2RHTA

Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3-cl hopda
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
283
structure length
283
Chain Sequence
b'LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNAMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
molecule tags Hydrolase
publication title The Molecular Basis for Inhibition of BphD, a C-C Bond Hydrolase Involved in Polychlorinated Biphenyls Degradation: LARGE 3-SUBSTITUENTS PREVENT TAUTOMERIZATION.
pubmed doi rcsb
total genus 107
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rhtA00
4K5QA 4C4ZA 5AI6A 4GBGA 3D2CA 4FBMA 4CI9A 5CT4A 3STXA 1E89A 4PV7A 1UOPA 5EI5A 5DNUA 4KAJA 3RKSA 5LZ7A 1GPNA 4IH1A 3ICVA 3HI4A 3QPCA 5CXXA 5K3FB 1LPSA 3O0DA 2WJ3A 4FNGA 1WB6A 2GBFA 4I19A 1PJAA 1GXSA 5AKLA 2PUHA 3DKKA 4KAFA 1KEZA 4UBLA 5EFZA 5LYYA 1LPAB 2Y6UA 2ZYSA 5KWIA 4AZ3A 3D0KA 4H7EA 3G0GA 2RAUA 5AM3A 1YA4A 1DT3A 4EB0A 5LP1A 3D2AA 5ALYA 4QNNA 3OM8A 5EHXA 3WA7A 1N8SA 1SCQA 1AGYA 3IULA 2WG2A 4Y2JA 1W75A 3BIWA 3M3DA 1N1MA 4PSCA 1LLFA 2C7BA 4OB6A 2OQVA 2OQIA 4W9RA 2XUKA 5FPQA 5DJ5A 3UMJA 5K3FA 2YASA 2DR0A 3VVMA 3N0TA 3WZMA 3DDUA 5ALMA 2ZJ6A 5CT5A 4D9JA 1S8OA 1EVQA 3C5VA 1VZ2A 4P08A 2XMCA 2PUJA 2PM8A 5K3DA 3VISA 2FJPA 4W1RA 4YPVA 1QFMA 2WLSA 5ALDA 2WHQA 3OURA 2C58A 1ISPA 5FXMA 4F5ZA 1W1IA 3BF7A 4UFPA 1JU4A 2XMBA 5T4HA 1IUOA 3D4LA 4G8DA 1XZLA 2QVBA 4L3WA 1QGED 5IH7A 5C8VA 5ALFA 1THGA 3QBJA 1T4MA 4CG1A 4H7KA 4U2EA 2QOEA 2JGFA 1K5PA 4TPKA 4EY8A 4M0MA 4NMWA 4KRYA 1XQVA 1IZ7A 2BGNA 4G9GA 4BTLA 3DCNA 2XUHA 2DCMA 1SCKA 4GW3A 5ALLA 2PU7A 4WDQA 2D5LA 1CQZA 2QTBA 4J0IA 1XRRA 3B3QA 2HFJA 1BU8A 3WKBA 3R40A 3BF8A 3BDIA 4DGQA 4HRXA 1XZJA 4C88A 1DINA 4J0GA 5HF5A 1SCIA 4B85A 5CTAA 4X3CA 1JJFA 3FSGD 3WIBA 4DNOA 1G66A 3U1TA 4FOLA 5D6OA 1QTRA 4K6HA 4B0OA 3H17A 1WM1A 2YH2A 2WIJA 2XUGA 4LXIA 2WUGA 1QZ3A 3IUNA 4QDUA 5FUMA 4MEAA 1X2EA 3PDCA 3NGMA 4U2GA 1IUPA 4AMZA 2Z3ZA 4KR0A 2B20A 3FLEA 2QM0A 4UHFA 5KWJA 2AJBA 2G5TA 2NW6A 4BVJA 4UHCA 2PSHA 1U8EA 3KOOA 3R0VA 3DQZA 2J4CA 4QDOA 3BJRA 5AH0A 2XMSA 5JARA 1ORVA 1AC5A 2ACEA 5DYWA 1H2YA 5K3CA 4C4YA 4BE9A 1PFQA 3RLIA 5CBKA 4G4IA 5AK5A 1QIDA 2HA2A 3OPMA 1K6EA 3FNBA 2CBGA 4QEKA 5JANA 2XT0A 4P92A 2CMFA 2XB6A 3D3NA 2WIDA 5CRIA 2WG1A 1BRTA 4UBNA 5EHQA 3G9UA 1T2NA 3C6ZA 5D3KA 2HHAA 5ALGA 2ORYA 2QUAA 4NZZA 3O95A 1U4NA 2WG0A 2VT6A 3ICWA 3PF9A 3WL6A 5AIBA 4BP9A 1W6RA 4CCYB 1H22A 4MYSA 4GECA 2X76A 5D3ZA 2I3DA 3C70A 4L72A 5AM0A 3HRHA 1JU3A 1A88A 3W04A 5IVDA 1QTIA 3FYUC 3I2FA 4ZV7A 1XQWA 4HZGA 3KWFA 4LYDA 1WPXA 3MVEA 5EGNA 3ZI7A 3G0IA 3DEAA 3K9BA 4FFVA 3V1MA 4L9AA 5LZ4A 4Q05A 4H7DA 4BDTA 1QONA 2R8BA 3AJAA 3H2GA 4J3JA 1CUIA 4O08A 4IH4A 5BWBA 1OCEA 1CUZA 1JJIA 1P0PA 4BCBA 1YB6A 5AKZA 1GGVA 5JAHA 1OILA 1DX4A 4B84A 4XIIA 1ETHA 3A6ZA 1CQWA 1JJBA 4BCCA 5JATA 4EZIA 3E4DA 2V97A 2O7RA 4QLAA 2HIHA 3EIOA 3V9AA 1EK2A 2OCGA 2QZPA 1K8QA 4KACA 3O4JA 1EB8A 2ECFA 2ZJFA 1E3QA 4X90A 4QDXA 3F98A 5FDFA 1ZIYA 3IURA 3BDVA 2ZSIA 5A6VA 2HA0A 2OG1A 2VF2A 5HCUA 1ZGBA 3LLCA 3VJKA 3M82A 4MYDA 4UPDA 4B83A 1NU6A 2OPHA 5DTJA 3WIOA 4L0CA 2QR5A 1KU6A 2DSNA 5HQ3B 4HVTA 4V2IA 1AX9A 3FLBA 3R3WA 3WJ2A 1Z68A 3WK7A 4OCZA 4N8DA 1U65A 3EF3A 1W4LA 4M0FA 4GI1A 2J3QA 4HXEB 5LZ5A 3AIMA 1YB7A 1ZIXA 3FCXA 4RNCA 1OXMA 4EHBA 4G8BA 3QPDA 5EIHA 4UBMA 1XRMA 2QXUA 3WKCA 1EI9A 2K2QB 2O2IA 3DNMA 5ALTA 2WFZA 1JMYA 4ZI5A 4NVRA 4CFSA 5AJHA 4E15A 1EDBA 2XMDA 4ZWNA 2Q0XA 3WK8A 3G0CA 3DLTA 1QJ4A 1AQLA 3QMMA 2GZRA 3ZWQA 1Y7IA 5JD4A 4X6UA 1AMNA 5K5EA 3HYSA 5IVHA 2HU7A 2BUCA 4X6XA 3ED1A 4S0XA 2DQZA 4GXNA 4QE3A 4PSUA 5AI4A 1MJ5A 4AN1A 1UOQA 1X70A 4FKBA 4J0JA 4CIAA 1TCBA 5CT6A 5HF8A 4M0EA 1AZWA 3VDXA 4W63A 5DLPA 1QIIA 1JI3A 3FWHA 1UK7A 3HSSA 4GDMA 3KXPA 4AO7A 4G9EA 1BS9A 2V96A 4E11A 2JGJA 3EQ9A 2ACKA 2G63A 4KEAA 4YASA 2WTMA 1VA4A 2JBWA 4DNPA 2D0DA 4GLBA 2DFPA 4DSZA 5LZ9A 3K2IA 5AOCA 3QMVA 3R41A 1TCAA 3ANTA 1XZHA 2OGSA 3STVA 3JW8A 2ZYHA 2PU5A 2G4LA 1G5FA 2Y2VA 1ZD2P 3O4IA 1VE7A 2WQZA 2CB9A 3F96A 1QLWA 3EQ8A 1XQYA 2O2GA 4H7HA 1R3DA 1DT5A 3I2JA 1CUCA 2OGTA 3WK9A 3AFIA 3DJYA 3I6YA 4X94A 1QO9A 2WTNA 3G9XA 3R3VA 2C4HA 1XZDA 3QITA 2QRUA 1P0MA 2PVSA 4UFNA 4KJXA 1NU8A 1ZI9A 5D7BA 2GBCA 5AK4A 2RHTA 2I03A 4PF1A 1CUEA 2WU3A 3KD2A 4LIPD 4AB1A 4DMKA 1MX5A 3WK6A 1W52X 3LS2A 2XUJA 3FBWA 5HF9A 3DS8A 1UKCA 1MAHA 4EY5A 1HDEA 4KYVA 1K4YA 1HBJA 3WLAA 1LGYA 4DSAA 1GPLA 4JH0A 4ZXFA 1Q0RA 2WILA 4HAIA 1A7UA 1UXOA 4MXDA 4AZ0A 5ALUA 4Z49A 1VOTA 3L1HA 1D07A 4TVKA 5HQ3A 2ONCA 2JEZA 1F0PA 4J03A 3WK5A 4UBIA 3HC7A 4Y2YA 1R1DA 3ILSA 3BXPA 1YCDA 3AZOA 1EDEA 3PUHA 1E8DA 2WUDA 2RIPA 3YASA 2XUDA 2VAVA 3T52A 4X91A 3R3XA 1MX9A 4WY5A 1HQDA 5DYTA 3SX4A 1XROA 2P8SA 1JFRA 1TQHA 1GT6A 4PQEA 1UT6A 4N8EA 2O2HA 5AKKA 3NWOA 3H1AA 2RGUA 5J3JA 2OLEA 1DWOA 1XRPA 2GYVA 3I28A 2PX6A 3PUIA 2EEPA 1QIEA 3H18A 3DL7A 3E1GA 1BEZA 5BWCA 3A70A 5HZGA 5I7UA 2JGKA 1ZJ4A 4X85A 4JYPA 2WJ6A 5HFAA 2XMGA 2PBLA 1P0IA 4Q34A 4TGLA 2CUTA 4QA9A 1CUUA 3ZLVA 4UUQA 2XQGA 5AHXA 3WMRA 2V9ZA 5FOQA 