA 2VSQA 4FS3A 4OL0A 5EJ5A 2ZXUA 4U5XA 4PPNA 4EMBA 1NVBA 1IOLA 3JVUA 4QBGB 1IV2A 4Z7QB 5HJ7A 4KTVE 4FMCF 1IWPB 1C3OB 2FOLA 4J1SA 2H06A 2VUHB 4AIIA 3N76A 1E2DA 3DFIA 3F0TA 3NT2A 4HWGA 4DBVO 2P91A 2WQZA 2OBXA 5IM4F 4NSNA 2WICA 4Q1DA 5K0BA 4L51A 2OHXA 4RGVA 3NBQA 4Q9DA 1R18A 3TF5A 5ENVA 4LF9B 4CQMA 5A5EA 3L8CA 2O8DA 1E6WA 2NUTA 4YMTA 4IDPA 3CKKA 3GRUA 3QYJA 3JPWA 1VSUA 5JZMA 1MR3F 2D4AA 2V7VA 1YE8A 1MP0A 2FP4B 3JX9A 2P3LA 3NHPA 3MTDA 4ZANA 5FLYA 1BA3A 4MQ6A 5AXAA 3U37A 4RIIA 3ZIAD 1RRKA 4DLAA 1IMOA 2P79A 3GNSA 3L40A 5D84A 1ZWLA 4WIAA 5LDDC 1F1BA 4L78A 3NCHA 1EFCA 1QONA 2ZJ1A 4GLJA 3D1JA 3FZEA 5JXGA 1CZRA 2QROA 2WAAA 2WP8J 4LHSA 3RWMB 3QJGA 5AQEA 5FOTA 3C3BA 3E35A 1TKAA 4TV9B 1WZNA 3HMKA 3MGCA 1BWPA 3AM3A 3IR5A 2HEIA 1WVMA 3OJ0A 3P9CA 4FYIA 3SBOA 3AVXA 4A7PA 3K14A 4RPLA 3L6UA 2R79A 5C2JB 4E0BA 5J4LA 1L1EA 1IXKA 3OD5A 1I36A 2CVOA 2JEZA 2HQBA 3BGOS 2WD9A 2GX6A 3ZR4B 4KGDA 1PS0A 4A23A 3PFKA 4JXZA 5EZ5A 2VYQA 1ZINA 3HV2A 2VUIB 1YR9A 3PGA1 4M0DA 5IARA 4AS3A 2W6QA 2B3DA 5DWDA 2Q46A 2I99A 4FU0A 5EMLA 5K0SA 2J31A 2FCRA 2GPNA 2GI4A 1G9SA 3V4SA 4DSUA 5AOCA 2C2OA 4W82A 4H4EA 2FU5C 3O73A 2CUZA 4LRSB 1KERA 4RM2A 3TG8A 4WAUA 1R9NA 1X8KA 2QR2A 2WT8A 1GN8A 1NU6A 5JT1A 1JSZA 1Q77A 1N9GA 1XVUA 3A4VA 3ENQA 4L57A 4OA5A 4RVHA 3SEAA 4PNZA 1VQ4F 5AJTA 3CGWA 4UM9D 2AIRA 1C8VB 1HFJA 4MS1A 4DRZA 3JPYA 3HCCA 4MGEA 1Y9DA 1Z6XA 2JIMA 2XQGA 3QUSA 3CF4A 2E7ZA 3PLAC 2W43A 4Z8YA 5DNEA 2NVUB 3EZYA 4RVUA 2BCEA 3HZZA 3RCBA 1QTIA 2SICE 4N3NA 3UOGA 3GP8A 3OTWA 2AKAB 3SF0A 3DL4A 4H35A 1W2GA 1Z35A 4FZ5A 3V7EA 1CS4C 2JDIA 4EK9A 4LC0A 1RSZA 1S3FA 4MS4A 1PLLA 4TMYA 3WGUA 4D8UA 4F8EA 4U1RA 5C8YA 1QVAA 1F6DA 3GJXC 1G2QA 3ZWKA 1GCAA 1K6JA 4MDFA 1MOPA 3QTLA 1F8UA 5AT1A 4ZVVA 4QHSA 4X9XA 2Z43A 2IBTA 2NQ2C 3DM5A 3EH1A 3J7TA 1VG9B 2C9YA 3LLVA 3QK7A 3ZXYA 2Z4SA 4FNAA 4FFRA 2CLEB 3MNFA 3D4NA 4YHBA 4DR2B 4BNVA 5F98A 3ZVRA 1B8UA 3A05A 1K9SA 4EI2A 3LW7A 5FYQA 3DDSA 3TMKA 3QFRA 4YTEA 1L4HA 1XMIA 4ERHA 1J2EA 5I7SA 1PE0A 2FLWA 1RIFA 2QT0A 3KEQA 3I1FA 3QMMA 1ULSA 4MLDA 1P0FA 2VWGA 2XF2A 1JXMA 2AI2A 5JXJA 2YQ5A 4OU4A 5WRFA 4G1BA 3H97A 3PCXA 1DPGA 2YY6A 4RWEA 5BOVA 3N8HA 1RTTA 3H2BA 3QIAA 4XM1A 3RFFA 5JV5A 3CPWF 2XT9A 4Q9LA 5DH9A 2PX6A 2A4MA 3ZHRA 2IAFA 5LL6P 4MHTA 2W2QA 4DBLE 2J3DA 1RRCA 1KQNA 4BVHA 3PXCX 1ZGBA 5JDIC 4O4HA 1HH4A 2ECPA 1T2UA 2ST1A 5CTJA 5H3HA 3DOFA 3H0KA 4RTMA 1UXIA 5ELXA 2GD6A 2HIAA 1IHXA 5CURA 3W06A 4LEIA 3HAXD 1ORRA 1SVWA 2WHPB 4R1TA 2K1SA 4JB0A 1HE8B 2YV2A 1FUKA 2ONYA 2GT1A 2QMHA 3BILA 3ZWXA 5I7OA 1QIEA 4KLCA 3OX3A 4UREA 5DMHA 4GOND 2I71A 4JD5A 2HF8A 3QTTA 5L51A 3QVGB 4K0RA 4ZV7A 4KODA 1IWBB 2HUNA 2QJRA 2UZ1A 1M5UA 2WWXA 1FFXA 1DG9A 3OTGA 1T8TA 2UZIR 3AW9A 4CG1A 2ZSEA 4H1WA 5DYGA 3OAAD 3UQZA 3QLVA 3KLOA 4REQB 3RBAA 2KGWA 1Y8QB 1MJFA 2F6RA 1F9EA 2EAUA 1DUVG 2PGLA 1VPTA 3JASB 2NXJA 3GAZA 3D4BA 3EA5A 3IBTA 2G9UA 3OTQA 3PXEA 1WV1A 3TGWA 3WNZA 3M1XA 4Z53A 2ATCA 1RE1A 2C00A 2GEVA 2R86A 4MPDA 1UZMA 3K0CA 1T0BA 3N28A 4HWOA 4QYIB 3EWNA 4TT3A 1XZLA 4YJKA 4EJSC 1ZK4A 3GP5A 2X76A 4HDSB 3UB4A 1EWVA 5D8DA 3RRJA 1M83A 4BX9A 2PR2A 2VK1A 4WI1A 4C29A 5K3SA 2Y3IA 1G3RA 4OHBA 3CVYA 4IRUB 4MUNA 4JJGA 4K9DA 3L0DA 4CLOB 1AXGA 1DV1A 1WXDA 5JD3A 3HZRA 1UBRS 4E3ZA 1LH0A 4YMGA 1JX6A 4MO9A 1OYOA 3L1JA 5IDXA 1XP5A 2HSJA 4TTIA 1IUPA 3NHAA 2RGXA 4OQLA 3RV4A 2A0WA 3W1WA 3TZ6A 3KOUA 3QVMA 2WYUA 1ORWA 4QOFA 1IQ0A 4UVGA 5KNBH 5C9ZA 3J81A 2VOJA 3S3TA 5ES4B 5HWSA 1SBHA 3MWLA 3DDOA 2EKDA 3DOCA 5EMNA 1U40A 1JEOA 1K8YB 1N8TA 1O03A 1UBJS 2AA3A 2AE2A 1KNKA 2CDRA 3GX1A 4Z7OB 3D4OA 3A28A 1ZZGA 2XB6A 3M34A 4KLNA 1VDMA 4PV7A 1E2GA 5BQOA 3PE3A 3O90A 1QHGA 4HQKA 4J1NA 3SJZA 1NLZA 1UZLA 2P1RA 5HXAA 1NQTA 1XVVA 4AQYB 4FFPA 5EXPA 3T1YB 1KJYA 3GMDA 3I2FA 5D1NA 5ALSA 2WZQA 1GRNA 1Z88A 3KU4A 3JCZA 4GVLA 4MCAA 3VKUA 4GOXA 1NBIA 4MRMA 5F4ZA 4OQDA 4BNDA 4IIJB 3ZJUA 1E60A 2M6RA 5FBZA 3KTAA 1V8BA 2YASA 1ZD2P 2IU4A 4R05A 1U2ZA 4D99A 5JPCA 4ZZ0A 2HDWA 2I8CA 3VU0A 4JKYA 1JFSA 3D31A 3KB2A 3GQVA 2FEXA 5JCJA 4K6GA 4BNZA 3RAGA 3UMJA 1XFAA 1LPNA 3PGLA 2AMLA 2YZNA 4M1WA 4MYUA 2VQSA 1TRHA 3ESQA 3HM2A 2VP9A 1E20A 4HDMB 4I6JA 4HVTA 4YEDA 3STYA 1UBSB 4TKUB 1L2TA 4C7KA 1V37A 2HHAA 2RHHA 3BREA 4FKBA 1GRCA 4QQ8A 4GEGA 3WKEA 2P6UA 3QX8A 1QG4A 5IKOA 1TF2A 4QXQA 2DTDA 4ZI2A 2WTNA 2IIBA 2A3RA 1HXHA 1W75A 2AUMA 3FPSA 1T0UA 2XE7A 1U9JA 4PAWA 4QYSA 1JR3D 1ODSA 3HNPA 5LA6A 4GKBA 2WIKA 4R2KA 2V9ZA 2AFRA 2ZJ6A 2PUTA 1ADCA 3BK7A 1Y1RA 3C74A 3H42B 3NWJA 3WRVA 2QMYA 5A5GA 4LXGA 4RZ3A 4ATNA 2ISCA 3LT0A 4UE3S 1D0SA 2OGSA 2H54A 4FNOA 5JQGA 4JEUA 2RG7A 3U3KA 5K5EA 5G0SA 5D5PA 1E66A 1XX6A 3DXXA 1JDBC 2FWMX 1A82A 1E2MA 1MD9A 1XDWA 1Q74A 4PM4A 5ESXA 1G0OA 3SI7A 2PT9A 1GQFA 1CJBA 1Y3CE 1YRBA 2WWIA 2GEUA 3D6UA 1PR2A 2RGNA 4DABA 4G36A 3KQQA 4HAWA 3UFBA 3RU3A 2LE0A 3EIUA 4F2GA 1IU9A 1D2MA 