4KE9A 1A8UA 3L1IA 2CKMA 2HA7A 5ALRA 4H35A 4LHEA 1J07A 1CV2A 2GYWA 1TK3A 4OU4A 2I3ZA 1UK9A 3DYIA 1PV1A 4ZRDA 5ALQA 4Y2TA 4K6KA 3BL8A 5JD6A 3FCYA 4G4JA 3FYUB 4U2DA 1CLEA 1BROA 3WL8A 2VEOA 1QIFA 1LPPA 2WUEA 1O6GA 4BAZA 3W9UA 4OB8A 2PPLA 5C8XA 5DNWA 3WYNA 1CUWA 2ZSHA 3IB3A 2W22A 5IKXA 3BE8A 1BE0A 5DYYA 1ZD3A 3HACA 4DMHA 1EA5A 4PW0A 1F6WA 4BVKA 2VSQA 4ZV9A 1ODTC 2ROQA 3C6YA 2OAGA 2VAXA 2J4FA 3WWEA 4X95A 4OSEA 4WY8A 3H0CA 2CZQA 2JGLA 2XMZA 4B82A 2Y2UA 1EH5A 4OUKX 3MGAA 3V1NA 1YASA 2QJRA 2JIDA 3C5WP 3DD5A 3NOXA 5E4TA 5FV4A 1KU0A 2BJHA 2RHWA 3H2IA 4IH9A 5AIAA 2H7XA 3I2GA 2ZJ7A 5AM4A 5AP9A 3STWA 1LPOA 5AI9A 5JYCA 4LKOA 4U2CA 1Y37A 5I9IA 5T4BA 2BFNA 4A16A 4UBJA 3AZQA 1CR6A 5AI0A 1MX1A 6YASA 3TRDA 1AUOA 1RP1A 4OYLA 2EDCA 5KREA 4N5HX 4LXHA 3W06A 4B0PA 4EA6A 2WHRA 2FUKA 3STYA 3HLKA 1XZIA 4C89A 5K3BA 1XLUA 4BATA 1ZJ5A 2V98A 4C6HA 5ALVA 3QZUA 2H1IA 3GA7A 2XUPA 1FFDA 4P93A 1VKHA 4J7AA 1ZI8A 5LZ8A 4IQ4A 4Y2QA 4XVCA 4X71A 3I6MA 1IUNA 2HU8A 3R3UA 4U2BA 1YAJA 5ALJA 4JYMA 5CH3A 3KDAA 3C6XA 4HRYA 5CURA 5E4YA 2Y6VA 4CCYA 2Z8ZA 1E66A 1YA8A 3GROA 5CH5A 2XE4A 4UHBA 1VJ5A 1R4ZA 3I2IA 1MNQA 5AKXA 2FX5A 4YK7A 1GPKA 4DYHA 3GBSA 4H77A 5ESRA 5AK3A 3O9MA 3H1BA 4MQMA 3OTQA 1XQXA 3VJLA 3QVMA 3ESDA 2BUAA 4OU5A 5FKJA 2YXPX 4N8SA 3DKRA 1XKLA 3IA2A 1C4XA 1LPNA 4B9EA 1H2XA 3TJMA 2X8BA 3AIOA 4HS9A 4FLFA 3QH4A 5ALWA 1YAHA 5LKAA 1FFAA 2XUOA 5SYMA 2J3DA 1TCCA 3S8YA 5JAOA 4H7FA 1XZGA 1R50A 4Y2SA 2HM7A 1F0NA 3H04A 3PE6A 5JAUA 4AN0A 1DX6A 1EVEA 2GZSA 3FYUA 4OB7A 5EIEA 1F8UA 2VJDA 2PKYX 3O4GA 2IITA 4KRXA 4UHDA 5AOBA 3AUKA 5HFNA 1XLWA 1K63A 1MPXA 5HF6A 3C8DA 4JNCA 2HFKA 1TRHA 5T4FA 4NS4A 2GBIA 2OCKA 4INZA 4EY7A 2BCEA 1QE3A 3ESCA 1TKRA 1EX9A 4FHZA 1CRLA 4DNQA 1J2EA 3OG9A 1MT3A 3WKDA 1R9MA 2WIFA 5CH8A 3A2NA 3WKEA 3JWEA 1WB5A 5FLKA 4UBKA 2WHPB 1FFBA 4CIBA 3AINA 3C43A 5HK9A 1YS1X 4Y7DA 4AX4A 1WPRA 1THTA 1XZMA 2CEKA 3PF8A 3WKAA 4BRZA 5K3AA 3HJUA 3WL7A 2XI4A 3ZV7A 2I78A 2JGIA 5CW2A 4BTVA 1TAHA 2BGRA 4Q82A 2HU5A 1E8NA 2XUIA 4Y2UA 3PFBA 1EB9A 3I2KA 4HXFB 2XDWA 1E8MA 3LIPA 4Y2VA 4DTCA 1ZD4A 3OOSA 3G02A 1UWCA 5JD5A 3FSGA 3UUEA 3Q8WA 1IVYA 4CG3A 3ANSA 2QKYA 2IX9A 1SOMA 3PICA 3G9TA 1QO7A 1CUGA 1VLQA 5JZ9A 4G4GA 3EQ7A 2XMRA 4XWGA 2VJCA 3FVRA 3AZPA 1HLGA 4F60A 2WM2A 4FWBA 4ARBA 4B81A 5CMLA 1UFOA 1VXRA 2HA3A 2QUBA 2HADA 4EY6A 1DTEA 5A7HA 1FSSA 1NX9A 4DMCA 1HPLA 4RE5A 2WJ4A 2XUQA 2Z5GA 3D2BA 3WJ1A 3MUOA 4AO6A 3G9ZA 1CEXA 2DQYA 3CXUA 1XZEA 3MUNA 7YASA 2BKLA 3I1IA 4DLNA 1H2WA 2Z3WA 3QPAA 5AKJA 4HTAA 1CUSA 3PFCA 1BEEA 4H7IA 3CCCA 2CJPA 1W76A 3FLAA 4UBOA 3JYHA 4P9NA 2HL6A 4BE4A 4H0CA 3WL5A 4FMPA 4I3FA 3F9CA 3GUUA 1CUHA 1LBTA 3C6BA 1ZI6A 4Q1VA 5AM2A 3C87A 4HXGA 2Z8XA 1EXWA 2QT9A 4C01A 3EBLA 2JEYA 3R3YA 1JKMA 4FTWA 1ZOIA 4ROTA 2WSLA 4ZGBA 3Q0TA 4U2FA 1VE6A 1VZ3A 4BZWA 3F97A 3CN7A 4N5IX 3ESAA 3HZOA 3RK4A 3OC0A 1QIGA 1DQZA 1R9NA 4G5XA 2VATA 1G4HA 1M33A 2H7CA 2AXEA 2HA4A 4IHAA 4UHHA 1ZD5A 5HK8A 4OD0A 1P0QA 4FBLA 5EHNA 4FLEA 4B80A 2XMQA 1DQYA 4MEBA 3E0XA 1EDDA 3H2JA 4F0JA 1XFDA 5A62A 4MJ3A 5DNVA 1TIBA 2WHPA 1GKKA 4EY4A 1UK6A 4PNZA 5FRDA 3W2TA 3AILA 2QXTA 4BRSA 2C0QA 4C87A 3STUA 4Q3OA 4QDTA 2C0PA 1X2BA 1XZBA 5JAPA 3IDAA 1CUFA 4QDZA 1QIKA 3H2HA 1UZAA 4X93A 3ZLUA 5ALIA 5CT9A 1EK1A 1CUDA 3IVMA 5ALKA 1VA5A 1G42A 4RPCA 4K2AA 2VA9A 4WJLA 3LP5A 5E4JA 2B9VA 1QOZA 4J0KA 5JZBA 2JGMA 3DL4A 1CUVA 4XX1A 4X97A 5AM5A 1Q83A 2WFMA 4W1SA 2W6CX 1YS2X 2XLBA 4MQLA 3ZPXA 3FOBA 2VTVA 2B61A 1UOOA 4G8CA 3WA6A 2O7VA 3X3HA 1BN7A 2OAEA 2AJDA 3R3ZA 1Q0ZA 1EHYA 4BC1A 1J06A 2C5GA 5C7YA 1IMJA 3WI7A 3K6KA 3WZLA 5LIPA 1BCSA 4X00A 1H2ZA 2H7YA 1LBSA 3WYDA 3ESBA 1CVLA 1XRLA 5AI5A 1LNSA 4X7BA 2XLCA 1CUAA 4MWSA 4H18A 4KE8A 3IUQA 4UFOA 2AJ8A 4IO0A 5HKAA 5ALNA 5LLSA 3AIKA 5AICA 3A2LA 3D59A 5T4EA 4QLOA 2AJCA 4DM7A 3F8SA 1XZFA 4PSDA 1FFEA 5ALSA 4QWWA 4W1PA 5LKRA 1XKTA 3V1KA 3WWCA 3DOIA 3I2HA 1ZGCA 4FDMA 3H19A 3N2ZB 1MNAA 1XLVA 1SFRA 1ORWA 5EIAA 5ALZA 2ZVDA 1N5MA 4E14A 4BC0A 4J0HA 3SWWA 3D7RA 1RYYA 3RARA 1BCRA 2HA6A 3D5EA 3TGLA 4BVLA 1CUJA 2VQ6A 1LZKA 3CCBA 4AQDA 5C8ZA 4C4XA 3W9BA 2R11A 5ALXA 5BV7A 5ALEA 2IIVA 1A8SA 3E3AA 3I6ZA 2PSEA 2G5PA 3P2MA 4EBBA 3HEAA 1MN6A 5AOAA 2XQJA 1E5TA 1MAAA 3V48A 4Y2RA 2WFLA 1QIMA 2VJBA 4BBZA 1XZKA 1ODCA 1WOMA 4AXBA 5A71A 1CUYA 5AKEA 1L7AA 2AJLI 3I1YA 3DYVA 2RONA 5JADA 2PSDA 3FYTA 4QZVA 1DU4A 4ZREA 4GHWA 4PO3X 1J1IA 3LIIA 3G0DA 2DHDA 3WK4A 1O6FA 5HKBA 4FFWA 2OGZA 4X6YA 4Y2XA 4JEIA 5DTIA 4GWLA 1FFCA 4WCVA 3SK0A 3LCRA 2Y1KA 4LYEA 3C45A 2X5XA 1FJ2A 2E3JA 3IUMA 1MTZA 3HABA 5AKHA 2WUFA 3G8YA 3TEJA 3CN9A 3VJMA 2FJ0A 1XZCA 4X92A 4UHEA 5ISMA 1N5RA 2H9YA 1ACLA 2HA5A 5JZSA 1WCYA 2XUAA 2XQIA 3G0BA 1ZICA 4ARAA 2OCLA 1H23A 5A7FA 5IVKA 2VJAA 2XQKA 4FNMA 3QM1A 4OYYA 1B41A 5H3HA 4GEGA 5FPPA 3BIXA 1UK8A 1MO2A 5BOVA 5JALA 1L7RA 5IVIA 5I8PA 1BN6A 2PSJA 5K3EA 1CFJA 4WDRA 1C7JA 2YYSA 2HRRA 4H7JA 4Q3LA 3GZJA 4WFJA 2PL5A 1CIJA 1JT2A 1YR2A 4BDSA 3VXKA 3G7NA 3WWDA 1R88A 5AKIA 3UUFA 1ACJA 4YX9A 5KBYA 2ZYIA 3S2ZA 3VVLA 4E46A 4DIUA 1LPMA 