1PT5A 4EZEA 4JLNA 2PKRA 1V3VA 2NXCA 1DARA 2A88A 1J20A 1NM5C 1FMTA 5EJIA 4ZVRA 1N9GB 1PJBA 1Y4DE 3KK0A 3OCUA 4C81A 1TT7A 3W3ZB 4MS1B 1Y3AA 1YDFA 4ZI3A 4AJEA 1ZSVA 2BHNA 4ZT4A 4DR4B 1E5VA 4HEA6 5AYVA 3ZHVA 4C3ZA 4E22A 3HR8A 4YNBA 1FJHA 1WXGA 4IDNA 1KU6A 5KOJA 2Q4TA 1ST3A 3WL6A 4PLVA 4BJ6A 5AI8A 5T3UA 2TSYB 2PLNA 3RODA 3LUHA 4M1ZA 3PI7A 1JQBA 1D4FA 2HH9A 4DQUA 3BK1A 2WOOA 1TZKA 4WJZA 1CJTC 2CLKB 4MS4B 3JY6A 2YDYA 4NAHA 2QMUA 4TYYA 1A27A 5C8YB 3EC7A 2E48A 3G9XA 1YJQA 2RJNA 2XNDA 5IG2A 4CQLA 4F93B 4HDRA 2HXYA 4N3CA 1TGVA 3D8TA 3QI7A 2QS9A 1IPFA 1I13A 1SFRA 3SS7X 4DMFA 1KHTA 2QWXA 3S28A 1P7PA 4MK4A 1BS9A 1ZXBA 3QLUA 1C0LA 4PZZA 2XMSA 5G0WA 2XXAA 1ZRMA 3D1LA 3FPAA 3O1HB 5DI3B 1P5HA 4HDCA 3SY8A 3JAKA 1TXGA 2HWYA 3R4VA 3DCJA 1WCXA 4G4SP 2FN9A 4GWLA 4CTJA 4KKVA 2M32A 4AKTA 1FOEB 2PM8A 4N40A 1LI4A 4GDFA 3EXEA 1MFPA 2P68A 1J4AA 1U8YA 4JROA 4A1OA 4ZDIA 5A2GA 3FI9A 1ISHA 1FNDA 2BJHA 5G4LA 4REMA 4OBWA 3ZY2A 3IEMA 2C7OA 3KSUA 3WIOA 3GZNA 4B6SA 4LMBA 1J7KA 5JCXA 3S2EA 1ZJWA 2GD1O 1DAFA 1CJKC 1U3TA 3O6VA 2C4HA 3AWDA 5C53B 3VR3A 2R6DA 1DX4A 3KKQA 5EL0A 1S3GA 5JRZA 3RFXA 1W3EX 4FDVA 4MMYB 1PJ8A 3L8MA 4OSPA 4BRWA 1PFGA 2G3YA 3DDUA 3GPIA 3LKVA 4UDOA 4FR2A 2ZRPA 2PSDA 4F8JA 4O4HB 1YQWA 3UUWA 5HY0A 5HY2A 1W35A 2OHIA 2R1TA 3QVUA 1R66A 1X38A 1Z68A 1LBHA 4QUDA 5CJ2A 1L7OA 4JZKA 3VX4A 4JJ4A 3UJHA 1NZDA 5SV2A 1ZLYA 2WFAA 2AOVA 2OGUA 3A2MA 5FT9A 4GMFA 4DDVA 5BVGB 3K0AB 2BM8A 4TN1A 2IYFA 4GSLA 1WPRA 1X7ZB 3RFTA 5B64A 1JVNA 3AFOA 4J0DA 2OC9A 4P33A 4YBRA 7MDHA 1X1DA 5BT9A 1NP3A 2H1VA 1TADA 1VG1A 2DWQA 4GBED 4DNOA 1Z4QA 1FXWF 4LECA 4Q6WA 4S1PA 5HY4A 1AC5A 1X7WA 4EBFA 5FR2A 3DR5A 5IVIA 5LQDA 4P7BA 1FFXB 3V2IA 1IN6A 3K0FA 3L1IA 4I5IA 1RKXA 3V7YA 3CHYA 3SJAA 3PEWA 3HCNA 3HCOA 4L5CA 3SOZA 3WR5A 2BFAA 4BT4A 4DV5B 1EQUA 1ZEMA 5K09A 3JVDA 3N0TA 4EZIA 3I4LA 4L8YA 2ZOSA 2NNLD 4DR6B 3B8HA 5CT5A 4UUPA 4AY6A 4AJOA 3RRBA 1SXQA 2BFFB 1XRSB 4I4NA 4WZAA 5IK2D 1J1UA 4JN6B 3UMSA 3CIOA 2G70A 4GOOD 2LCIA 4UNPA 2PMWB 3BE4A 3OEHA 1OXKB 5AK4A 3UWPA 1W4RA 5CNIA 1EUZA 1T5OA 1WXXA 1XRRA 4GI2A 1FVFA 4YX9A 4BQIA 4DLRA 3CB2A 2IWHA 3N2GA 2PZGA 4MB2A 4EJ6A 2GBCA 2QGNA 1YRHA 4XYLA 4MMZB 5KWIA 2PNFA 2DH5A 2EX1A 1GPH1 4PYOA 1BFKA 1CXZA 1VE9A 1ONIA 1DSSG 3HXLA 1JE0A 1RKQA 4Z0TA 3LDGA 2C94A 4EJFA 4BXOA 1ENPA 3I39X 3ZEIA 2D7DA 3WGKA 2FW6A 3DDCA 2ZBVA 4XIGS 1WXIA 2EJVA 3JVVA 4I81A 3IB6A 1XD8A 2E37A 3DW3X 1KSHA 2CL5A 3P20A 4I1VA 3UM9A 4ER0A 3K73O 4KFUA 3TFQA 5BN4A 2B4AA 1J90A 1ZNYA 3EUAA 4QRIA 5LMUB 1T8SA 2HA3A 1JPVA 2PMCA 3H6KA 3P9QA 1DC4A 4NCAA 3KHNA 4TYWA 1YZKA 4H6VA 3U4MA 3V1YA 1S7CA 1SVIA 2UYQA 2DHDA 3RT9A 2QW8A 3NW9A 3UH0A 2BI4A 1Z6TA 3E7PA 1W46A 3HCFA 3K4QA 3DD1A 1AG9A 2RIRA 1PBTA 3LPCA 4JQCA 3TLXA 1GDHA 4ZALA 2I3GA 1PL8A 2BSQA 3QVLA 3JAWB 4MAFA 1LPBB 1QHSA 2JW5A 621PA 1DI0A 3L05A 3LS2A 4BO4A 2WNIA 4KV7A 4JVMA 5DT9A 5JNVA 2JHPA 5KOYA 3HA3A 1YHNA 5C4MA 4P0QB 2OWEA 2VTEA 1NBMA 4OBEA 4P54A 4X3OA 3HFGA 1AF4A 1QV9A 5HIJA 3R5FA 2IODA 3TNDA 1WUJS 4YUWA 2H4WA 1CD5A 2IYVA 1NVVR 5EXEA 1E0AA 4CMCA 4LVCA 3LQKA 1PP4A 5JNTA 5AVQA 3HXOA 4D79A 1GXSA 4AURA 1YR1A 1RM0A 1SA0A 2GYYA 2K7FA 1C41A 1PWYE 2IYYA 4UPDA 1IEWA 1ST2A 3SN6A 1HLGA 1U2DC 3BB1A 1IOVA 3E7FA 3IKJA 4YV1A 3SWWA 3VKHA 1N1DA 4I2NA 3KIZA 5HF8A 4D9IA 3AHHA 3FDJA 3LZDA 1JKJA 5DT2A 5H9VA 5LA6B 3GGJA 4J7XA 1EE1A 4R54A 3LNTA 4JCOA 5CVJA 1V7ZA 2PG3A 5DW3A 1XZJA 1HTTA 2A2ZA 3N2YA 1R9GA 4R9SA 3RABA 2FJ0A 2KSQA 4XGKA 4BO6A 3PE6A 4KQ9A 4IRMA 1NXSA 3EE6A 2ORYA 4B76A 4DYVA 2RARA 4EG8A 2FUG1 5JQGB 1Q50A 4QUKA 1E9SA 2Y92A 2CVFA 5T6MA 4TXMA 4CLXA 2X4GA 2GK6A 3CZ4A 1P1KA 4IWYA 3E2IA 4EPYA 3AI2A 2I8LA 4YFVA 5JDCC 2Z8ZA 1M7BA 1ZIDA 3Q1KA 1I6LA 1I4LD 3VI3B 4Z3OA 2X0KA 3T4PA 4MQBA 2R25B 4R68A 2M9MA 2QK4A 4A0FA 2YC4C 4D42A 2O1EA 3L01A 1BFUA 1VXRA 2LBTA 2AC4A 2W6CX 2Y1DA 3CTMA 4KR2A 2HWWA 4PSAA 5L45A 5DOZA 4M4SA 2Q7OE 3U19A 6CHYA 3QW4B 4D02A 2Q3HA 1SQGA 4ZRMA 4X66B 5LZ9A 2ZUCA 4B87A 2B4RO 5EHZA 4JBNA 1QF9A 4V38A 4EKGA 3Q40A 4FR0A 3P2IA 1HF3A 1UEXC 3GU3A 1WDLA 3WJRA 1B4DA 2DTEA 4RF5A 3ZU3A 4AY5A 5DYTA 2ZG6A 4DREA 1T43A 1CVRA 3CD6F 3OE4A 3QVTA 4BN5A 3LY8A 2JNBA 3KE1A 1FZQA 1K6MA 2I4OA 2DJIA 3H4TA 1LX7A 1T1JA 2C42A 1S96A 1D2AA 3F3YA 3E9CA 1EUDA 3DB1A 3SX2A 3VZSA 4U39A 1H2XA 4UPVA 5JPIA 3ELUA 5EJGA 3SQWA 1JDZA 3EMVA 4LYHA 2JRCA 6YASA 1QB8A 4ZHVA 2PX4A 4WBXC 5J1TB 3ND8A 3K32A 4CQLB 4HDRB 3EF3A 5KYTA 1JSRA 2N9UA 1KI6A 4RW0A 2A9OA 4Z9YA 1PVOA 1GL6A 1Q0RA 1QIJA 2ZEJA 3WYGA 1OILA 1SUCA 3MWYW 3VZDA 4ACBA 2XXAB 3A3YA 2O50A 5JZBA 4XVCA 5L3SA 4G56A 3N6XA 1Q15A 2ONKA 4BO9A 1VLHA 3DMHA 4II3A 5AK5A 4EB0A 4K3VA 4MR9B 5IF3A 3O8RA 5EOVA 5J2TA 4UEJA 2PWYA 3INRA 1YMVA 2QORA 2YXLA 3P9XA 1WBJB 1I5OA 3H13A 3C6BA 5HUHA 2V3CC 3ENKA 1TA9A 3GZNB 3WK4A 1G2OA 1LV8A 1NDUA 2EDCA 1VIYA 3CR7A 3E3LA 3VHRA 1YOVA 1CP3A 1M8FA 3S2FA 4QGBA 3VR1A 2UYHA 3B51X 4XWKA 1A7AA 1D1PA 3EZLA 2OVBA 4W9NC 1Q5PA 1N2CA 2G77B 1P5JA 2FUCA 5JBNA 4URWR 4HLUC 1A76A 3NWEA 5D7BA 4ZKDA 1DADA 2Q9AA 2X14A 5I7VA 4MUKA 2R1TB 4UNRA 4ZVSA 2IXEA 3WGQA 1NW9B 2VSYA 1RJDA 3K9QO 1NW4A 4RVSA 4WUTA 4F3NA 4JB8A 5C32A 4A15A 1Z3CA 2BZSA 4R98A 2E49A 3MQ2A 2Y93A 4RD1A 4IEFB 4DJEC 3GBPA 4ZJYA 1ZEJA 4KNYA 1WW2A 5EESA 3ICEA 4GH5A 4NPHA 4BRZA 3RFUA 5L7WA 1PW5A 3V9PA 1K5HA 5HXZA 1YULA 2ZYIA 4IQFA 4J6EA 2JCYA 3U9SA 4FFBA 1Z6QA 3FMPB 4BFTA 3BCSA 5JNLA 2CWWA 3IIMA 2ZBRA 1A4XA 2CE2X 3N53A 4WECA 3QUWA 1UQTA 1AZSC 1N34B 4NDZA 1X7WB 4ZI5A 1MX5A 3TOXA 3WGMA 5AM0A 4YUZA 4J49A 4WDQA 2C8VA 2RH5A 3K0FB 5KQPA 4M53A 1IPHA 2ZWVA 3HJUA 1KZ9A 1C9NA 2VDMB 3EDQA 3K7EA 4IFIA 5J63A 3IAHA 4MW0A 4H27A 3C48A 3F0DA 2PYIA 3Q5DA 1TD1A 4UQOA 3QM1A 1FFHA 1I6KA 4U0KA 3F6BX 5IAEA 1E79A 3VC7A 5TQVA 3OQJA 4YROA 4HFRA 3PD1A 1N7IA 5KCMA 2GM5A 2QLMA 4MPJA 5LD2B 2BHRA 4Y8VA 2IUSA 4FOPA 1MXHA 2OXTA 1N36B 1MXFA 2DBZA 3TTUA 1X42A 3B6EA 3OF3A 4TWRA 4UXIA 4EVQA 1DO2A 1U6JA 5DBIA 1LY1A 3LKZA 3IKTA 3CCUF 1SIWA 5FA8A 3T0IA 5EJ9A 3LX4A 3GIDA 5LDGA 3HVHA 4YT4A 3N2GB 1UMKA 4WY5A 1NIPA 2P2CA 2ZRHA 3OA2A 3RS4A 3UTDA 4G0WA 4N76A 3TS1A 5HILA 1OFHA 1SKAA 3WFJA 4QDJA 1QTRA 2FH5B 3OP1A 1O95C 3KV3O 1IN5A 2HIHA 5FA6A 4D41A 3QFCA 1RXEA 4UDYX 3ZWBA 1O8BA 5DYWA 2XUQA 4BO7A 4OAQA 5TQ2A 2PK3A 4BXOB 4JYCA 3UAWA 2F00A 3DO6A 1GTL1 3Q7PA 2Q3LA 3FTNA 5ARCA 4CODB 3NYRA 1PDOA 2FETA 1S9DA 3AZQA 1OA0A 3WLPA 4HX2A 2RC6A 4LXHA 3I83A 1EBBA 4Y9SA 1ZVVA 3JR7A 4NBVA 2J45A 3EEYA 3OM9A 5DCWA 4HNAB 2EFEB 1O5TA 4P08A 3CV3A 1AZLA 1KC1A 1OYWA 1Z2OX 3U0OA 3ECAA 2CHQA 2QZJA 2VDOB 3EG5A 3FUVA 1KYZA 4MA5A 4NLLA 4RKRA 5KVSA 5JTUA 3SNKA 4YRDA 5AICA 1QGDA 2J9FA 3K0KA 3OA0A 2CXHA 3S0HA 2IT1A 1X8JA 1NSFA 4K87A 4AJIA 1O96A 3D4LA 3I6MA 5LQMA 5AW6A 1QMPA 1DPFA 3QGMA 3U7RA 1C9MA 1E1LA 5A2QA 5FX2A 2XLCA 4O2RA 2DKNA 2I1QA 1ANKA 3MJTA 2WLTA 4B4UA 2YOGA 4U6NA 1NMEA 1Y8AA 3PFIA 3LDHA 3IUMA 2LD4A 1SQ0A 3TX2A 1ELOA 2Q21A 4RETA 5GJCA 3RIHA 4YR7A 1DXYA 1JA0A 3A4NA 2C5GA 4RAQA 3OBYA 1GXSB 2G1UA 5EFZA 4WASA 4D6XA 5F5NA 1SA0B 1SCJA 2GPWA 4R51A 2QVXX 3NIGB 1EDOA 4H7JA 1V4VA 2UDPA 2CC2A 2CFOA 2IU6A 1OI4A 2J85A 3GYQA 3KJKA 4DTCA 1YR3A 4MINA 5BUCA 1JKJB 1ZN7A 1TVEA 3H7IA 3M9XA 3NDRA 5FLXM 1PLJA 4XD7D 3TVYA 4OB8A 3V80A 1EB9A 1VG0B 4NARA 3HFJA 2FK8A 3I7TA 4PRLA 4UZFA 4YALA 5EXSA 5C5EA 5KYNA 3CVVA 2CV0A 5J2UA 5B30A 1JJ7A 1S3SA 2LPMA 3G59A 3UT6A 5AI4A 1FBNA 4NBSA 4LTNA 4M0LA 3ZWNA 1ODFA 3ABRB 1G1AA 1VPEA 3T4UA 1L1QA 3I0MA 4ZK2A 3KJFA 5AHXA 4AJ1A 5F2EA 2QBYA 2O2CA 3V4DA 4PLCA 4JMPA 1APBA 4CR8A 1Y6GA 4Q4HB 1CY0A 3DYBA 2IZ0A 3R7LA 2OCIA 2J1LA 2X7JA 2IZOA 2CLOB 3JD0A 3T7RA 1DXHA 1I2MA 1T1IA 2EGUA 5LKRA 2BGIA 2A9PA 3ED1A 3GL9A 4LHWA 3Q6MA 1G6KA 3AJRA 3P2JA 5AVMA 4HRYA 4JKOA 1UKYA 3H65A 3T8YA 3DFUA 5KSZA 3G7UA 2RH4A 5DBGA 1H8ED 4R1OA 4AZ3A 3E8SA 5ESRA 2Q6IA 3KJHA 4EF4A 1YDMA 1KAMA 1LTQA 2IEIA 2B6HA 3FUTA 3O38A 4IXWA 5HIIA 1CDDA 1D5CA 1JMKC 3NEAA 2ZUWA 3LQRA 4TSRA 1EHYA 4LHEA 3WL5A 3MTEA 3GC6A 4IINA 4UZSA 4P53A 2HNAA 4P32A 3OURA 4A8PA 4IZIA 3VJMA 3S1SA 4E21A 4OGWA 3D6NB 1QG0A 4WADA 3HYCA 3QA9A 1L7DA 3RTAA 1XNGA 3KNZA 4QPJC 4AN4A 4TV8F 1OB5A 1OXSC 2HJHA 2P2DA 1AMNA 1KI6B 2BR3A 3I76A 1JQ5A 3JALB 4TL8A 4HN9A 2D3WA 2FW0A 1ETHA 4P3KA 2VKQA 2Q5HA 2J9GA 4GNRA 4OK5A 3VU1A 3BMCA 1G8GA 5L3SB 1P44A 4B6EA 2PKYX 5DXJA 3VV2A 1JEJA 1XVAA 1KYIA 1YVDA 2J4CA 3I6YA 3DV0A 3EDRA 4HAYA 4J90A 2OCDA 2XXBA 1QZTA 3BWBA 3GZJA 4NBUA 2NZWA 3GNQA 1UDXA 3OE7A 5DSTA 2JIRA 5LQUA 2RHMA 3A1EA 4Y2TA 3LAWA 3D4IA 1Q1BA 1NP7A 3N05A 4QGAA 4EFKA 5HKKD 2OZPA 1UADA 2V6BA 4ITVA 2HZBA 4I1UA 3H9GA 4BVLA 4UUOA 2C57A 2R3SA 5E7QA 3AY0A 4CT0A 1P7WA 2H3EA 1JIVA 1QQ7A 4RHAA 3L4EA 1QFYA 3M0EA 1IH8A 3MS7A 4NPCA 4N8EA 4FIDA 4PNPA 3RS8A 2WKRA 3DS8A 4BTEA 3IQFA 3E7WA 4BASA 1NPDA 3M6XA 4M0EA 5C4GB 1R6DA 3DB2A 3WX0A 4LWZA 4ZZIA 2R6CA 3MTGA 8LDHA 4F92B 1EWQA 1KJIA 4OSEA 2LDXA 3IMKA 2BMFA 4NULA 3NB0A 2FTKE 1P5FA 5BV1A 2PX0A 3QKUA 1CF9A 2IOQA 2HXSA 3M89A 4BV3A 3TQHA 2OGTA 5GIOE 2PR7A 4F72A 1AUOA 3H3FA 2O7RA 1H65A 1YVUA 2JIPA 1Z5VA 2ZIVB 3D3KA 3ETDA 5A9SA 4FFBB 2ZUEA 2QLJA 1Q7YH 3Q0EA 5BN5A 1VHLA 3VO9A 4D1YA 1ZGCA 1ODLA 4TVKA 3UW1A 3P94A 1UP4A 2QXUA 4DZZA 4PWTA 5JARA 3AGKA 3I5XA 1HDGO 1K7CA 1MUUA 2EFCB 4PICA 5CJPA 2ZUSA 3MLAA 1H1LB 1XFDA 4AKHA 1VQVA 3OHSX 4IDOA 3SP1A 3BWCA 4PQRA 3ONVA 2E55A 3O4RA 4E33A 3NALA 1X6VA 5BUSA 1NNEA 5K20A 3QE9Y 2FPRA 1S89A 4RF3A 2UVPA 3ORSA 4H7IA 4JOSA 4KGZA 4LJ7A 1XDUA 1YE5A 3CF4G 2QN9A 3KAKA 1MGOA 4LS3A 4TV9F 1OQAA 3RS0A 3VSDA 3NQ41 1KYTA 1RI5A 2M1ZA 3WGZA 4D96A 1NF2A 2XCQA 3D02A 1UANA 3L8FA 5HS6A 3TMAA 2GXAA 4WN9A 1ZFNA 3BXFA 4I1YA 3TAHA 3OEED 5HS4A 4FOTA 2F1JA 2GJAA 3TW6A 4ZHSA 4J76A 4J07A 1IV1A 2X58A 3PXUA 4BB5A 4KU4A 3C8HA 3RIXA 2FX5A 3AP3A 1P7CA 2N47A 2OB1A 5TC4A 2SKEA 3A3PA 