1GZ7A 1QFSA 3IBTA 2WU4A 1UKAA 4BCDA 4RE6A 1ODSA 1WHSA 2XUFA 3WQHA 5JASA 2C5FA 4Y9SA 1U2EA 1RWQA 2BUBA 4JUIA 2WFLB 2DHCA 5F4ZA 5YASA 5AKYA 3WWOA 3QYJA 5DWDA 2GYUA 2DHEA 2QJWA 5AKGA 5AK6A 2WKWA 1QIHA 4ETWA 4RGYA 1C7IA 1LPBB 2BAGA 3DOHA 2OXEA 3PI6A 5A7GA 3B5EA 4CG2A 4BAUA 1MU0A 3WWPA 5AM1A 2JF0A 1Q84A 1WHTA 5LZ2A 4CCWA 4ITVA 5FP0A 3U0VA 1XRQA 2JGEA 4WFKA 1LZLA 4B6GA 4KAAA 1CUBA 3ZLTA 5ALOA 2VT7A 1CUXA 3M81A 1IZ8A 1AURA 4DNFA 3STTA 1SC9A 3BWXA 1GKLA 2B4KA 1DWPA 4MWTA 3M83A 3T4UA 5ALHA 3GFFA 4AO8A 2EDAA 3RM3A 3GELA 3IIIA 5AI8A 4BZZA 4AMYA 2GBGA 1XRNA 3SC2A 1B6GA 4I4CA 2PSFA 4Y2PA 5E2IA 5AO9A 1QIJA 1I6WA 2XQFA 4A5SA 2LIPA 4QWMA 1A8QA 2QS9A 3O4HA 3IUJA 4W1QA 4A23A 4B9AA 4KE7A 3VKFA 4LXGA 3H2KA 5JIBA 2ES4A 3HXKA 2OCIA 3QMWA 1HKHA 1USWA 4BYMA 1WB4A 2WIKA 3W05A 1L7QA 3BJMA 4BP8A 4BB0A 4XJVA 1AKNA 4B7ZA 1Y7HA 5SYNA 1VXOA 4Q3KA 4DMFA 4F21A 4OPMA 3KSRA 5CT8A 2UZ0A 3B12A 3F67A 4FLMA 4KE6A 4WFIA 1JMKC 1YSCA 3FAKA 4J0DA 2HDWA 3KWJA 1GQSA 4K6GA 3NUZA 4J0CA 5A2GA 2HRQA 3O9VA 3A2MA 2RI6A 4G1FA 5EHZA 3V1LA 5ALPA 1UKBA 1DWQA 2WIGA 4BAGA 1XZAA 1CPYA 5C81A 1GQRA 5CXUA 4EUSA 2ZYRA 3L1JA 1EINA 2QMQA 3C8HA 3FVTA 1HL7A
chains in the Genus database with same CATH superfamily
4BO8A 2HSGA 1AKVA 3FE2A 2PIDA 2QDXA 4C4ZA 2FSPA 3OZXA 4PHCA 5AI6A 3D2CA 4CI9A 2HCJB 2WDPA 5DGTA 3KOYA 3CGGA 2VTBB 2WP8J 2DTEA 3ITDA 3HYNA 1H42A 5DNUA 1FK8A 3PA8A 4NYJR 1MVOA 3OSZA 5L51A 1G1AA 1GUDA 1ECBA 2IFTA 2PH5A 2Y1GA 3DPIA 3P9QA 4FFPA 1GQYA 4UDNA 5CXXA 4RFSB 4WN3A 4BMSA 5H4GA 1LPSA 1YQDA 3MRXA 4ASUA 3WGKA 3GWZA 4GWKA 3WL3A 1BWPA 1UJMA 3KUKA 4LZLA 4I4TF 1WB6A 4V0NA 4YRTA 1H0SA 2OO5A 3GLGA 2QAJA 3RPEA 3N05A 5JE8A 4J76A 1GXSA 4W82A 1GAJA 2GN2A 3E81A 2K6GA 5LQKA 3LL7A 1PF7E 5LYYA 4EHNA 1GU7A 2Y6UA 3QE3A 5IBPA 2IYEA 3H83A 4WACA 1IK4A 3N2KA 1RHKA 3GYBA 4HB0A 3LWDA 1P80A 3RVDA 1IATA 1XNJA 2NVUB 5KYNA 3MAJA 5EY5B 4W5OA 1DEXA 2FFHA 3TIGA 1UJCA 1RZUA 1L5FA 2V7QA 2OD7A 3MCVA 4JC5A 1B23P 4QNRA 4DQVA 2RHHA 1J0DA 1YA4A 4ZU3A 3E35A 1CE8A 4E33A 1ZNQO 1ZM2A 3UK0A 3OM8A 3VR4D 2HIMA 1FTQA 1KJQA 4Q37A 4L9WA 4ZVQA 4C7VA 1WTAA 5BURA 3H2SA 4WGFA 1EWTA 5JJLA 3DEJA 5C1BA 3O26A 4NHOA 5JDCA 1SCQA 2VBFA 4ENSA 3GNTA 3GLFA 2HCFA 4Y2JA 2X5NA 2GSWA 1EUQA 4DANA 3L7LA 2HDOA 5I47A 2RH4A 2PK3A 4R83A 1XCJA 1H69A 1RRGA 3AFMA 4LDZA 4PSCA 4ZQGA 3M3DA 2Q3EA 1N3IA 1K8ZB 2L42A 2C7BA 3WGZA 4EITA 1VKNA 5JY6A 1W5SA 1W34A 4V24A 5KNCA 1RYHA 2OQIA 1MO3A 2JAHA 3I32A 1CETA 1FVXA 2KQUA 3A9WA 1AS2A 3L3BA 3PEVA 4Y0NA 5DJ5A 3I39X 3T3IA 5BW8A 1EGAA 1KKUA 2HWWA 2CBXA 4KW7A 2XADA 4RD2A 2DR0A 3ZEAA 1YDWA 3WZMA 2YWJA 4DBZA 1G21B 1V6SA 3VNAA 1II9A 1U2GA 1KMCA 4LJSA 1NQOA 1K0UA 5ALMA 3WLKX 4B4DA 2FPPB 2UZ1B 1SR8A 4H6WA 1Y3BE 5CT5A 3MJVA 4CMIB 2EW2A 4D9JA 3ZD6A 4EY3A 3AIIA 4ND6A 4EI8A 4ZI7A 5JRDS 4JYZA 3RRJA 2IHJA 2P9ZA 3LZDA 3HKBA 1GPAA 2ZSKA 1HFEL 2IY8A 4FEGA 4O02B 3A58B 1L5KA 2XDQA 1ZO8A 1IBLB 2JLSA 3JQ7A 4MOWA 1TLLA 4G4SO 1FYDA 3RV4A 4MRSA 2AQKA 4P08A 5J4LA 1XO1A 3ROKA 1YQ9A 1C1XA 3DBLB 2O2YA 5B1DA 3DGFC 5I9NA 1TQ8A 4O5AA 1U6KA 5A0FA 1C3EA 2KM1A 4MQFA 5A3JA 4YXWA 4B7XA 4CIYA 4XW2A 2Z3VA 3ML1A 4A6EA 4CEHA 4QARA 2PO7A 4JXZA 2CN1A 1PX2A 1ZXBA 5GONB 1DAMA 4NRDA 4DHWA 4I9GA 4BYGA 2PG3A 1YRYE 2FW8A 1Z08A 1YVPA 1ISPA 4JJ4A 2NM0A 1MA0A 2V7UA 3ZZ1A 4ZYUA 4MVWA 3TG8A 4CEIA 2JLWA 1PFYA 1W1IA 4E51A 4G07A 3N39C 3K9WA 4IINA 4WADA 1E0KA 2VPPA 4UAGA 1XZ8A 1W96A 3CNEA 3LUJA 1U99A 4HDNA 5F9MA 3D4LA 3VHXA 4B2LA 4E5DA 1U8CB 3R7SA 4DWWA 3KJXA 3V7UA 1MTOA 1Z47A 1XZLA 1NM5A 1U28C 4Q4CA 5FWNA 3ZJVA 3KDSE 4HQNA 3DP7A 3KL2A 4K0RA 3ZV6A 4ENRA 2QAGA 4XGIA 4BX0A 4DB2A 3K9HA 2VL7A 4EPTA 1Q3HA 4RHFA 2BBOA 3CR3C 4GZ3A 3Q3JB 3T7RA 3QBJA 5EXPA 4CLDA 1VL2A 5G4LA 1AY0A 1YONA 3DT6A 3AVYA 1L4LA 4PSKA 1YB5A 3NHJA 4Z2YA 2A1UA 4DEYA 1RAHA 4EHKA 1LSUA 4YP6A 5F21A 2B7LA 1GY8A 5EP1A 4UEJA 3GCXA 4EHFA 1FNMA 1K5PA 1U9JA 4CWAA 4G24A 1VLHA 2BVNA 3FFBA 3S2IA 3WJ7A 1XQVA 3L0ZA 1YZUA 2V58A 2I6XA 3IALA 4IKEA 2PA0A 3SX0A 2JCBA 3TWOA 4YREA 1Z5NA 2BGNA 5B58C 1F8GA 3IQXA 2FZ4A 2R7NA 3DFUA 4RD1A 4DG5A 3DCNA 2XUHA 2YOFA 1LLQA 4RY2A 5JS8A 1FSZA 1U8UA 1TADA 2PH1A 3HUUA 1T6NA 1ESMA 4GW3A 4JP5A 4F6RA 1U5AA 2W2LA 3JASA 4PLGA 3IJPA 3NDJA 2O1SA 2X8LA 3LUFA 4J0IA 1M2FA 1U1FA 3B3QA 1N5JA 1CJVC 5TQ2B 3NT4A 3BF8A 1CF4A 1Y8RA 1DRVA 2IH4A 3BDIA 3GUVA 2GXSA 4TX1A 3FIUA 4HRXA 1ECJA 1JTFA 2PXAA 3O90A 5C7OO 1DINA 3SI7A 1MF7A 2HV9A 4UUNA 3WLLA 4J1TA 3PDHA 4BFLA 2BGUA 5L3QA 3IUEA 3T5DA 3KJFA 3KKMA 3NCHA 4KHPB 1L4HA 1GCUA 4WY2A 1C7FA 2FSUA 4L2IB 4RMJA 3VU9B 2E6UX 4RTQA 4XOIA 5CTAA 2AKYA 1OOEA 2YNMA 1E3MA 4X3CA 4YPFA 3H9JA 1V35A 2VPTA 3OT5A 4KMRA 1JJFA 2AMFA 3R6LA 3WIBA 4DNOA 3L8DA 1VIAA 1ORIA 3DOUA 4YT5A 1YR8A 3I5YA 3H75A 3H17A 3KZOA 1B0PA 1WM1A 2ET6A 3L5KA 3OP1A 4GSYA 2YH2A 1D0IA 4BFCA 1P1FA 1W7AA 4CQNA 2UZIR 2BKAA 1KDOA 2FI1A 2WUGA 4TRNA 3I5XA 3FN4A 2QD4A 1D4AA 2W11A 1MBZA 1QZ3A 5KSYA 4FT2A 4QEZA 3IKVA 4A0QA 1M34B 3ROFA 1R66A 4LAFA 5KYXA 3EX7C 1N2ZA 2C4TA 4P5PA 4U2GA 1J25A 4YJ2B 1BGVA 5IAKA 1G2IA 4HGZA 1E7QA 