5GMOA 3GLUA 3I32A 3AVWA 3VYUB 3BJIC 4M9UA 2BF7A 1Y6FA 4JUCA 2ZZKA 3G5LA 4ZT7A 3WIUA 1BCSA 4PO1A 1XN1A 4DC1A 5TQ2B 1W30A 4BT3A 1M8KA 3WP0A 4OJTA 4IHAA 3RS2A 1TM2A 1U5AA 4IYRA 3UCEA 5DBFA 5JS2A 3WHKA 1V45E 3T15A 4MJLA 4OSOA 2YHBA 3TCKA 2C9MA 1CY6A 1DAMA 4J2TA 2FLVA 1E8NA 3D3JA 1P2VA 4LC1A 4NZMA 4TLLB 3VR2D 2PRYA 2B1RA 4B6JA 1J9EA 2IYQA 3CVOA 3WV4A 5K8LA 1G38A 4XRRA 3CJQA 1YJ5A 3WWDA 1D07A 1H8HA 3O4VA 1WF3A 3SFTA 3IIJA 5I7EA 3ZV4A 3BT7A 3RWBA 4I1OA 3PFCA 4WXPA 5DTRA 2EP5A 1NQ5A 2QTHA 4MPPA 4DADA 4JB2A 1GRQA 1QP4A 2ZRGA 2QXTA 2Q07A 5L7YA 3FHLA 2H51A 2HJRA 2J9FB 3IT2A 3V1UA 1Q1NA 3CMEF 2OMEA 2XITA 2VT3A 3HTNA 3EOZA 2O5RA 4U7HA 5AKZA 5JSQA 3HJRA 3LYUA 3K71B 3ZGVA 4AFNA 1LLCA 1TU0A 1M1YE 5JXIA 1M3SA 2Q3DA 3U4QA 3OFND 1FK8A 1NXQA 1EFTA 3RUEA 5AOBA 3HJBA 1H5UA 5AHRA 3L7MA 4OREX 3TL6A 4CM1A 4CUJA 4MVJP 5BOSA 5BN1A 1UODA 4PZ9A 5F5LA 3ZDAA 1N32B 1XU9A 5JDIA 4BGEA 3DBRA 1QE3A 4HLDA 1UJMA 4NU5A 4OU5A 4Y6QA 5J58A 2JH9A 1W581 1G291 4ARZB 4ND7A 5C35A 5T4EA 3IDAA 1IWOA 3ETEA 1BYIA 4W5JA 3IVRA 4QSMA 3V4FA 1DRJA 2CVZA 2D54A 1IEXA 4N6OA 1OA1A 1RZVA 1YA8A 3WLNA 3DVRX 1SK8A 4NTZA 1B42A 4Q47A 5CT4A 3SK0A 2Y4NA 2Y77A 5AVWA 5F7JA 3SF8B 1M9NA 1VQ9F 2BZ1A 4N0EA 3KVYA 2NPOA 1O87A 5DHTA 1CETA 4LWQA 4IICA 4EFNA 2OV2A 4EHDA 2XGJA 3NUQA 4RORA 8OHMA 3E5HA 2DP4E 3RREA 5ICMA 1QE0A 4JBWA 2PH7A 4H31A 2QBYB 1UFYA 2XQVA 2HOQA 2NO6A 4QJIA 3R0IA 1ZL0A 1KORA 2FN3A 3PZRA 1TOAA 1DAGA 5M7EA 1TF5A 3HLYA 1JLMA 1XALA 3QG1A 4YP5A 3RPEA 3ZGXA 1G60A 2BMEA 4C04A 1G8FA 5C1IA 3L49A 2CVHA 3K9CA 1VDZA 3QOWA 1KMNA 2RGEA 1XQVA 4NG4A 3CRQA 4I6EA 2VJLA 4EJSA 4UNQA 5BSWA 5AW8A 2A5FA 1HM5A 2C61A 4JU9A 4X62B 3LO5A 2ZVDA 4D46A 3NGXA 1JEYB 2NYAA 3PUIA 5CLQA 4PYRA 4X45A 1W57A 1RABA 3EYWA 1KTVA 3KYIB 5DHRA 4AZ3B 5KVQA 4F86A 5IXYA 1QNLA 3QMPA 1JLRA 1GYPA 2ESRA 3LUGA 3PX2A 4RFSA 4XDHA 1TCBA 3V8PA 5DNWA 5AW3A 4TMVA 2R87A 1E9BA 3QU4A 3L3BA 4MVWA 3ZXIA 4DQKA 2Q5IA 2A8YA 2QL6A 4NH4A 2G17A 2FK7A 1PT7A 2OHVA 3I8XA 1ZKDA 2N1MA 4KL8S 1KEWA 4QJBA 4G4WA 4MXDA 1G20E 2XDQA 1C8LA 1N6IA 2WB4A 5FFMA 3U7FB 4L6CA 3TSWA 3IAM6 4H7EA 3I9NA 5D01A 1BH6A 4MTCA 1OXMA 3ZVMA 1R8SA 3P9YA 3INTA 1QQBA 2E1RA 5H82A 1O94C 1B93A 3BMCB 1W9MA 2W0MA 2H17A 4CMBA 1I3MA 2D0OB 2WUGA 4ALKA 4XFKA 4ZYVA 4RTSA 3FOCA 2RCNA 2AEEA 3IA2A 3DV0B 1F8GA 1UJBA 2BGJA 4ZREA 4A0SA 1THMA 2I3DA 3A9WA 3CONA 5KIAA 1WVGA 3B38A 3WLTA 3ISVA 5DNAA 4K6MA 5ILQA 3TOVA 4BUCA 2HQOA 1YL6A 4WKBA 5CDFA 4B46A 1P0MA 2Q7DA 1PW7A 2BBOA 2F9FA 3GT0A 3OG9A 1P60A 1RWWA 3RJTA 4GR9A 3KUCA 3RUIA 7AT1A 4F1WA 2BDUA 3PLAE 1RMTA 2O0KA 3JYOA 3RYFB 5LZ4A 1Z0KA 1QU2A 1JAIA 4ZVKA 3ZCTA 3U09A 5HFNA 5E7JA 4TXNA 3LK6A 3Q2KA 1UJ6A 1F2VA 1NW5A 4UE2A 4GMHA 3NV9A 3UMMA 5JISA 4LRQA 1NVTA 1JL3A 1P75A 4TSFD 4JI6B 3DOEA 3WQSB 1U5BA 1XHEA 3KX2A 1ILWA 1JAZA 1P4GA 5JSKA 4BHTA 2PXAA 1WKCA 4FW9A 4HXFB 1GUBA 1NHGA 4GF5A 4XWOA 2OBFA 4KP7A 3RQIA 2Y9MB 3M3HA 2X0FA 4M0CA 3VNAA 2UZ4A 4Q1CA 2FMXA 4G81A 1B6GA 3FUUA 5EJ8A 2RH9B 5JC1A 1T1SA 4ZAWA 2IA5A 2NO7A 1G4HA 4X8LA 2AOXA 3RVLA 3AOEC 1LSUA 1WMSA 2QJWA 2W2KA 4A1FA 2GNAA 2HF2A 1KAQA 2V9YA 1CUGA 5A9SB 3O0TA 5BN5B 3FGPA 2VHTA 3P9RA 1M1NA 1DQNA 1IYZA 2J4FA 4M55A 1KK1A 4EUKA 4Q03A 2DGDA 2BHSA 2WAYA 1K68A 1N7GA 1SZDA 2W71A 3OT1A 3ZDYB 5JSHA 3DPIA 4NK4A 1U1CA 2QVGA 1V5GA 2I4NA 4DVGA 1VRCA 3FSJX 3QE0A 3EBLA 1BE8A 3PQDA 4LGMA 4AG3A 1EUCB 4RZXA 4CQNA 4LJYA 3LBHA 2NO5A 3ZGLA 3EORA 4UUNA 1N2GA 1XWWA 4LKOA 2UVPB 3OE1A 3ELCA 1NWCA 2UUOA 2VDKB 1IBCA 3UXEA 3W1EA 4AN1A 5BMOA 3MWEA 2QSUA 2R1UA 3KR2A 2J0VA 2L18A 2IW1A 5CMLA 3R7WA 1ABEA 1R0XA 4MDHA 1USIA 1OFUA 3B8EA 1NM5A 1T2VA 3HRHA 4AWBA 4EY4A 3PYMA 4JYPA 1G55A 1UDBA 4ALIA 1G7CA 1KPHA 2IYLD 2Y0DA 3EW9A 1KMIY 1ESEA 3A4TA 3ZWCA 2P3SA 1GG9A 1NXOA 3RSCA 3RHTA 3G1WA 4G4GA 2JLBA 5DWQA 4P9NA 1GWNA 4OGFA 4AJ9A 1XCLA 4GQAA 1S1MA 4LK2A 4LMRA 2JH3A 2E6KA 3RS3A 1GFSA 2OL4A 3PGVA 3OZCA 1MZPA 3KUKA 3WJPA 3TSOA 3Q3GE 1KR5A 2O2YA 1NJ8A 4TN5A 1CUHA 1QRAA 1R6BX 2A7XA 1NUHA 3NCTA 4PW0A 3VRHA 1GNLA 5CM2Z 1CIPA 1OT3A 2Q5LA 2ZDGA 3PNSA 4JAVC 3UT5A 4CKCA 4E07A 1J99A 1Z18A 2XI4A 1M67A 1LU9A 4KI7A 2QY6A 2YXZA 3KS9A 3VOAA 1K1EA 5FB3A 3A2LA 4MV3A 3EIHA 5JS8A 2BBTA 4KE7A 5UKDA 1II8B 3E70C 1DUIA 1HT2E 1NG9A 1QB7A 2E2WA 3W2IA 1E0JA 1WNTA 1QWSA 2PL5A 4LDRA 2V97A 4OHRA 5C8YF 2CJYA 1QE5A 1YC5A 2V6JA 2Y71A 1URPA 3LJKA 2ZYSA 4K5QA 2ON6A 2ZSDA 4X7BA 5ALQA 3RR2A 1E1QD 4R2LA 4L8WB 4J29A 5ADWA 2AX4A 3LWNA 3URKA 4GUAA 1TQ4A 2PUJA 4M9CA 3ZDRA 4G07A 5B37A 4KZPA 2H31A 3FYUC 2H1SA 5K8UA 2YV1A 1JPNA 2AV6A 5BOSB 2FG6C 4B2PA 5E1DA 8MHTA 1S2NA 2HU2A 2REBA 1NA5A 1SXJA 3SSAA 1SUWA 5ECYA 5MF6A 1X86B 1GM5A 3WJ1A 3LG2A 4FN4A 5KEIA 3W9UA 1QCZA 4C9BA 3IJ5A 3AF1A 4WNAA 3TDMA 1ZH8A 1L5WA 4NFSA 4CF5A 3IGFA 1OLUA 1QXSA 1WSAA 3A9UA 4DA0A 3BF7A 2ZTUA 3B3AA 1SUIA 4YT5A 3A1UA 3UG6A 4G0YA 5K0TA 3I2IA 3WLAA 