1FP6A 1T25A 2J9ZB 2R1ZA 3FLEA 4XRGA 5KWJA 5IDXA 1RVDA 3WY9A 1ONNA 5T57A 2D1FA 1TX4B 1QKIA 2HLHA 3HCEA 3L8YA 4HL6A 4RVFA 4AJPA 1OYVA 3A6HA 3K09A 2BHTA 1YQEA 1QCZA 2IT1A 4YI5A 4D3ZA 1QYWA 4V1CA 2JK0A 1J2JA 5ER6A 3KOOA 3U6BA 1KJ9A 4YJFA 1QTNA 2C77A 4LHZA 1PWHA 2H4HA 4IUDS 4PM4A 3BJRA 3GRKA 3K35A 2HPHA 5TQJA 1ADFA 2ISSD 1X86B 4I5EA 3HO8A 5JARA 1UBGA 1ORVA 2OZLB 1L8QA 3RFTA 5IF9A 4GF5A 1U0NA 4MV9A 3AOEC 1SQSA 3UOWA 2NTNA 2QROA 1CQJB 3I83A 1N5DA 4CTMA 3UAYA 3ECSA 1YTLA 3F4BA 4D25A 3DKIA 5ENDA 4BIIA 5KTMA 4UTXA 3JQFC 4G0VA 2Q5LA 2P2GA 3QLTA 2NSDA 5DISB 5G4KA 5JXHA 5IT9A 3AHIA 3OPMA 3A4IA 4NBKA 3JRXA 3AEUA 3FNBA 2R25B 1SGWA 5I7VA 1E1KA 4CGZA 4QEKA 2UDPA 1XTPA 4P92A 2ZVQX 1H4QA 5LMNB 2A5FA 4O4HF 2JI8A 1SBZA 1TYCA 2ZEJA 4CG0A 3NV9A 3D3NA 2VUHB 1MENA 5B2EA 2E2WA 5CRIA 1X8XA 2HPAA 4G25A 4FCWA 3RJMA 2P9FA 4MVJI 3ZBUA 1HT2E 1QYXA 5TC4A 4MAMA 2F1OA 2AR7A 2WWFA 2BMDA 3D0OA 3ES9A 4QPPA 5CU7A 1C8BA 1U7PA 4UBNA 2Q07A 1XN4A 5BQFA 1YOVB 4P3KA 5JROA 2D13A 2PV7A 3SF8B 4OMCA 4OJYA 1Z17A 3WGYA 4R0VA 4UU0A 4LV5B 3FDIA 3LW7A 4X61A 2AF4C 5ELMA 3MN1A 3T7EA 3CSSA 4DLXA 4KXWA 4NH0A 4DZTA 1SB9A 4QVGA 1OR8A 2OZVA 4OFBA 2P9TA 2GAFA 4NZZA 4WN9B 5EQDA 4BVAA 1KE1A 1SG9A 2X0JA 4Z4CA 5FI1B 1NXVA 1U4NA 4ZCLA 1A96A 4JBGA 3ICWA 5ADVA 3WNCA 3PDWA 3WL6A 4MYRA 5BSTA 3IHTA 3T0FA 1RYBA 5D00A 5HR5A 2BSAA 2QI9C 2FDCA 4XGQA 4S2EA 3PEEA 3U39A 1US8B 3E9EA 2Z95A 2WYWA 3W7AA 4MYSA 1P60A 4UQOA 2X76A 3TQTA 3PXUA 4ZN6A 5LQRA 1RQGA 3C3DA 1RYMA 3B8EA 3KR0A 1KP9A 3L79A 3REQB 3B7GA 3UCFA 1EQ2A 2I3DA 4E4TA 3F73A 3C70A 1B2LA 1HG0A 3T6KA 1LBHA 1PSWA 1T4CB 5I5GA 5DK6A 1Z38A 4BMCA 3JAMA 1J70A 3GLHA 3W04A 4B3GA 2AMVA 3IBYA 4R8MA 1A5BB 5TMDA 2YY6A 1D2EA 2C20A 3JPWA 3Q8MA 4ZV7A 2FCRA 3F7OA 4HZGA 1UM8A 3EDRA 2ON6A 4ZQIA 4JI5B 3IP1A 2E4YA 1Z45A 4BECA 4QAQA 5EGNA 4N5DA 2IYVA 3CQ9A 1MGOA 2E4WA 4P6VF 2WA1A 4J4HA 3AR2A 5B57C 4Y0AA 5H02A 3CVXA 3SC3A 1VB5A 4GD3Q 3V1MA 4JSTA 1BCRB 2QG6A 2CJYA 2IH2A 1C7QA 2FPIA 1A5SB 4LY6A 4R4JA 3M89A 1NZFA 4BDTA 3SZMA 1Z4MA 4CM9A 1QONA 2XOKA 2J31A 2R8BA 3K2QA 3TZLA 4OLBA 1LEHA 2YS6A 3AJAA 1DIOB 1K88A 3GFRA 2YJ3A 2CHGA 3H2GA 2ZCVA 2WA2A 3D31A 3WGHA 4BJ1A 3DEKA 4DXAA 4UNPA 1HDIA 1HTBA 4IH4A 3G7UA 1MLDA 1KHTA 3W5DA 2BE9A 1QMGA 1K8YB 4QO8A 5AVOA 2CHFA 4XA8A 1ZH6A 1J39A 2DVMA 3FWPA 1CT9A 4MKIA 4RMHA 4MVJF 5TGZA 4CM1A 1P0PA 3CLTD 5C53B 4M9XA 4BCBA 3A9UA 4GX2A 1V1MA 5F52A 1YB6A 4BO0A 4CMAA 2XGGA 2FMIA 4TM7A 2C5BA 2UVDA 2Z04A 2V54A 1SU7A 3CUUA 3WICA 1DX4A 1KI8A 4PTLA 4RF4A 1OIVA 1ETHA 1T4BA 1B42A 1CQWA 4ENVA 2KYRA 1YRQA 2YZ2A 5TJHA 1AZLA 3OX4A 3MWLA 2VDNB 1UJ4A 4IDGA 5JATA 1GGEA 3AF4A 4AXXA 3LGAA 2EARA 3V5NA 2VZ9A 3W3AH 2HBYA 4YV1A 5A5VA 5LVAA 2O7RA 3OCJA 1W4ZA 3GRYA 3QTLA 5ES3A 5JPIA 4EEKA 4O4JB 4R7TA 5FFMA 5K3SA 1J9EA 4LISA 1TMGE 1NP7A 5B3AA 1HDGO 1NIPA 1ZWLA 1KR5A 4KACA 3LY7A 4JR0A 2C07A 2FW1A 4KN6A 1ZK0A 2BE7A 3RS2A 1S3FA 3QU7A 1P61B 2ZYGA 3NG1A 4YBZA 2IEGA 5D51S 3AL0C 3Q40A 3WSTA 5AQ1A 1WY7A 3ZHVA 5KQRA 3WIUA 4TVBA 1GCIA 4CM4A 1I3KA 2WOJA 4MUMA 1YMVA 4GEKA 1RIIA 2CVQA 2WAOA 5A4KA 1Z4QA 2VF5X 5EAIA 3UBMA 4FC6A 1U1IA 1Z9BA 1M6YA 3FNRA 1U3TA 2IZ0A 3O2NA 3RYIA 4D82A 5K0ZA 2LDBA 1ITZA 2RAFA 3CZQA 1SHJA 2HTEA 3DLCA 2SECE 3IB6A 3JZAA 2JBAA 3LVRE 4YA6A 1ZS9A 1NQTA 2P8JA 3TMAA 4BNWA 2ECPA 2CCJA 2FFBA 4JBLA 4DDVA 2OG1A 1VKZA 4HDMA 3LLCA 3SN6A 4PYLA 4UPDA 4L8FA 3HVUA 4I1UA 4MUJA 1YBVA 2QVCA 3K9QO 3L7IA 2A58A 4ND2A 5LQUA 5JQWA 4DYVA 5DTJA 5GTDA 3IAFA 3D3WA 4RKFA 1TKCA 1N5IA 5KSZA 1FXWF 2IU3A 5A2QA 3NYIA 4JLJA 1JTVA 1WVIA 5KQSA 4F1KA 5FUWA 2HWUA 3TLJA 2A94A 1X0VA 1HE4A 3KIPA 4H59A 3REOA 3T9CA 1PO7A 4RV4A 3DC7A 3OKPA 1ISHA 3DG9A 3R3WA 3HB9A 2AFIA 2EBWA 4PPFA 1VHQA 3RQIA 1HEUA 5KTOA 2WJWA 3N59A 2BMVA 2VSOA 1OI3A 1U65A 3CR8A 4JLBA 1ZOPA 3E5HA 1S2LA 3ZWYA 4XB6B 4C06A 4PZEA 2GT1A 3EFEA 1RXYA 3NANA 1Y5LA 3C2QA 3I58A 4LYJA 1DAKA 3RHFA 3SAJA 1GZ4A 2UUOA 4FYPA 4CIDA 5LOVB 3L4JA 4JHLA 2NV6A 2INGX 3SU8A 4O8ZA 4ND8B 3TMYA 4UTOA 1O7JA 4LRTB 3RABA 3WJAA 4Q21A 4GC5A 3PVCA 1M2OA 1I2BA 4K1LA 1JAIA 2R6R1 3FXAA 2YWBA 4RNCA 1S7CA 3LI2A 3AWIA 2Y71A 1B93A 2FMXA 3K9LA 3PZBA 3PQ2A 1T0PA 4G8BA 5EIHA 3WAKA 2C8LA 4O29A 4U6NA 3SHTA 1FYWA 3V1TC 5AVZA 3N0VA 3TSZA 4CKEA 1L3CA 3GUCA 5ALTA 4P98A 1J49A 2VP9A 1Y6JA 1UBMS 3GJ0A 4ZI5A 5TLSA 5GINE 1A9XB 2NPIA 4NVRA 4PQGA 1G9TA 4ZVLA 3VV2A 3QOFA 2NVUA 2YJ4A 2ZYAA 1EAYA 4ZAVA 3LGSA 2XMDA 2Y1WA 2XW6A 2O05A 1J2RA 3ZVNA 3G0CA 3T38A 4FS3A 4QOSA 1Z0AA 2ZBGA 1CJTC 4CTNA 1S3IA 2B1GA 2BLNA 1AQLA 3QTBA 4CMCA 4C7OA 2GZRA 1AHHA 2VVTA 1ETUA 5JD4A 2IK8A 5F7ZA 5AWFC 1AMNA 3EXHC 2XVXA 3ZGZA 2FPLA 1VL6A 4OHMA 5LXTA 3FTNA 3HYSA 2Q9BA 1HDYA 2NPOA 1E1RA 1USGA 3PQ7A 4GBMA 2RKBA 4NG5A 5EP2A 5TQ0B 3SYTA 1GLVA 2QVYX 2X13A 5L3RA 2QMYA 2JGNA 1PJZA 3WQQA 4K6CA 2HYDA 4S0XA 4E94A 3KVRA 3VAYA 4GXNA 3BGDA 3QFRA 2QYOA 4JBXA 3I04M 5TF0A 4GGPA 3NT2A 2VTBA 1XYYA 2NACA 4NJMB 2C2YA 2GXUA 1P5RA 3FJ1A 3EGEA 4N6OA 3NTLA 5DXJA 1KA9H 4CIAA 3K70B 4CU2A 4IHKA 3WXBA 3UGKA 3QUCA 4U7FA 2Q2VA 3LUDA 4A36A 4I4LA 4TLDA 3AW8A 4PICA 1ZHHA 1ZBQA 3B60A 2EWMA 5DLPA 3CH7A 4UMVA 1FDSA 3ASVA 3EFHA 4HWGA 3HSSA 5CFRA 1IN4A 3KXPA 3MD9A 4AO7A 1FDWA 2Q49A 1CY8A 3NNSA 1UP7A 1H0RA 3NKLA 3GLIB 2HHCA 3HS3A 1CDOA 2HMYB 3KAJA 4QNMA 3PNOA 2O3QA 1HYQA 2K87A 4R3UC 4CXMA 3FOEC 3LCCA 4KQ9A 4Y6QA 2Z5LA 2CXOA 2H1RA 3URMA 3FKSA 3TW6A 3KTDA 3AI3A 4YAFA 1IRIA 2DECA 1TGVA 4AZTA 3H4IA 1NZDA 3GAFA 4PU0A 4RADA 2XE8A 1JPJA 1U11A 4OXNA 4YASA 1T2VA 5FI3A 3JZDA 1N3BA 1XKXA 4EGQA 4Y6GB 4L4XA 1E4VA 4NCHA 3QY0A 4YMWA 2WTMA 2YWCA 3ZHSA 5DSTA 4L8LA 2P7IA 3FPFA 1NVMB 2Y1LA 2D0DA 3LOQA 4MGKR 4L50A 2IPLA 4BLVA 1MORA 3R7WB 2A9JA 4H3SA 3SLGA 4RDCA 3ETNA 3VKHA 3QMVA 3L82B 4QODA 1XZHA 3KQTA 4FGWA 4ND7A 4BLUA 3LWNA 5AW6A 3SJBA 3E5NA 3NHUA 3CE6A 3N9IA 1NUAA 4RX1A 3LQFA 1XDZA 4LX8A 5KO2A 2BFOA 4IOKA 1OA1A 1I3CA 1YACA 2O7SA 3KAKA 3KQYA 1NKVA 5KYUA 3P2OA 621PA 3DVSX 1QK5A 2C42A 2NQTA 3DOOA 2MYPA 1OX6A 3NHSA 4YLGA 1XQYA 2VDLB 3IPAA 1SJ9A 3BEOA 4I8DA 4PIMA 1EFCA 4KQIA 4HG2A 4ZO8A 1MJHA 4R1TA 3AFNA 4EQ6B 3DXZA 3DFMA 5KVQA 4BX9A 1CUCA 1QHHB 1CD5A 2OGTA 3WLHA 5E6RB 1KBZA 2VT2A 1C3OB 1U4OA 3KETA 2R8RA 1T0HB 3AMVA 1KEPA 3DJYA 5EEHA 2QK4A 3I9MA 3L0SA 4UEOA 3J7AC 2JLCA 3HY6A 3MTDA 2J0VA 4P7KA 3TLGB 2ZI3A 3WE7A 2Y27A 2QN7A 1VKRA 3MILA 9LDTA 1D1QA 1TM5E 2VNJA 3AHFA 3VU9A 5CDUA 1Z4JA 4GQBA 3WGMA 2TYSB 2R1VB 1E9FA 2RAVA 4DC0A 2PR7A 2IS6A 4RF3A 2GN0A 3A4YA 3JD1A 1XZDA 4YRFA 3QITA 1Z5ZA 2FZCA 2QRUA 2VJLA 2PUTA 1CE8B 1VYUA 5EZSA 5KX5A 4ZEXA 2O1WA 4F5WA 2QRZA 4KJXA 2RHDA 3DBVO 3R4CA 4N12A 3KEMA 1P7VA 2IIQA 3DDZX 3A7DA 2GPNA 4KXMA 1C1DB 4EYKA 3FOCA 2HU2A 1BMFD 1RSZA 1UXGA 4G5QA 4MA5A 1E7SA 2WE8A 2BMWA 3L77A 3EHDA 3KELA 5BR8B 3RUAA 3P5BA 1BHQ1 3JRWA 3KOMA 2BIFA 3TYXA 3ZU5A 2DBQA 3BIFA 1Q1GA 3NB0A 2PXXA 2ZE6A 1MJGM 1GXSB 3R6GA 2WU3A 4S1WA 3PTLA 4QGAA 3UWPA 4AB1A 3ZTWA 3WGTA 1HTWA 1A9PA 4GS5A 1W52X 4I50F 1JHMA 4PFKA 3URKA 1SHUX 1N36B 1TMKA 3I12A 2R1VA 3KPJA 2G17A 4WNYA 1OROA 3S2YA 3EDCA 4LY3A 3K32A 2HMAA 1HURA 3QU5A 1YQWA 2WPNA 1M2HA 2QLLA 1HDEA 1D5WA 4RD6A 4M1TA 4LRYA 4IYJA 3IVAA 4DSAA 3H8VA 1QZTA 3OI7A 4FN4A 4JH0A 3TQFA 1YU6A 2PBFA 1RI4A 1Z36A 2DY0A 3NBZC 2WJIA 4ZXFA 4AYXA 1Q0RA 3BQ9A 3U44B 4HAIA 5KTSA 2QM7A 1FRFS 4G9BA 2I6FA 1BW9A 4Z49A 4RTJA 1FMLA 1TA0A 1Y3CE 5HBGA 4D7AA 1LBIA 1NC3A 2D4AA 1FW8A 2AEJA 4TVKA 1C8KA 3OWHA 3PXXA 4QFDA 1F0PA 4J03A 2DFVA 4KFRA 4XYMA 5IC5A 1QRUA 1YBAA 5IDYA 1V4BA 4WERA 3IV9A 1CEYA 2WVGA 2E4ZA 1J22A 1FFSA 3SOZA 1XA0A 2ZRLA 4NJEB 1GG8A 1GSOA 4IRMA 5JLAA 4JQSA 4DC1A 2WUDA 1IHYA 1KZ1A 1Q0LA 3BS4A 3HBMA 1OBOA 3A0RB 1GA4A 5CVUA 2I3BA 4A9AA 2PX2A 2YYYA 2WTAA 3GJRA 3U44A 3T1YB 3KXKA 2RE8A 1W49A 3OD1A 3T52A 4DIMA 1NL3A 4EQZA 1BJTA 4FE4A 1T35A 2R00A 4X91A 5PGMA 2Z6QA 3ZQKA 3A6LA 4GICA 4L8YA 1MX9A 1E3TA 1AV6A 1HQDA 3IV6A 1QFZA 1FMTA 2DU8A 4P22A 4E6PA 2XTZA 1AHIA 3PG5A 3A6FA 3G79A 1TQHA 3ZG6A 4DC9A 1UT6A 4XEUA 5EE0A 2G4VA 3IDSA 3WHKA 1SBYA 2RGXA 2E0IA 5L40A 3KYCB 2EWWA 3AR5A 1MB9A 2XTNA 5EWLB 1JA0A 3ZHXA 4JI7B 4J91A 4QBIA 4RDHA 3NWOA 1XQ9A 2HX1A 1CS4C 2UZ3A 3P0JA 4RLSA 4F1JA 3SEFA 4P58A 3H1AA 1AIPA 3HDHA 5FJIA 4IMIB 2QNRA 2QYHA 4RFVA 1X94A 1K9SA 4DR6B 4B7UA 1DPGA 3V8BA 1DG9A 4NPHA 1U1CA 1NBOA 4NCAA 2GH1A 3DYBA 1KO7A 4F9TA 3B6JA 1DWOA 4JI3B 3OPVA 1HDOA 3I28A 4R2KA 3PUIA 4MS4B 3LMKA 1JSRA 2EEPA 1QCYA 4PPYA 1TEVA 3UIEA 5KINB 3MWJA 2C2KA 2VQSA 5JXIA 3NATA 3E1GA 1ZUWA 4DQ0A 3O21A 1TQ6A 3IJEB 1AB6A 1RYZA 3GPDG 3VBCA 1EFKA 3MINA 1T3ZA 1RI1A 4Z1OA 2IU6A 1VMDA 2DTXA 3RHTA 2MYUA 5FUYA 1KETA 2V5VA 3MOSA 5TS2A 1RZRA 4P1ZA 2D1TA 5BP7A 4YRGA 3ZDQA 3G1TA 2AC7A 3MWGA 3IVCA 4RFLA 4K88A 4KTTE 5I7UA 2ATVA 1VG9B 5K0FA 2EIXA 1ECCA 1ZJ4A 2HLPA 3T3GA 2PDAA 4ZU1X 4AFNA 4D9HA 4KGVA 4M9SA 2EGUA 5J43A 3I30X 3F0TA 4TRRA 3P4YA 1OI4A 4BASA 1P0IA 1GRRA 1Y8QB 2H0QA 3F7NA 3IHLA 2O5RA 3R8FA 4QA9A 3VX4A 4W6QA 4HVCA 1V1RB 1E1RD 1E32A 2ZIUB 2HLDA 1U98A 2XQGA 3WMRA 4BFSA 5FOQA 2YQ4A 2NQ8A 1A8UA 5EMNA 4U7GA 4E5VA 2FTKE 4DFDA 4LGYA 1Q95A 4KI7A 1NSTA 3LX4A 3CW2A 3EVCA 1KDYA 4IIXA 4H35A 2VXBA 4LHEA 4ENQA 4QPZA 2XJ9A 2YZKA 2Q8PA 3O8RA 4UCWA 4ZTUB 1CV2A 2EZUA 3ZR4B 1ABEA 1F0KA 1CSEE 2MSLA 4KNWA 2A0WA 3WO0A 5JT1A 4DR5B 4GU5A 4OU4A 4LXUA 3DYIA 2QORA 3EGXA 1RAEA 3KVNA 4K6KA 3RFCA 1NW6A 4X24A 3VZBA 3FCYA 2VYND 4G4JA 3FYUB 4HUJA 5JECA 1NY6A 4QULA 4OA8A 3S27A 3K0BA 1RKUA 4L4ZA 2YINC 3WO1A 1BROA 3U26A 5K6TA 3WL8A 3COWA 2O52A 3HKDB 3HN7A 3TNDA 1Z12A 4X60A 2FQWA 2WJAA 1O6GA 3FMPB 3X2SA 3S40A 3W9UA 2TECE 1RACA 3H86A 3WLMA 3A25A 1BDBA 3QKSB 2OOSA 2DUMA 4POAA 4BKOA 2ZSUA 1QUEA 4DB4A 3ZCRA 3WYNA 4RHUA 3UJ6A 4F86A 1PD0A 2HHHB 3AK4A 1TECE 4DN6A 1MXHA 3WLSA 3THXB 5E1DA 1SH7A 3B53X 4UOQA 3PFWO 4ZCPA 3UC9A 1B00A 2Q4RA 1GNSA 3QEBZ 3T5AA 4XM1A 3EOZA 3CX8A 1H8ED 4JWTA 5I5EA 3Q87B 1UMDB 5FPTA 1TTQB 1VDZA 1AU9A 3VYSB 5IWAB 4PLPA 2CY0A 2G36A 4OL9A 1Z07A 3D4NA 3CUWA 5DYYA 5HZHA 1SUBA 2FMFA 3L0PA 3AVVA 2P35A 3ABZA 4L27A 4F7WA 1Z4PX 3JTEA 4K6OA 2VSQA 1ZLYA 5C52B 1L1FA 2ODBA 2R47A 2NZXA 1C4KA 1Z2OX 4KL8S 4RHCA 3C6YA 3U4DA 3VSCA 1K5DA 1D09A 4JBIA 3UB4A 4D8UA 