1Q19A 1KZ1A 1W88B 4JELA 4QUAA 2GCOB 2BEVA 2UVDA 1QYXA 9LDBA 3I0NA 3LLSA 4R8MA 1T6XA 3AB7A 3IS3A 4FBLA 3WWZA 2H8EA 1J2UA 1EVYA 4O4HF 1F0PA 5K0NA 4FXOA 3EEQA 5FUWA 1DZIA 4DIEA 4GZLA 2QXYA 1ZJZA 3N2NA 5IDYA 5TV2A 4YJGB 4AM8A 5JATA 1VRVA 1RD4A 1G3MA 2P6OA 1O9BA 5G1OA 4DV2B 3D5QA 1YS2X 3D3EA 4DV1B 1KOLA 1ZCBA 1GPWB 2CSUA 4LVOA 3C43A 1EJ6A 3C0KA 1J8FA 1DQSA 2VYFA 3DV9A 1T91A 3LI2A 3MT8A 3RAJA 5AIBA 1BOOA 4B3DA 1QQAA 1BN7A 3U7JA 2JL1A 3ABSB 1YRYE 3G49A 1TKBA 3LM8A 3PUVA 4AKSA 1P0CA 2F8MA 4EJSB 1GDTA 4CM5A 2ZWOA 2FPGB 2FR0A 3T6KA 3OUUA 5AUPB 1WCIA 3LWQC 1JJVA 4LJ8A 2D8AA 1JBKA 4PS0A 2YH2A 4GMGA 1QP0A 1WDWB 2OZLA 4UZEA 4JLVA 3GLQA 3VR4H 2KQUA 3K12A 3TLMA 1KMCA 2JIBA 4QLAA 3ZU4A 1W4CA 3L93A 4XYBA 5FTWA 3C1OA 5EQDA 3V7QA 3NK7A 2YIMA 4CIBA 3G68A 1QR6A 3OSUA 4YY3B 5GZ1A 1P4RA 1FVHA 4L4ZA 5K0JA 4WK6A 1ZCJA 4S3MA 2B0CA 3BHMA 3TX6A 1I7NA 1W4ZA 5BRJA 1AKNA 2ZANA 3QXHA 4BN4A 2AXNA 2WU0A 2ZT8A 2D1TA 3FSGD 3KZXA 3CCFA 2XVXA 5L6LB 1QSGA 3MQFA 4B44A 2PVSA 1UWLA 3WLEA 2OTMA 1HSZA 4PU0A 1Q7GA 1E63A 2V7EA 1OOEA 4TRNA 5B6JA 3LC1O 5EWMA 3JQAA 1Y80A 2Y6UA 3KZCA 3ZHCA 5LOVA 2HQRA 4MWEA 4RK7A 3MW8A 4H7PA 3SPXA 2KS6A 3T9FA 3GUCA 3CYFA 1ZK3A 3WWCA 1G98A 1LLUA 5C1PA 3K0TA 2WJHA 4HUJA 3MOSA 1ABFA 1GQ2A 1VJ0A 1BDJA 1JLLA 4RMGA 1I4TD 2ZB2A 3K5PA 4L5BA 3EPRA 1CS0B 2OKCA 1TO1E 3NC0C 4JIMA 4TTVA 5MFPA 3K0BA 1NKVA 5B2ZA 3Q3CA 2HADA 1XD9A 2OV6A 2VDWA 2W83A 4YMWA 3M81A 3I9LA 5FUYA 1J2JA 4OHVA 1PF7E 3EBPA 5BYAA 2R7KA 1JYEA 1RI3A 4NJMA 3FHJA 2CNLA 4TMTA 1RM4A 3BUSA 3QXSA 4HH1A 1YBFA 4ZFNA 1U2DA 3M82A 1WO8A 1MT0A 3GWZA 1LNZA 2JRLA 4FGLA 1M0WA 3I6ZA 4WE3A 3FWKA 5KJ6A 2Q1UA 1F38A 3MS4A 3OT5A 2W2KB 1PF5A 3DL7A 3L7AA 4ETWA 3CVWA 2UYPA 4HRAA 4XM0A 4D0GA 3X3HA 2E85A 4II7A 3ZK7A 3VJRA 4QPCA 5KMGB 1M1NB 1UPCA 2VDNB 1R8YA 3HADA 4QYXA 4RSHA 3ZCPA 4C4TA 5CM9C 1MIHA 3WMWA 1TJPB 3HGQA 3OT1B 1Y4ZA 2V4MA 3BTOA 3H99A 2WSIA 1BMDA 2I66A 3NANA 4Q3DA 5HQTA 1SKMA 1ENOA 4W7SA 3P0RA 4WK4B 5LP6C 4W5NA 2Q28A 1JDBB 5JAZA 1RJWA 1YNOA 2JANA 4QRDA 1PGOA 1LRLA 4W8OA 4AZTA 4EAQA 3SLKA 5JDCA 3RFVA 1PT6A 1PVVA 2WQ7A 4RF4A 2GTHA 4IS3A 1U0FA 5LA6F 3WA7A 3AY7A 1NQVA 2AW3A 1CP2A 1Y7HA 3RO7A 1WLSA 3J81k 4IJ5A 3JQ6A 2OAEA 3NWBA 3NATA 1E8DA 2P75A 3R7WB 3P97A 3ZWVA 2HO4A 4WSOA 2CCJA 3MF4A 4ZYYA 2FFHA 1IN1A 4Z3DA 5CB6A 2C95A 3MYRA 1Q0SA 2G07A 4RK6A 4XQ9A 4JC8A 5JQGF 2WSSD 4O33A 1YU6A 4E5VA 3CWCA 1OYVA 2W6IA 3GB9A 2WA2A 3QU9A 1Q7EA 5CT8A 1U0NA 4DSOA 1J39A 3OY2A 3HG7A 5LUAA 3T5BA 1L3BA 2FQQA 3UJNA 1N6LA 1N2IA 1E64A 1E9EA 3S7ZA 5I8PA 4BNLA 1VQPF 4ILKA 4XEUA 1O58A 4YJHA 5E4TA 4KPFC 3OJLA 1EQ2A 1ONPA 2XYRA 2O6LA 1Q44A 1TMYA 3MT9A 1NRXA 3PNVA 5G53C 1ZPDA 4N03A 3LBFA 4WV3A 1MV5A 2G67A 4RL6A 2O1XA 2PT6A 2BI8A 4KIFA 4XR4A 2BMVA 2DKOA 2ORIA 2R7LA 4HB4A 4ON9A 4X3CA 3WNCA 4YAUA 2GR9A 4DCPA 3NMUC 2I80A 2QEXF 3UT5B 1PEYA 2Y05A 1JIQA 3H18A 3G5UA 4G5RA 4P92A 4XDGA 1AQIA 2VGNA 1E4YA 1OTHA 2BUAA 2GPTA 4DRYA 1X1QA 1XTKA 2VUSA 3HGMA 5D6OA 1BO6A 1QORA 3EH2A 4FJ1A 4FFVA 3CW8X 4HFNA 3W5HA 1YZYA 1SJ9A 3EXFA 2CFSA 3ZGNA 1UZNA 1A8IA 3D0KA 3WZ2A 1O97D 1UXKA 4LNUB 5EMMA 1S7GA 2PGOA 2J5KA 4I8XA 1KEEA 2E9SA 3REQA 5DN6A 3GJ7A 2AJTA 4QVKA 2M6KA 3GVCA 2I7XA 3TOCA 5TGZA 3KFXA 5IU6A 1GNTA 2YWFA 1VMKA 3ET4A 4JJZA 3TCXB 4OKIA 1Y9AA 3K20A 3VHXA 3SHFA 3VR0A 1DEAA 1ZUNB 3DT9A 5PNTA 5JNUA 4W9NA 1LEHA 2ZXEA 4GOMD 4IJUA 3NXSA 4W63A 3L4JA 1PYDA 3GDOA 4UHFA 2JFWA 4HLUA 3SEFA 3A3NA 3JAMA 4ERNA 3FTPA 2OQVA 4OTZA 1N6HA 1L4EA 3K9LA 3VDRA 1G6OA 2GRUA 4OH7A 4WNAB 3S8YA 2XDWA 3B78A 3HB1A 3ICQB 1KRXA 2IUEA 3DUFA 3LDFA 2G7ZA 4WX2B 2DR3A 3R3UA 4QGSA 3TQOA 1H0HA 2BT4A 2HIMA 2YWHA 4X6YA 1H2WA 4NATA 5G1PA 3ZHSA 1CVLA 4OHYA 3GDHA 1JEQB 1MB0A 4WFKA 4JLSA 5CP8A 5MN4A 2I2CA 3H2JA 3NEPX 1EB8A 1LDEA 2CMFA 1JY8A 1C9JA 1PYOA 2ZRBA 2HRRA 3D7NA 4HEQA 4JXKA 4MVJH 4RYLA 1KSJA 4YAWA 4AW9A 2B6NA 1R8XA 4BV8A 3EVTA 5A3RA 2WG2A 3FGOA 4H7FA 1FX0A 5CJJA 3F6SA 3GFGA 1NUTA 4M7RA 2AI3A 3CRW1 3I1JA 3SEZA 6ABPA 3H1BA 4DXDA 2BM1A 1XDBA 1IOZA 1JB1A 4KQEA 1OW3B 1K2VN 5FOSA 4D8YA 4H3HB 1ZR4A 1M1KH 2W4MA 1RDFA 2YZGA 3PEFA 5JAOA 3P2YA 2GAFA 3BMQA 1H2FA 3LTEA 3GQBB 5L4SA 2UXDB 1XRMA 1A72A 3ZU2A 2NV2B 5I9LA 1IZ7A 1O08A 4D4KA 3IE0A 4E5KA 1OWOA 4B6FA 5IULC 1CEEA 2VLIA 5CDTA 1WCIB 3TKYA 2H4FA 3P27A 3DWFA 1LBSA 1NUAA 4FI3C 1K0FA 1EK0A 2HWUA 3SC2B 4KGVA 2BGGA 3RYHB 3BJZA 3BCRA 4JB3A 1COWD 1UFVA 1L4NA 4Q1AA 4TVSA 2GVZC 3AFHA 4D9GA 2H3HA 2PGJA 2FN7A 3FHTA 2P2SA 4ICIA 5ALLA 3QPVA 3WYCA 3F8SA 4ZEVA 2OY0A 2IYEA 4KBFA 1F2UA 1KFBB 3B9RA 5AVOA 1EFPA 1O95A 4QM7A 1L7AA 1V95A 1IQPA 4JUAA 5KNDD 5F2OA 1FPQA 2O2DA 1M5TA 1NG1A 3DZDA 1NMZA 2BONA 2ERYA 2QZSA 1R0LA 1YL7A 1RRPA 3RDPA 1WD5A 2IP2A 3AVPA 2R0QC 1NAHA 2R68A 4BQNA 2H4HA 5CPBA 1XEFA 3UJCA 1I7LA 4BNKA 1WTCA 2Z5LA 1N6RA 2XPCA 4NBRA 5TS2A 1G1MA 2Q5QA 1PNTA 2Z56A 3BG5A 3GIWA 3LH5A 4L8VA 3O1IC 