3P20A 3WWEA 1U5BA 3TSOA 4C0BA 4GNRA 3VVCA 1J4AA 1PNOA 1DXOA 4IDNA 2QXYA 3TINA 2FMTA 1MDBA 4LYAA 1WUTA 2CZQA 3CX3A 2CZGA 3K0EA 5H8WA 2JGLA 1G8HA 2GJ9A 2YVKA 2JD1A 2ZANA 4GBED 4UULA 2Q6VA 5BUCA 2XMZA 4B82A 5MDHA 4F8EA 4OUKX 3BRWA 4IJQA 4MPDA 1R4MA 3PNSA 1DTSA 2WTBA 1RM3A 2JCSA 4ZYYA 1Y34E 4BLQA 3ZDZB 1Y89A 5JRZA 1LTQA 4P2BA 3CLUD 5E4TA 1XB2A 3ESXA 5TE9A 3WRVA 2MINA 3TVTA 4W5RA 1EUDA 1H66A 1Q5PA 3HYRA 3K9NA 3MM4A 4OHKA 3VH3A 2YUIA 3OMLA 2VNHA 4BXOA 2HZBA 4L95C 2GVNA 5FBZA 4DEVA 1YZYA 3ED5A 4LKOA 2G5GX 3HN6A 4JAVC 4U2CA 1R0XA 4FDAA 1QHEA 1JHDA 4S1PA 1RTTA 1CZHA 1Y37A 1XSEA 3RVOA 2XXJA 4D3YA 2IZ7A 2N1BA 1CWUA 1JR3E 4KREA 4HYEA 4LA4A 5EGSA 4TLMB 3SQLA 2R8XA 1K8RA 1L7VC 4PZAA 5EKTA 1RRMA 3TFOA 2NV0A 3D43A 2O2DA 3ND7A 1MX1A 4U3JB 6YASA 4D0SA 3B52X 5KNBH 2IYWA 1F6DA 1QS0B 2EHJA 3M3HA 3U3MA 2D2XA 2GMWA 5FBVB 2EDCA 7MDHA 1V7QA 4AJLA 1MJGA 4LXHA 4JBHA 4N5HX 3SC2B 4B3RB 1VFNA 1TJ3A 5DW3A 1OC2A 2WHRA 1ZINA 3NBYC 4U5XA 2AKAB 3ITNA 1MDFA 4L4YA 5EZ6B 4DEXA 1G8GA 3F6YA 3M33A 1GZDA 4RLFA 4EIWA 4C89A 4RETA 3EVDA 1XCOA 1UZLA 3Q7RA 4ZTBA 3WRXC 1ILEA 2WABA 3RYHB 2A9OA 4E5KA 4D41A 5AUPB 2QL7A 2GLTA 4BQEA 4I5FA 2G80A 2BFDB 3QBEA 1MRZA 4HDCA 4G41A 4MQUA 4BATA 4EX6A 2GJ8A 3NBQA 4IL5A 4X20A 4C6HA 1DG1G 1ZW6A 2YFKA 2NU6B 5HS4A 2A1IA 2HJRA 1L4NA 1DTWA 2D2IA 1DCKA 3ND9A 4P93A 5CLIA 4YIKA 5B55A 4FGLA 5JCZA 3UHPA 4BX8A 1N2JA 1R5NA 1WDMA 2R6CA 3PRKE 4NJOA 1OREA 2XA1A 3DF9A 3EB9A 5D3QA 5LZ8A 4YQFA 1SXPA 4DIBA 3FUWA 3CZCA 5THQA 4XVCA 4MZXA 3UQZA 3SYMA 4U2BA 4D9NA 3SKXA 1JKXA 2C83A 2OBFA 3X1MA 4YJ3A 1IZ0A 5ALJA 2XXAA 3PGMA 4V0ME 5CH3A 3H6KA 3VTFA 3SQMA 3C6XA 4YGXB 3V4VB 4AKSA 3BMCB 4E5PA 2PX0A 1YMQA 5BSEA 2YBEA 1ZVMA 1NSFA 3OM0A 1FYFA 4LV8B 4R9NA 3NONA 2P1DA 1KZ6A 3GLRA 1SXQA 1P0FA 1REQA 1MC5A 4D0LB 3NPAA 3D8HA 5EMLA 2Q3FA 1P7WA 2C5LA 4CCYA 4DLVA 1RCFA 2FEPA 1E66A 2Z8ZA 4WOBA 1QP4A 2B2NA 3OPNA 3OZAA 3GROA 1DRJA 5CH5A 4EUNA 4ML3A 1KFKB 1GCGA 4IIVA 2PLFA 4I9FA 4HCJA 4M1MA 4RYLA 2X1LA 1ZK4A 2MU1A 2OVFA 4G1EB 4C2BA 5DH9A 4ZEVA 4KFCA 4PN7A 2VCEA 1MNQA 1YXMA 2XNHA 1A2BA 3ADPA 5IZ4A 1KH3A 5J2TB 2HSWA 5HZKA 2EZ9A 1A77A 2G70A 1GD1O 4NE7A 2AN5A 4NS1A 2CW5A 5KYWA 4R1MA 1U8FO 2YHAA 4KIUA 4MQMA 2VK4A 1TJ4A 2G6TA 3U61B 1XQXA 1KZHA 1IDN1 5BQ5A 2CUZA 3BSSA 4TRJA 1W581 1VMAA 3G5AA 4DUGA 3PFKA 1BH2A 1OC4A 2DYKA 2BUAA 3HHPA 3UAWA 2YOGA 1WDWB 4RTSA 2JKYA 3LPMA 4XASA 2WZDA 3I61A 3HJAA 4CIVA 4FN5A 2XVMA 4JJIA 3MSXA 4MR8A 1YIDA 4BKPA 1WUJS 4J3FA 3RTEA 4A5OA 4UEQA 1XKLA 3KAQA 4GQAA 2YMPA 5J63A 3ZCSA 2WT8A 4D6YA 2YL2A 4EFDA 3EQ2A 3JQ6A 2OYCA 2KS6A 1SUCA 1P4SA 2BFMA 4HS9A 4JWKA 1JBKA 3HL0A 3CX4A 3JVIA 4OXKA 1KQFA 1W2WB 3CRW1 2KMLA 3ZCTA 1EQAA 4JT4A 4ZAFA 1UMBA 4OHRA 5K6AA 1FX0A 2Y0BA 3O8NA 4JXJA 3CNNA 1Q22A 2Y1XA 5ALWA 3O3MB 5IKOA 5LKAA 2XUOA 3TPFA 1NAIA 4LOIA 4TXNA 3DGEC 5ED4A 1KNQA 2YWFA 1HI9A 4QXPA 3RKRA 5JJKA 4GOOD 2I4LA 3OEHA 2W2TA 3QLVC 2BF7A 2IYPA 4S0ZA 1UBSB 2HM7A 2VC2B 3QWAA 4HYYA 1M54A 1M1NA 1CZKA 1G63A 4Y1RA 5AVUA 3B1KA 2O07A 4WK6A 3T3PB 3UW3A 2G9ZA 4ME6A 2Q5HA 1CZLA 1SVOA 4RH1A 1RR6A 3L18A 3ENNA 1JB9A 2FZGA 1A9RA 3QTTA 1I33A 4J0EA 1OXVA 2B83A 3UFXA 3K6SA 1W36D 1N33B 2R7KA 4P36A 1TE2A 1O5OA 2GZSA 1DIAA 5B5SA 1ABFA 3IVGA 2NU6A 4UTRA 2NO1A 2PZMA 2AS0A 1X19A 2PJUA 1T0IA 2ZE7A 4JR1A 5CEFA 3NHLA 4HWOA 4QOJA 4YAUA 2N0SA 3NXSA 4E3ZA 4MUYA 4JNKA 2CYCA 2HJGA 4KRXA 4CV3A 1U2TA 1G2QA 1LK0A 3BICA 3P5SA 5H1YA 1ZK3A 4HGNA 2DZDA 2ZTVA 3KT8A 2BI8A 2IYLD 4HUQB 4BIMA 1QO0D 2AC2A 2AFIB 4QGFA 3THSA 4F56A 2SNIE 1XCBA 2BP7A 1Y63A 2ZULA 2X0FA 1RAAA 2H17A 3LT1A 3VZCA 4CW7A 3KAPA 2Q3HA 2BF4A 2WWTA 1P1HA 2FF5A 3VYRB 4FZVA 1GYQA 4TT3A 3O82A 4DDHA 5A06A 1LLCA 3ADKA 3H5WA 1KVRA 2AG1A 4BNFA 1RXSA 2GK4A 3ESCA 4NY1A 1RCTE 1TKRA 1XIVA 4L9RA 4E1BA 2F3RA 5J47A 1TMOA 4QOHA 1EX9A 4BE7B 2DFLA 4DNQA 5DULA 1IHUA 4EAQA 4URZR 2VDWA 1C4OA 3EWAA 4AX8A 1MT3A 1O94A 4L5BA 4XM0A 2ZAOA 3WKDA 1RKXA 4DKJA 1ESEA 1K7YA 5HDBB 1M8FA 1RQNA 3M8KA 4PLHA 4EKEA 5CFMA 5DBHX 3TB6A 3E22A 3SWWA 1DDIA 3GVCA 4RGBA 4Y18A 3CJTA 4UBKA 2WHPB 2GZAA 4B8ZA 1H8EA 5EP3A 2GAIA 2P6MA 2CEAA 4PFSA 1Z0IA 3U3JA 4CIBA 5L95A 4RJJA 4O5OA 1VLVA 3IJRA 3ZWMA 1ZH0A 3KEQA 2KLBA 3B6ZA 2PGNA 4JJZA 5EG5A 1C30A 1THTA 3BEDA 1AA9A 1QK3A 1XZMA 1Z8FA 2YXLA 2C7VA 3EOAI 3PF8A 4IFIA 5L6LB 5K3AA 2QBYB 1PQUA 3UHAA 3NTUA 3IAHA 4KKVA 3WL7A 5ADHA 4H3HB 3QUSA 5IARA 2YWEA 4JDPA 5CW2A 3VO2A 2OKCA 4LZOA 4KU4A 1TAHA 1C81A 1ENOA 3H2ZA 2V0CA 3BKXA 5IAEA 3LHIA 4XARA 3OOYA 5IMBA 2O8BB 5FI5A 4Q82A 4B34A 3LWBA 1E8NA 2OD9A 2JHGA 4XPIB 4Y2UA 2F9LA 4HWSA 3U7RA 2DOKA 1YULA 1ZCFA 1XKQA 1TYAE 3I2KA 3TPZA 4L4UA 1Q12A 4RJIA 1C9YA 1QHXA 1HDXA 1QGUB 3OLVA 3LIPA 4DTCA 1IN5A 4F3CA 5KJFA 3LYAA 3UBTA 1QB7A 1SXGA 2C9DA 3G02A 3VYWA 4ROSA 4JB3A 4MYHA 4GSKA 2LTAA 2GCNA 2QRJA 1F17A 2V6GA 4PWYA 2JZOA 1NT2A 2HEGA 2V65A 1O4WA 3Q8WA 4IBOA 4EZEA 1IVYA 3N2NA 1T6BY 4YXFA 1BW9B 4ZO9A 2C4NA 2VA8A 2FKAA 2YQZA 3ANSA 2QKYA 1KVTA 5TPZA 4ZICA 5KS2A 3U7HB 1KI1A 3OX2A 4HXYA 2HCRA 2BDTA 2HIAA 2QNBA 3PICA 4CEJA 3LPNA 1FDTA 1WSAA 1K5GA 4G4GA 4UPVA 4IQ8A 3FTQA 1CQIA 3JQFA 3V8QA 6AT1A 1T43A 3ROQA 3HXLA 2RK4A 1GGHA 3D7NA 1EAMA 1ZM4A 2XRMA 1BKSB 2DEUA 5CTJA 5CLJA 3VDQA 3GJ3A 3TRJA 2XAUA 3IBFA 3AVTA 4NZYA 3RTAA 2EJWA 2WJZB 4OP2A 4WBNF 3AZPA 2Q3JA 5AK0A 2PMEA 1SKYB 1HLGA 1CF2O 1IG3A 3FPSA 1P4HA 3UY4A 4RANA 2BD0A 3MJRA 4L5IA 4RKWA 3SE0A 1MAWA 4Q7MB 1WB9A 5D86A 2J08A 4LNUA 3NHBA 3EF0A 4DLUA 3SIRA 2BEUB 1GQFA 4OHPA 3LE8A 1WQ3A 4Q3AA 2CLMB 5A5DA 4HPJB 2XRYA 3USZA 4EY6A 1FMFA 1DTEA 2FZ5A 3BGSA 2J4DA 3CLTC 1NFFA 4KNYA 2G77B 4EUHA 1QGAA 1IUKA 3KKEA 4RY8A 4C05A 1NASA 2OOKA 3G2OA 3W7BA 1R8JA 5B3KA 1Y1PA 3PV0A 4QFCA 3LQRA 5IAAA 1OGIA 5FBWB 4IG9A 3NVDA 4JCOA 3VMMA 1YDMA 4O4LA 5BSWA 4EJ6A 2P62A 3D2BA 1GHTA 3MWEA 1FB5A 1QH0A 1FZTA 2VZ0A 5BV2P 3T7AA 3HB1A 3R5KA 3UEOA 1SO8A 5ELLA 4DLBA 2JJ2D 3M6UA 1U81A 1HKUA 3L4KA 4GIBA 1WSDA 3E9RA 5KOHA 5C32A 1F48A 1W44A 1IONA 3ORHA 3PXBA 3MUNA 1J8MF 4ACAA 3HDTA 2FW0A 3EY9A 2G76A 3I1IA 4DLNA 2QLTA 1Q2UA 4L22A 1RBYA 1UKEA 3KVVA 2G40A 1GUYA 4J7UA 4U4AA 3TTSA 4LHXA 1FFXA 4HTAA 4N0DA 2YX1A 1RFGE 1KPGA 5BMOA 4L75A 1NC1A 1WQ4A 4XB2A 7REQA 4WNIA 1CUSA 1NSYA 4YFVA 3PFCA 1BEEA 2CL6X 3KJQA 3H8JA 4X1KA 4XYLA 4HWKA 4RVGA 2O3SA 2CJPA 3CB2A 5GV8A 3FLAA 3JYHA 2PVCA 3PFHA 2HL6A 1N2XA 1RWOA 3R0IA 4XLTA 3GGSA 4A8JB 1W5TA 2YXNA 4LDNA 5J5AA 3CE9A 2X0RA 2Q99A 1XVUA 2ZTUA 3ZHBA 4IOJA 4WOKA 3TI9A 2F2TA 1Z06A 3S68A 1IN6A 1XEXA 1XNHA 1A95A 3QXSA 3RHSA 2G83A 2ZSJA 5JSYA 3EZ2A 1SVWA 1YQGA 4JHXA 4L57A 2NXNA 3E7DA 3ENVA 1E9RA 1SUEA 1VCIA 1MABB 1XQ1A 1EFHA 2JFPA 3C87A 3NORA 4JT2A 4RSMA 3GJXC 1NATA 4RFSA 5C34B 4TKZA 2V8OA 4PPNA 3AYXB 2A4MA 5ES4B 5D5PA 3ZD7A 2AC4A 2GK3A 2NUPA 1L5ZA 3PHLA 4DV1B 1EEXB 1P72A 4GPBA 3AHEA 2FJUA 4I50B 4RZSA 4COOA 2AOWA 2VDPB 4PPQA 1CRWG 2EATA 1M67A 1RPNA 5HIJA 4EVIA 3A11A 4Z4GA 4FYWA 4ZO4A 3TL2A 4FHDA 4EHAA 3DMNA 5F7JA 2QE7A 3T5TA 2B98A 3A1EA 3Q0TA 1VE6A 2OHVA 4TYYA 4OQZA 4WT7A 5C18A 4BZWA 3FGPA 3EUAA 1LCIA 4HDSA 3F97A 3T5GA 1NHGA 3O1JC 2OK7A 2CHQA 2H4FA 3QRWA 3A9RA 1UQTA 3ESAA 3ZJYA 3HZOA 1CFZA 1X42A 4GOLD 4WOJA 3HCWA 5F78A 4A6XA 2O8VA 1PKXA 1O77A 1CR2A 1TPYA 2CFTA 2Y66A 4CL0A 4F4DA 2LXNA 2VATA 4IDFA 1G4HA 1K6IA 3IAXA 4CUKA 4G1MB 4WJZA 5E38A 1PR9A 3D0QA 4I50A 4YUZA 3VZPA 4LE0A 1ZD5A 3WR5A 4ZT7A 2XWSA 3Q1KA 5CB0A 1MOQA 1E96A 2IBMA 5IFLA 3L8GA 4EGJA 1PR1A 5BPFA 4FLEA 1XA4A 2ZYUX 3WG9A 5JMTA 3SSNA 1FBTA 3NBUA 3S55A 1NMQA 3KP1A 4B3CA 1D3AA 2EV9A 2F8LA 1LI5A 4C0SA 5KIAA 2QRMA 4L73A 3IQZA 1JDBC 1M3SA 3BBPA 3IT3A 1JBEA 1K7CA 2CYBA 3VNBA 1NW9B 1TM3E 1MW8X 1Q6YA 2WM9B 2E89A 4HEJA 3P9IA 2Z2JA 1NURA 3AFOA 4OQXA 1XZQA 2GTPA 1V47A 4NTZA 3WYCA 2XNJA 2LW7A 1KC1A 5LP6F 3H42B 1O5IA 4UNRA 2V59A 1Q6ZA 3ABSB 4FM9A 2ACVA 2XF8A 3HO1A 4E3WA 3M2PA 1NI4B 4HN2A 5B2ZA 4AJHA 2HSDA 1WNTA 2EEZA 4IDDA 1E0AA 2FDXA 1UXKA 4EARA 4Q3OA 4IVPA 1Q57A 3MJDA 4QDTA 4R16A 5TR9A 2JH8A 3CKMA 2IXEA 1E1CB 1X1CA 2C0PA 2WJYA 3CPEA 3KYDB 5B7GA 2XVYA 5BV8A 4IF4A 3TFWA 5JFGA 1J5PA 1Y1SA 5EPOA 1WZUA 3LSYA 4HMPA 3IDAA 1P7ZA 2WR8A 1UBLS 2EP7A 4G65A 1U3DA 1I3MA 1QIKA 1UZAA 4DNXA 5BSVA 3ZLUA 1CRZA 1M8GA 3LXUX 4AAYA 3R3SA 3TKYA 1EK1A 1EJ2A 1FYXA 4G5OA 4X65B 5FNVF 1NXQA 3EWSA 5CXQA 3CTMA 3RUFA 1IVSA 1IEWA 5G0WA 2P91A 1RLMA 3I3OA 1Q11A 5CK5A 1U0SY 2IEYA 3PFGA 1G42A 4BFUA 5JEDA 2XT9A 4B3FX 1GU0A 1XXHA 4PG5A 1TIKA 2IV3A 1EEHA 2RGWA 5EJ6A 3DFIA 4L0MA 3F6RA 4J0KA 2QLMA 3U4CA 4WLVA 4Q39A 4DRZA 4JP2A 4B44A 3WRYC 2XZLA 1P62B 1WXFA 1YCFA 2FV8A 3CVJA 5EZ5A 1OV4A 2A0KA 2DH6A 3UUWA 3HFJA 4Q66C 1V11A 1TZ2A 5IJZA 2D06A 3IHWA 5AM5A 3BXHA 3X2FA 1PVDA 2F3TA 3AR3A 1QSGA 1L5LA 3DZGA 3FVWA 3JQ8A 2GAJA 2XY4A 4NL4H 1IWPB 2QT1A 4AUMA 2HMTA 3N3BC 2HNBA 3QA3E 4QRHA 4DA7A 5LQJA 1WLYA 4G01B 4YRQA 5REQB 1NVAA 1SBCA 2IE0A 3V4OA 1JBQA 2WKQA 1W1WA 2GHIA 2XA9A 4NZMA 3ZIAD 3E9MA 1ISIA 2EF1A 4XVRA 4ALMA 4N3NA 4PIVA 1ARZA 1P1KA 5KAMA 3SLKA 2OO5C 4BMOB 1ZWKA 2D5AA 1FX0B 4G8CA 1QP7A 4RS3A 5LQAA 3WA6A 4BL5A 4DLAA 1S3GA 3V9PA 3EA5A 2YZNA 4OHZA 3MFYA 4HTFA 3DB2A 3M5CA 4CZ2A 4DM4A 1QAOA 2OAEA 4IEEA 3U9TA 4BQSA 4OA5A 4EMTA 4LI3X 5HA5A 3R3ZA 1DSSG 3TQOA 2Y68A 1H4SA 3JYOA 4E4RA 5TT0A 2QLJA 1XMQB 2C5GA 5ILGA 2ZSBA 2RAPA 4WN9A 2VOJA 3M0EA 2Z0MA 3TD2A 1H3EA 2D1RA 1TT5B 3FMVA 2JFXA 4Z9YA 1GAQA 4PTZA 4QUAA 4H16A 4QXMA 3SJAA 3ABRB 1L9KA 3K0FA 4FR2A 3K6KA 5DO9A 1OTHA 4DGSA 5LIPA 1OY1A 1G41A 2FX3A 3ANMA 4FMBB 4LMRA 5FR1A 3AQ4A 2Z4RA 4PINA 3FCCA 1HZZA 1XRLA 1V8OA 3P94A 5AI5A 3VU1A 4LCEA 3E1SA 4R1NA 3TR0A 4DT1B 4U7TB 2QL6A 4Q7EA 2FZWA 3ORQA 3PIIA 1WXEA 4MUAA 4RPGA 4IM7A 4BEJA 3DKPA 3UMSA 3L0DA 4X7BA 4URVR 1RZVA 2QTFA 3GGPA 4Q5IA 3TBHA 4B5LA 2D1QA 2E49A 5ECDA 5BY2A 5LDHA 2CNOA 2EX0A 4HNGA 3MAGA 2R8EA 1Y9JA 1BMDA 4DDKA 3R9KA 3R20A 1JLLA 3QKUA 2D2EA 1XVAA 4C0KA 2GN6A 4CKWB 2FZLA 2GVZC 2OC4A 1T9KA 3BE4A 3IILA 5CNJA 4BNHA 4YV2A 2V6MA 3AI1A 4NU5A 1SBHA 1UPCA 3NRJA 3QFSA 3VR6A 2ID7A 4KN9S 4UVHA 3HU2A 1NVXQ 5A4MS 5HKAA 3OFNA 5ALNA 2J9YB 3LFHA 3UJ3X 1LJ8A 2H4ZA 2GD2A 4S1TA 5HKOA 3VSBA 1M1YA 3A2LA 3D59A 3ZU6A 2BI4A 2H2DA 1UCFA 5GM1A 4BFZA 3IXLA 4HQ0A 