1U8XX 2BSXA 2GEFA 2DEUA 4FHGA 5MGNA 1GCOA 2X9LA 4RQAA 5F73A 3TQTA 2VT2A 4C5AA 5L6MB 3I52A 2CKMA 3CRMA 5EWMB 3T7CA 5D1HA 4B8YA 5LOVB 2XCTB 4MPRA 2XLBA 3TM4A 3E9EA 2OSBA 4PIVA 1R4NB 2EYUA 1TQDA 2JK1A 3I3SR 3I1YA 1LCIA 2ATXA 3BL6A 3CNNA 3T9BA 2EX4A 3KT3A 1KBQA 1GTJ1 3BD8A 3OIUA 4HRVA 2G1PA 1XQ1A 2QM0A 3K70B 1TUBA 4YJFA 2FSHA 3I42A 4ARUA 2DJ5A 3WZLA 3UAZA 1GZ0A 4WBNA 1IE3A 2CXRA 2GEDA 2NU8B 2H5EA 4WKPA 2VUTA 1SVSA 1OFIA 1QIGA 4TOIA 1E8MA 4I1PA 2JGKA 3KJZA 4FUTA 1Y7TA 5AJVB 4YI5A 1L5QA 4XFDA 4DLUA 1KFCB 5HY1A 4NHEA 5JZSA 4QTZA 3E1KA 4NJMB 4TL7A 3F7NA 2M1XA 5F1YA 4US2R 3IRVA 4C4XA 2VPPA 3N8NA 1YITF 2O2IA 3IVAA 4LHYA 1IONA 4KAXA 3SXJA 2BGUA 5C5IA 4EZBA 3AU9A 3QVWA 4RIEA 2HRZA 2RHGB 5A4IS 1GZHB 3HO8A 1YJCA 5F33A 1BROA 2IXFA 1Y8RA 4CV0A 1SIBE 2MJLA 3CPHA 4IUCS 2X6RA 5FLEX 1BMFD 1W19A 3C98A 4TLDA 1CVIA 4YLGA 5E7IA 3RARA 2VPIA 3W7VA 2EXXA 3EFBA 2D1RA 1RAFA 4M22A 2C4VA 5A1JA 4RPHA 3LC0A 4KXNA 4MI1A 2AC7A 2CD7A 3VPFA 3VKVA 3WB9A 2Y1OA 3IIKA 3NC1C 1CUVA 4PC6A 3DE0X 4XCQA 3IHKA 4AMBA 2ZBUA 4LAFA 4OA8A 5CRIA 2FSSA 1QF7A 4MEAA 3FHCB 4Z4QA 4D56A 1FQOA 1XWIA 1NULA 4XVHA 3TE7A 1PFQA 2PAAA 3OU7A 1LBTA 1N57A 5CCBA 2AFIE 5BSVA 3K2BA 4L4SA 4BLWA 4Z3KA 1U0BB 4DW8A 2RBGA 4S1VA 3JARA 3HSKA 3R3WA 2ADMA 3VO2A 2Z2JA 4LW8A 3GG2A 4NYMQ 4PXSA 4ND6A 1R0RE 2FWIA 1ZG3A 4CW7A 1HX7A 4CIVA 2DT8A 4MW6A 3P0HA 1XKQA 1N75A 3AG6A 4R6XA 4XAQA 4E12A 3KCQA 4BGDA 2GLZA 3KLPX 1T29A 2GN1A 2ZVZA 2PIDA 4HZUA 1ACMA 3OLZA 4QTUB 4YJHB 5IN5A 5TVKA 1GGMA 2YJGA 3AXTA 3ZI4A 4ZT3A 4ND2A 4CMHA 4DIFA 3H6HA 5EIXA 4IVRA 5FH9A 3I01A 1EHIA 3EEFA 4KRXA 1T4MA 1US8B 1GSAA 1TDJA 3NTRA 3FYCA 3LHDA 3DUWA 4YGYA 1NMQA 5KTMA 1CEYA 2DUNA 3RKSA 3JYNA 2DXIA 4RVOA 1GIAA 1P9OA 1PV2A 1SXGA 2BFMA 5H59A 3AJEA 4LJ5A 1GL9B 1VL5A 3EXFB 4UHKA 4WCFB 3UXYA 4DT1B 4EA7A 4Z4GA 1WY5A 4Y6LA 2VTKA 5JXHA 2O2JA 4QC2A 3DBHA 1X77A 1R6XA 3HBFA 1EJ2A 3REQB 4ZVTA 1TYCA 2BP7A 1U28C 2FR8C 2BEJA 4FCWA 3SFZA 1YIAA 3R8XA 2E18A 3FJYA 1N5IA 2VHCA 3TYXA 4BDTA 1IM5A 4BVJA 4DMHA 3INYA 2IYPA 5GVSA 4JWKA 2JJ1D 1M2VA 1BKDR 1DLIA 4OPMA 3GR6A 2LR0A 3ZD7A 5J2TF 3HCWA 3D1VA 4AD8A 2O3SA 3ZGYA 1CBUA 3U2QA 4OYYA 2TRSB 3D0QA 2WBLC 3VDXA 1KZ7B 1M0EA 1THZA 1NI4B 1QGAA 1XBIA 1JPUA 2P3OA 1CUIA 5CFPA 3HU2A 3N58A 4E4TA 3DUFB 2JJMA 4DMUB 2AH5A 4YAEA 4G4VA 4IO1A 4KFTA 5HJ5A 3FWNA 1KF0A 3CZQA 4X3PA 3WBFA 1IUNA 4IDAA 3FTEA 1UFOA 3PVCA 5HE9A 2X0NA 1CF4A 2C9OA 2J5XA 4FYWA 4KLRA 2IXBA 4WW0A 3VTIC 4YAGA 3LHKA 4R0MA 2LTAA 1ZSYA 1EP3B 1PFYA 3LE8A 4W1QA 4O2BB 5ELLA 4EO4A 4E15A 3ZHQA 3IDZA 5BV7A 3O85A 1XQYA 4FDTA 1FTWA 4IHQA 5TEWA 2H16A 5K45A 1ISSA 2OB2A 1BD3A 3RJ5A 3KJQA 4ITRC 1XDZA 1P62B 1SU8A 4QXMA 5HFJA 1E7YA 1FX0B 1QYVA 1KVUA 1UKAA 4J0EA 3VDQA 5JYCA 2REOA 3CLRC 1IUKA 2QJTA 1NBHA 3AL2A 2X7HA 3K2IA 1C81A 3FPEA 1IEVA 3KZNA 2AFVA 3F7MA 1KAOA 2KBFA 4GEKA 3BMQB 1ICIA 3SXPA 3RW9A 3EAGA 1Y5NA 2H2DA 4M60A 4DKXA 1WBBA 1ODCA 4MCJA 3RVBA 1DJLA 2OV3A 3KKNA 1JHMA 4MNTA 4RX1A 4YRLA 4PZUA 4FKZA 3B1ZA 1JFFA 3KWJA 3RSHA 1S3IA 4I3GA 3QPBA 5KDDA 1K88A 2CXSA 1ZAKA 1LZLA 1N25A 3IE2A 4CQMD 1UJCA 4FYJA 2V4UA 5DM4A 4ETIA 2QN3A 1TW2A 1GA6A 3NU1A 4EY8A 4MUEA 1E1RA 4BGIA 2BSAA 1J8DA 3O1LA 5EP2A 5SYNA 4C3OB 4W5OA 1NNLA 2J09A 3BWEA 3W5VA 1K4YA 3OSZA 4HS9A 3DOIA 4BMYA 4DUGA 3RSZA 1U6IA 4UBOA 4PE5B 5PGMA 3H2YA 3AKEA 2LV8A 4GO1A 2X0DA 3RASA 3LC2O 5KPDA 3UFXA 3TFOA 1XCGB 4EYQA 2ZSJA 1C9KA 1U3DA 5MGBA 5FJJA 3A32A 3BL5A 4M9QA 3QNMA 3LCUA 1GQSA 4F7WA 3C8LA 1A5ZA 1O6GA 3OQ6A 2J59A 1R5JA 2VTBB 1Q8RA 4HV4A 1U3WA 3K2QA 4PLYA 4KITB 1PWXA 1N8KA 3KXPA 3AZOA 3P10A 4P7JA 5CT9A 1NMSA 3QOXA 2ZB7A 3FOWA 4FP9A 3DZKA 5TIIA 3A9RA 3K2EA 4HEA1 4QFBA 3THSA 3B6NA 2KLBA 3UICA 4K9NA 5LQAA 3NIWA 4ZODA 3E53A 3PRJA 3UCXA 3Q7IA 4MV7A 1RLMA 1TUBB 4YJFB 3TUIC 5BW4A 2F4NA 2QZZA 3W05A 3HKCB 3B6ZA 1P3DA 2X6QA 1F4PA 5IYZA 1XAIA 2G1KA 3M83A 3P2KA 3QUTA 4MTLA 4QPNA 4QUHA 5A3VA 2JHAA 2QLBA 3VC1A 2MT9A 2HJWA 2ZWIA 3C3YA 3K92A 4V0QA 4R3WA 4ASUA 3LT4A 2O8CA 3PPYA 2YZMA 1PZEA 2D8MA 1QH1B 3I23A 3N9IA 2DETA 2R2GA 2COKA 2PXCA 2JIZD 2VQ3A 1IXSB 1TUEA 3QKWA 3KQWA 3INGA 4PAMA 1CF2O 2Z2KA 2OP0A 1Z8DA 1LC0A 3GLHE 3PJGA 4KIUA 3LFHA 1ZVQA 2P9HA 4YT2A 2P5UA 5IJAA 3E3OA 5H83A 2YZ7A 5DTMA 3HNRA 3CX4A 3TD6A 1B16A 2JGNA 1TCCA 1QNFA 3IJRA 5IBPA 5KSYA 2L2QA 1MT3A 2JDID 4L3VA 1XL1A 1Y8RB 2BJVA 2CLDX 3CLVA 4E51A 2D2IA 4MKGA 2VP2A 1SH7A 1KGSA 2QM3A 3AFGA 1NJIH 2H92A 3O1JC 5FBWB 2VHUA 5FTKA 5EHIA 4ZGBA 1NUUA 4E5UA 1NXPA 2FP3A 3NUGA 1UZAA 3LUJA 5HZGA 4DPMA 4QYMA 1I80A 2AKYA 3OO0A 4ND4A 3DVAA 3SM3A 3B2EA 1GGFA 1XZ8A 4KFRA 2C1EA 4URXR 3NO4A 2Q62A 4CG3A 2RAUA 4L72A 4DXHA 5EUCA 1J6UA 1X3SA 3PC2A 4Y9UA 4R2MA 2Y68A 3KQKA 3VPGA 1VJ5A 2XB9A 1WL8A 5J2UF 4R71A 2LZ0A 1AQUA 4HAOA 1JHXA 1VB5A 3TJZA 3JARB 2XOEA 2YBEA 3IMPA 1BFDA 2FE4A 1V8PA 1ZYUA 2NVBA 3TIVA 5FDFA 2PXXA 1FTYA 3WKBA 3EGDA 1KY4A 2Y76A 1MHPA 2A1IA 3L0CA 4DQDA 5KKCA 4PYJA 1CUEA 2D62A 2ZZNA 3JZIA 2O07A 1SIUA 4LWOA 1YBVA 1FYDA 2OBYA 5CA1A 2QT1A 2VT6A 1RLIA 2Z3ZA 5TJ9A 4D57A 4AJNA 2BW0A 3TZQA 4HZUB 1T0HB 3P32A 4HDNA 3PFBA 3M4YA 2VDUE 3U31A 1POWA 3FAKA 1EX6A 1EXMA 3M5WA 4J6FA 2HZ7A 2BMWA 4BIIA 5I8WA 5L40A 3UK6A 3L41A 1E2HA 3CW2A 4D26A 2WJGA 4W6QA 3ANXA 3F3KA 4XE5A 1LPAB 2D59A 4EUEA 1O94A 5FQNA 4C89A 3R44A 1PUXA 5AW5A 4I50A 3GLHB 4C88A 3E9QA 1XPJA 2XUOA 5IVDA 4MWDA 3RF6A 2EV9A 5LWHA 2J30A 1TUGA 2Z8YM 3L46A 1V16B 1I51A 2HBRA 2HMAA 2NYRA 5DHUA 4EAAA 1P8AA 4L4UA 1NPYA 3SX4A 1V3UA 3OQIA 3ZCSA 1PQPA 3PU6A 1X74A 2VYNA 3DBHB 1JHZA 1I4OA 3OESA 4L9SA 2ZYTX 3OWOA 4HQ0A 1UKBA 2FW8A 4J4TA 3S7TA 3UB3A 5KYWA 4BQSA 1BEZA 1R1MA 4DJTA 1GN9A 1SVOA 3NHSA 3IA7A 4OO3A 5FCDA 2JJYA 5ILGA 1M6HA 1NI5A 5FFFA 1YRWA 1KI7A 3OCCA 5IT4A 5CU7A 5HKAA 3IIEA 4M36A 4RXUA 3MCWA 4B5KA 4YXFA 4BMSA 3T4XA 1M2VB 2YHAA 2QYHA 2INGX 3I9JA 4LGCA 4QIHA 4TT3D 5U4XA 2NP7A 4Z9AA 3UB2A 5T8KC 3UA3A 3D54A 3RSQA 3ISTA 4F5ZA 2DVMA 2ERCA 2PGXA 2VBFA 4FCVA 4L07A 4WBSA 4Y1EA 2IXDA 2LW7A 2WIAA 3EIOA 3OZDA 4YRCA 5HK8A 1H2YA 3AUSA 3TZCA 3S5UA 4WXRA 3ZHYA 1X2BA 1HEUA 1X1SA 2W2NA 3D64A 3MIZA 3EQ2A 4NWIA 2X3YA 1RLUA 2CJXA 4LJLA 3JVHA 2ABWA 2D1QA 1KDRA 3AF5A 1VBFA 3AOEA 4IX1A 1NVKA 4PBTA 1SMKA 1GPDG 4OMFG 2EDAA 4CQJA 2JVIA 3ESYA 3L84A 1N78A 2NMUA 1EZZA 4NEGA 4CIAA 3W4JA 3OOWA 2AMJA 3MPUA 1E6EA 1MO3A 3NWOA 1WY7A 2Q41A 4G0OA 2V7TA 1FX1A 2WINI 1NTOA 3BBPA 4TQAA 3R77A 1T2NA 3Q0TA 2NO4A 1PLKA 3AM4A 2C3MA 2QYSA 3PNPA 4RL4A 3UIEA 4B71A 3G1UA 5KNBA 4GFDA 2I1WA 4KE8A 2NNWB 2KTVA 3BSFA 2B34A 3JQCA 4RC9A 5IBRA 1HI9A 4WFQA 1CK4A 1J23A 4GMKA 4QBTA 4E2ZA 5A3SA 3NV7A 4N7JA 1UDWA 1G42A 2TMGA 1KP2A 2O52A 3P2MA 4JBIA 4KYUA 5A05A 1Z82A 3D7MA 4F6RB 1F6WA 3GFBA 1L5OA 1Y63A 1TI7A 2G36A 2OBMA 4AJ4A 3L6BA 5CVUA 4WHMA 1JFFB 1QGED 3X43A 4B31A 1EGAA 1GGHA 2H1WA 2Z3VA 4BRSA 1W93A 3HKDA 4S24A 3EUWA 2VXOA 4KQ2A 1DHRA 4Q3LA 1RI4A 5K3CA 5KHOC 1QFMA 3U4GA 2MINA 5BMVB 3HWSA 3L7LA 1H1DA 4YYEA 4DLXA 2GWRA 4CLRA 1JHPA 3ON1A 5JCJD 3PXBA 4RD0A 3OJEA 3MCVA 3CMAF 4BKMA 4UVIA 2KHZA 1S2DA 3K15A 2WD7A 2JI4A 2I3AA 2IW3A 3O8QA 3RRYA 1OT5A 2BMAA 4L22A 1JN1A 4TKZA 3B20A 2FSPA 2Q3MA 4XSVA 5G02A 5K8TA 2WE7A 4C6TB 3UFXB 3H75A 5DK4A 4EF6A 5ARDA 5HGXA 5FPPA 3MHPA 5AHOA 1OU4A 4HMQA 5TJHA 2VPXA 3T52A 2JLCA 2IU3A 2P9TA 4P4SA 4IH9A 5E4JA 4GG1A 5DBEX 3M2TA 1NKSA 1X19A 4RGYA 1FYWA 1RPAA 4RNCA 4YVFA 2HI0A 1X7DA 3Q3VA 2ZJ5A 4O5AA 2XNSA 4ZQIA 1PV4A 3EY4A 3CF2A 2GYWA 1FU7A 5JD4A 3G0OA 1F4LA 2X9GA 3PQ5A 3DWGA 3KEOA 4G0ZA 3K9NA 3U39A 3V8MA 4YCMA 3KC2A 2D6FA 1L5YA 5KNCD 2EX0A 3R0VA 4ZHYB 4C7JA 1QOZA 4D9FA 1VKJA 3BWDD 4IVQA 4II2A 5IYZB 2ZUDA 3FYUA 5DWVA 5HX7A 1IAQA 2V65A 4IJKA 4XUDA 3RBVA 4M7OA 4IIHA 3O8OB 2O8CB 4R8KA 3EGXA 5E3HA 1DOHA 2ICAA 3GJYA 1BXZA 3HY6A 4Q0MA 3TVTA 5M5BA 3AM1A 1YBAA 3LUDA 4PG8A 5AJYA 1TC1A 1VPLA 2IYXA 1TAGA 2XE4A 2EARA 2IOFK 3QKSA 4H1HA 4U7JA 4CIDA 2F64A 4XW2A 4DAOA 1GQQA 5IWCA 1G59A 1QFZA 2VYCA 4JA0A 3AHEA 1FJGB 2NU7A 4O2AA 3AR9A 2C1ZA 2QR3A 3OD1A 3R5JA 4N12A 4DEVA 1IG3A 3UPUA 1SCNE 4LZJA 1E2EA 3I04M 1Z29A 3E9DA 3ORHA 4K8RB 3PJFA 3ABOB 5KVVA 2IITA 2KTUA 3BA1A 3FNGA 3SQMA 3BFPA 3DONA 3KJGA 4YUAA 4RWZA 4RY8A 3HP4A 1AY0A 1R64A 1RXUA 3H5OA 3ORRA 4HLCA 1JP7A 2XNDD 5HDBB 3W9BA 5HZMA 3U3DA 4BYMA 5E8JA 1AM4D 5P8WA 5KKNB 1K5DA 2HDOA 4OOEA 1J2RA 4HMPA 5DPMA 3DVAB 5LB4A 4MGHA 3RS5A 5HRCA 3OECA 1Q7TA 4JCCA 4IP0A 4XYMA 2I9KA 2VXBA 3A1SA 1R0KA 5LXTA 1WMFA 2YJ4A 3COSA 4HYYA 4Q5IA 4AICA 1ILEA 3O21A 3SAJA 4AUMA 4EYOA 3QX7A 5HM8A 3DTTA 1GJRA 3D3WB 3GJ4A 2H59A 1ML4A 1TM7E 1ZDMA 2V5AA 2IKSA 2RSLA 3UW3A 1QFSA 1DFIA 3OJWA 3OWXA 3O9ZA 3OEYA 3ZU6A 1RCUA 3EX7C 3NTOA 3U9LA 2O0LA 3SJ7A 1FU8A 1NKTA 1TW3A 3EGDB 2PD3A 4IGFA 2CEAA 2P7IA 1U7DA 4MZXA 4X6UA 2AZ4A 2MWMA 2QSYA 3KZKA 3D2AA 1UMCA 3T3HA 3VR3D 2HN9A 1EU1A 3WJ7A 5C8ZA 2JZOA 3IEQA 5CA1B 3MDOA 2JFVA 4JLPA 4P7GA 4P93A 1NNUA 2J46A 1XCPA 3T7IA 2ZVYA 1MAUA 1W48A 1GTSA 1PNRA 2NAPA 5AVRA 4HDNB 5I45A 4CMEC 2HLPA 5EKTA 2X8BA 4C01A 1JI3A 2NTVA 3N0WA 4MGIR 4DN6A 4EUNA 5CBPA 5K4HA 1LK7A 3UUGA 1H05A 2G28A 3HVJA 5JY6A 2MR6A 1OH8A 3I12A 2O8VA 2QTFA 2QNRA 4NJOA 4NL4H 4DB2A 4WZZA 1CQZA 3TEFA 3DW1X 3N8IA 4QO7A 1G3IA 1AZWA 4KB5A 4TMKA 5SZJA 4I50B 2YZ2A 5HK9A 2XBLA 5LM3A 2EJUA 3H5TA 4G1MB 5K3AA 1HR0B 4TZ0A 3WHIA 1M2EA 3F74A 4ZD6A 3FX2A 3T80A 3AF3A 4WGFA 3T3IA 1XUOA 3M3DA 4XYEA 2Q3CA 3OQIB 1P7ZA 5AVYA 1UOEA 2P77A 1W85A 2C54A 3LPAA 3O2QB 4GAEA 4KLZA 5D5HA 1Z8NA 2J5BA 4I1SA 5CVTA 1Q91A 2ZR8A 5TGDA 4HH3C 5T4FA 5EO3A 3CGGA 2IOFA 2F3TA 1Q14A 2VDVE 1CR1A 5I7RA 3SGLA 5LQSA 3MINA 1IIBA 2WWRA 3HJFA 2ETXA 4MLPA 2I6GA 3MCQA 4A4DA 3ZDBA 2F8TA 5I3CA 2VJBA 4Z6KA 2WWVD 1W36C 1XXHA 3F0FA 3JTMA 3KG2A 1E2NA 3W6NA 1C1XA 2CXTA 1G8MA 1XA3A 4YH1A 3K96A 4RD3A 4ZZ2A 1I94B 4EI9A 1KARA 3ITNA 5B1IA 3GCWA 4WOKA 3LWBA 4QAQA 1C8BA 2VWPA 4UUMA 1HEYA 2OGZA 3FUWA 3OEHD 4AP6A 4AY4A 5A4DA 4ARIA 1N33B 2R96A 1QRDA 4LBWA 1K4MA 3GFOA 3TPFA 4BO8A 4DLSA 4H9GA 4CM7A 4RQOA 1TO2E 2B21A 2DPGA 1CY8A 2XD4A 4YP9A 1KDYA 2PRKA 1D1TA 4KQCA 5DJ5A 4OUKX 4PYIA 4H3KB 1PGNA 1XZDA 3OEWA 3C70A 4P6VF 4FGUA 3IVCA 4ZCPA 4PGAA 4F4CA 1II9A 2AYZA 2NQTA 2VS1A 3FCUB 2V8BA 4KXFB 4NRDA 4EJMA 4R2XA 2E1PA 8ABPA 4Z9XA 5LP6A 2HTFA 3C3WA 3R9XB 3JTEA 1A69A 2MMGA 3AZPA 4MIOA 4NIMA 2WPNA 3TJMA 3FOZA 4IV0A 3BD9A 4LVNA 2ZRKA 1ZD1A 3QFFA 1RCTE 2PMPA 5JLAA 3UGJA 2C9BA 3ENZA 4B43A 2CMGA 3LGXA 1XF9A 3ZE9A 4D4MA 4D5GA 2UYKA 3BK2A 2DBVO 3PPWA 4CKZA 5IEBA 2WHQA 3SZMA 4IM7A 5AI9A 4QT0A 3OZTA 4EVIA 2GPAA 4BMVA 3PFWO 3GK3A 3LUKA 4NS4A 1VQ8F 1WB6A 2WYWA 4REOA 1N3YA 4HYQA 3C7AA 5ALOA 5IX8A 4EMTA 2QE7D 2J9XB 1YS4A 2MMCA 4P22A 3VSBA 4G1CA 2B25A 2DC1A 1PZFA 1NBMD 3WGOA 1NAIA 4GOLD 2KYRA 1UC9A 2YUIA 3WISA 2AWOA 4YPVA 3BGIA 3DZ8A 1D4ZA 4F91B 4KREA 1JW9B 1SZCA 2DPYA 2OHOA 5EMJA 4OATA 2PQ2A 4IAOA 1R9JA 5LMCA 1J09A 3SE0A 5C4IA 1V1MA 3ROKA 5ILOA 1V39A 2R8YA 3AY3A 4B40A 3OFSA 3ZNPA 2RIPA 1GFWA 4BFSA 2C5SA 4L2IA 4CHGA 2HFKA 2PX3A 4PQEA 2E87A 3NGLA 5FKJA 1VB3A 2OPBA 4XUGB 6REQA 4P4SB 5EZYA 1EGHA 4UBJA 1KRWA 1KMQA 4I5FA 2Q4OA 4MR8B 3INNA 3GROA 2V7UA 1FFEA 1XTQA 5EJ7A 1K7YA 1GU1A 2J3JA 2ZI7A 1T0KB 1XWFA 1E3MA 3Q87B 3GNLA 3RK4A 4BTLA 2YJ3A 1TNDA 2HT1A 2I4RA 2VK2A 2HLDA 3BSYA 1XU4A 3ED5A 3TWOA 4URVR 2UYCA 4F21A 2QTMA 1OZGA 1B15A 2W6ZA 1L5NA 2EC5A 3FYUB 4MUIA 5CFOA 3AFIA 5TY0A 1J7HA 3R6WA 4XJTA 4ARBA 3FFAA 2HYDA 2IP1A 3U13A 4JR0A 4H6PA 2PLWA 3EGXB 2FAXA 4NZZA 4A2CA 3SQNA 2IZ6A 4X3MA 3H2KA 4A0QA 1XDSA 2Z4TA 4IJ6A 1VKZA 3GUYA 2OLEA 2X9VA 5DCVA 3AF0A 5KREA 4AF6A 3CNQS 3DBIA 1WXEA 5D85A 4OX9B 4I9NA 1UP7A 4DZTA 4RJLA 1WB9A 2NU7B 2XJ4A 5HP7A 4GYYA 3L07A 3W8NA 2XCRB 1A1VA 5HZKA 4HBZA 2AF3C 2MYTA 1K98A 4Q48A 1N0WA 2CD9A 5ERXA 4J3NA 4E32A 2P6PA 4TKMA 5JZ9A 4I36A 3S0YA 1MEOA 2HF7A 5FOXA 3CSUA 4DCCA 2Z08A 4RD6A 1RACA 4DANA 1IEQA 2GRJA 4Z2YA 3GRAA 3D9QX 5IWAB 2W5UA 4IX9A 2I6XA 1Q1ZA 1XTIA 3A70A 4QUGA 3RIGA 4KVAA 6Q21A 4JEHA 1FYVA 5FL7A 4PFJA 3FR8A 4Q3NA 2WPDA 4MYDA 3KUDA 5FULA 4H7HA 1TC2A 4FONA 2V6GA 2QNBA 2W58A 4B32A 2C99A 2C58A 4LBYA 5LXTB 3LKBA 1NVEA 2A9JA 3O8CA 5C37A 4FWTA 3W5CA 4BKUA 4FFSA 4S0XA 4C4SA 4PNEA 1U9ZA 3QVVA 1L3IA 4J0KA 4X54A 5AVXA 3CEAA 3AYXB 3W6UA 1E32A 1JG4A 3NUZA 2VJPA 1GV0A 1VLQA 5KSPA 1M6YA 1AU9A 5IAOA 3ZC3A 4LZPA 3RSLA 1LC3A 2PSEA 1D6SA 3NFYA 4MJ3A 5CW1A 2D1YA 2E4YA 5IMSA 3AHFA 3KU1A 3LZ6A 2QDXA 5C1OA 1YZHA 5FEMA 1UMCB 3OO1A 1UWCA 4LKRA 4QXOA 4BNWA 3ITEA 1T3GA 4Z54A 3EULA 3CNOA 4QHYA 3WK7A 3FPGA 4RYDA 5H80A 5D00A 2PO7A 2WUWE 3FCOA 1WU8A 3GJQA 3I6BA 3KR0A 3L82B 3M6VA 4QYTA 2NZYA 5A3QA 1EK6A 5CBPB 4BT7A 4X1IB 4CKEB 1IZYA 2XDAA 3T3DA 4KOEC 4PSVA 4WPGA 4K2AA 3PNYA 4M7PA 5LB2A 2IPNA 3T3PB 1Z7YA 4CCYB 2BR5A 2WYVA 5MN6A 1JZSA 3E9RA 3GPDG 3OIYA 1C0PA 2LBPA 5IFKA 2ZB3A 2YXPX 4EIWA 2G0AA 1FU4A 3MFYA 3LSYA 5IVHA 2WDZA 1UBTS 3CE9A 4COKA 2NUTB 1W85B 3AIMA 3C7TA 2HJ9A 4CL3A 4YHHB 2JAPA 4BMZA 3RBXA 1T5DX 3TOSA 3EBOA 1FUEA 1GGEA 3RU7A 2EKPA 2YRXA 4NXNB 2CW5A 1N9KA 2YMPA 3BRSA 3NRCA 4D4IA 1FS4A 1R10A 1SBQA 1QCCA 2Q6OA 3OP4A 4ROTA 3WB0A 2DFDA 4IIUA 3KT6A 1KWKA 1CG6A 1WSBA 2IU0A 1E79D 1E0KA 1EG7A 3AL0C 2D0PB 3V00A 4TX1A 2SECE 3THYB 3MD9A 3OZUA 1XXHB 1X87A 2WF5A 3G02A 5JZOA 1W73A 2D5BA 1YZGA 1XHLA 2CXOA 1PKXA 1HRDA 4EELA 5LOVF 4PX5A 2WT4A 5F7OA 3B9QA 3LMKA 5EHNA 3AHJA 3IERA 3TXXA 1PQYA 3RJ9A 4CFYA 5A0FA 1AGXA 3KVOA 3IPAA 3I8SA 4BMXA 1E6CA 3B6JA 1Z8FA 4BLSA 3FCEA 1L5MA 2G9QA 1UBLS 4IR7A 3NHMA 4QL3A 1A5AB 1XTPA 3VQTA 3W5SA 4CFZA 3ZJTA 3TNJA 4X94A 4I46A 3HXPA 3LCRA 4PFKA 1H4SA 4P0PB 1OR8A 2DWPA 3B1KA 1HDIA 1RKUA 1P19A 4NFLA 4RDIA 1C80A 3R75A 1QFXA 4N9QA 1FA9A 4WCDA 3D2CA 3FVQA 3AERA 1TZJA 3Q6IA 1R5BA 5LP6B 4CIWA 3ZCRA 3MAJA 2V7PA 1UI9A 1OWPA 2NSDA 1SCAA 1XV2A 2YWGA 3BEOA 5JJCA 5CEJA 4Q12A 5KYXB 4L0CA 4FHZA 3AVVA 5FAXA 4C8EA 2FZGA 3AR5A 1VP3A 2QTAA 4JZYA 1U3UA 2HB6A 4ALJA 4YPOA 3DEKA 3IUPA 4YECA 3BIFA 1QGOA 2VC2B 1CR4A 3B6MA 3UK7A 2PL1A 1ECFA 3CSDA 4Q7KA 5JO9A 1U9IC 3CO5A 4JI2B 3IKFA 1I3NA 1P0QA 4YT8A 1QIMA 1N6NA 4X0EA 3GDGA 3PX3A 3UAXA 2Z4RA 2V3VA 4FLMA 3DAHA 1YFLA 121PA 1D9ZA 2GRAA 4N5DA 4OF4A 2C31A 3EODA 2FV8A 1MABB 1KPGA 1WW8A 2H1RA 3DEAA 4RDHA 1KK3A 4DM7A 3AETA 5LNK6 2QPTA 4YRAA 2ZIGA 1T0AA 2VJCA 3C6QA 3L0IB 3DNPA 1KJJA 3HN6A 1ATZA 4X1KA 2BM9A 2PYDA 4J1QA 4D82A 1RQRA 4XZ3A 4G0VA 4NC9A 4CM4A 1QD9A 3L1HA 1PXWA 4FJ0A 1DVRA 5EIHA 3U0BA 1DJNA 1GZ3A 4F9EA 4MEJA 5TLSA 4GR5A 4G4IA 1O9GA 4RIGA 4LK3A 3C3KA 3LO8A 4GI5A 3PUZA 1I0ZA 3VNQA 3OMWA 1C9DB 1NRIA 1UMDB 2H5IA 1GCGA 1CY4A 3DHVA 1HFEL 3CCLF 4L2IB 2VRNA 5AIAA 1OBOA 2QV0A 1TK3A 2VP4A 3PNQA 5DI9A 5T6BA 1GPBA 3TN7A 2PHNA 4RTKA 4TWJA 3VTAA 1GPMA 1WHSA 4LY0A 4JI8B 2FMKA 4I9FA 1YCGA 5BYBA 4KDEA 3RSO