4LF6B 3ZZNA 1EQUA 2GLUA 4URFA 4GG1A 4QLOA 1NW7A 4O59O 4DJDC 2IXGA 3FVVA 3SFTA 4II3A 1CDEA 2G08A 1ZGZA 3DBOB 2VFAA 3CLUC 4K8RB 2COUA 2IC5A 4RHYA 3KB6A 3SQXA 2YN2A 2C59A 3LF2A 4KQ1A 4OI4A 1ZEJA 4ZO7A 5LCXA 5IT0A 3IRVA 1Y6ZA 3QVGA 4GH5A 1TD1A 4QWWA 2MMGA 4V1CI 3MTAA 5A3QA 5KJCA 1FJXA 3GX1A 1BYUA 2VF8A 1Y5MA 4M1QA 5GJBA 1IB0A 1KK1A 2OUIA 4YQYA 1I5EA 3DOIA 3I2HA 5LUBA 3N2ZB 2POQX 1AUPA 1YMUA 4RMNA 4CMEC 5JD3A 1ORWA 5EIAA 3I64A 2ZUBA 3NJ8A 4ALNA 5ALZA 5IAGA 2R5WA 2JD2A 3L6CA 4J2OA 2OD2A 3GVIA 3OZVA 3VGPA 1N5MA 4E14A 1H6DA 2DAPA 3L7BA 3NO4A 1GP2A 4MYCA 1AHPA 1JH8A 2G6BA 2FH5B 2ZIXA 4MV4A 2DT8A 1BCRA 1P2DA 2HA6A 3IR6A 3AEKB 4PLTA 1OFUA 3GPIA 2OT3B 1FSFA 4R01A 5DCWA 2FN4A 4RZ3A 4C03A 3THYB 5KAPA 4MWDA 3DEZA 3P52A 1ZMTA 1LZKA 3LZCA 5F77A 3E4CA 4NNOA 4G5YA 3REQA 4BVEA 1E9AA 1T5SA 3GIDA 4OAOA 1HE3A 4DTIA 3OWXA 1L7OA 2PGOA 1ZSVA 1HMYA 3MWYW 2GHTA 4QD3A 1E5VA 3T12A 3OUZA 5CB6A 1U7ZA 3C6KA 2VTDA 3A32A 3GLHB 1A9ZA 5HCIA 3CW9A 3KKNA 5ALEA 2DTDA 2XHZA 4YMGA 1E9BA 3AHHA 1A8SA 2OYSA 4D46A 2ZIAA 1JT9A 2H2GA 4IMJB 4DCGA 3Q5GA 3I6ZA 4JEMA 3V7FA 3KJNA 4MS3B 3MQFA 4HPWA 2IU4A 2AIRA 1XDGA 2PSEA 4URUR 5L6MB 4RNDB 1JV2B 4YT8A 4Z4QA 4Z2AA 2V7TA 1N9GA 2ONYA 1TVCA 3A9VA 3FA2A 3P2MA 2B2XA 4EBBA 3JQGB 5JJBA 2NVOA 3H11A 2G1JA 2Z83A 2WU1A 3I4CA 1XDDA 4WKOA 3S6JA 4Z1MD 4R40A 3B1YA 5H9VA 3K1AB 3HVHA 1VFPA 4Q48A 3RSFA 1Z26A 4WE3A 3PXDA 5I3CA 4KPEC 4YLEA 2QX4A 1E5TA 3IPRA 4PX5A 3RBAA 4AMUA 3VH2A 1MAAA 4MSUA 4P32A 1XD9A 1EWKA 3AX6A 5LDDC 4GI7A 4TWJA 4XPIA 4WZAB 4F93B 5E9QA 2PAAA 1SCBA 4C7KA 1NQXA 1QV6A 2VJBA 3SHFA 1ODCA 3NC1C 3W79A 4MR7B 3AGQA 3E48A 3R09A 4EA7A 2FW7A 3VR3D 1UEIA 4TMYA 4AJNA 2EW8A 2NXWA 3R74A 1JFTA 5ED0A 1V8FA 3HKCB 2W6MA 3KD3A 1P1IA 3KC2A 5DBFA 1QG4A 4DPLA 2AFRA 3LU1A 1JF8A 1NA5A 5AKEA 1K06A 2EYQA 3Q5DA 4JMLA 4A1FA 4M6WB 2FEMA 1UPXA 4RVCA 1DE0A 5E7MA 1HEYA 2YC2C 2GLXA 1N9GB 2F43B 3ETCA 4ZRNA 5GJVC 2BRUA 3TLMA 2F67A 1KZ9A 1Y4ZA 3I1YA 1AGRA 1GG5A 5C0OE 2DJ5A 4G0ZA 1QPGA 4RQAA 1P9WA 2W0MA 3FYTA 2VP0A 3QW2A 4EVSA 1F38A 1DP4A 2ZPTX 3RVMA 1HZZC 1Z83A 3TUJC 1HNWB 1EFRA 4M4SA 1JZTA 2ZR7A 3QWIA 2VWHA 5KCMA 2IYRA 4UTNA 1QWSA 1O57A 1XDSA 1X7WB 4UM9B 3ZE0B 1J1IA 3AEUB 2OBLA 3HCDA 3P97A 1I6MA 1GL3A 3G0DA 1M34E 3OEWA 1C4WA 2GVDC 1PVOA 2JCXA 3WK4A 5HW0A 1SOVA 1ZRHA 4B3DA 5KPJA 4WKPA 2QA5A 3BXOA 4Z7JA 4CI0B 5HGXA 3E84A 1ZP6A 1OWOA 3EVZA 1SC4A 1DKLA 3DPSA 5BN4B 1KAHA 1FFCA 4PZCA 2NU8A 4A2PA 2Q1TA 3BQMB 4N49A 4WCVA 3LCRA 4XVQA 4FYXA 3BZBA 3FCEA 2UUAB 1WXXA 5TF4A 1XP8A 9ABPA 2C2ZA 5L4LA 4FEYA 1FJ2A 4CMIA 3CWCA 4HPXB 4PG7A 2HLNA 3HABA 4XWAA 3RC9A 2A0YA 2YFQA 1JSCA 2I7TA 5K01A 2CFOA 4P38A 1DAFA 2WKPA 4INJA 3TEJA 3WNQA 3CG4A 5FUVA 4R54A 1P4JA 3GRCA 3Q12A 2MCFA 2FJ0A 2QB5A 4R0MA 2XECA 1I1OA 4QBHA 4YAEA 2WNIA 4KXQA 4K26A 4X92A 4UHEA 5ISMA 2H9YA 3JQ9A 1ACLA 1GT91 4GR4A 4W5JA 3SEZA 1E2MA 2E87A 3PEWA 2HA5A 1CCWA 1JR2A 1WCYA 3G0BA 1R00A 4V02A 1P2FA 5IVKA 2OCLA 4FGUA 2I2CA 4HDKB 4YR7A 5BQOA 1QZXA 4B7AA 3KR2A 2IBSA 3QVWA 1ZR4A 4QM6A 3BIOA 5H3LA 3GDHA 4GEGA 2VEDA 4UARA 1W5AA 1QPBA 4OMFG 5EMKA 3INRA 1LWNA 4YEDA 2IKSA 5JALA 4LUCA 3HA5A 4IGAA 2RHGB 2RK3A 4IF6A 2H9IA 4X1KB 2H1HA 2W48A 1GTG1 2X40A 3L8MA 5F33A 1XALA 5K3EA 5IYZB 2APJA 2SKDA 1Z0SA 1V0JA 5JZOA 3GJSA 1P4AA 1F60A 1KK0A 5M29A 4OBXA 3PLAE 5EIXA 2Z2YA 3DE6X 4GOJA 3GZJA 5DN9A 3RAEC 4IYRA 2GF0A 2OPBA 5B1HA 1G7CA 1W1UA 5BMVA 3MG9A 2XIJA 4XPZA 1JJVA 4EBFA 1CIJA 3HHEA 2DQ4A 3UA3A 1G8FA 3LPAA 4MP8A 4OKSA 3OTOB 3B36A 5C1IA 4A27A 1V7CA 4MO2A 3VBEA 3QFFA 3RU3A 4L6CA 2A35A 2ZJ1A 3WWDA 1JJAA 3TBKA 3EARA 5KX5B 1E3EA 3FM9A 1OPRA 1NJ6A 3PHBE 2DG2A 5AUNB 2ZUSA 4UDYX 1JYEA 1GZUA 2YXBA 3K96A 1PK9A 3N8KA 4BNMA 1U9IA 1MW9X 2FQQA 1U3UA 2F43A 1GL7A 1QFSA 3ND6A 3VVLA 1K66A 3IBTA 4DMRA 2XYRA 3N7AA 4UVEA 2IYUA 4MGEA 4BCDA 1Z16A 3AERA 3ZGYA 4BLTA 3ZTYA 4CDRA 1XDWA 2JJYA 4KQHA 1V8ZA 2VYVD 1GZSA 2Y4NA 3OY2A 1FYEA 1SIBE 2VH5R 4MR9B 4HAOA 1TDJA 4H15A 3PNKA 1KMMA 1LJUA 2QT0A 4UREA 5CYOA 1B3BA 5BNFA 3WQHA 1PW7A 1WE2A 5D7NA 1U2EA 4RL4A 1TKBA 4EKDA 1GEGA 4XWWA 1O0SA 1TI7A 1ZITA 2DHCA 2WFLB 5F4ZA 3S44A 5YASA 2AMLA 5AKYA 3VKWA 3ZNOA 4EG6A 3UGJA 3QYJA 4YAJA 1KK3A 5J4VA 2QHXA 1P74A 3H05A 1NRIA 5DWDA 2GYUA 3KWMA 5KYYB 4PIPA 4LJRA 5AKGA 4CMGA 1N6IA 4LDAA 3WP0A 5KYUB 4DUZB 3BVPA 3CLSD 2NAPA 1QLJA 1QIHA 2BLLA 2R1TB 1H6AA 2XRZA 4ETWA 5IG2A 4HAUA 4I5DA 1C7IA 1LPBB 2BAGA 3RVPA 3TTWA 5TARA 3B5EA 3VGJA 3B3FA 1M0EA 3RGGA 1PZHA 5C4GB 3QFTA 1CJMA 4FHCA 2Z9CA 1RWMA 1UBOS 4GDFA 1AJEA 1Q84A 4JX9A 2Q3MA 4Y1GA 1I9CA 2W6ZA 1DXYA 2F17A 2H9AA 5TDHA 4F96A 2BFCB 1RZRD 4BEBA 4EVQA 4DCOA 2R0QC 2JIQA 3B3JA 3P0IA 4LC1A 3T0GA 1XRQA 2QJTA 3HDQA 3JR7A 2IDMA 3ZE8A 2HCTA 5AUOB 4O1HA 4JVLA 3L07A 1FFWA 4QYIA 4D5GA 3J81k 1LD3A 3C1AA 4JUCA 4RA9B 4JXXA 5TVKA 2VDMB 3GWGA 3PGJA 1MB3A 5F51A 5B7PA 4R3WA 4CUZA 4G26A 3H9GA 5KJ1A 1PR4A 4KAAA 1EG7A 3R4VA 4Y9TA 4Q4LA 3RS4A 1GPYA 2H1WA 3JQAD 3L41A 1Z6XA 1CUXA 3M81A 4I55B 1C3JA 2CV0A 1AURA 3JQBC 2VYFA 4OO3A 3P9KA 4WUVA 3H5VA 4YAWA 3STTA 4DNFA 1JHOA 5JPCA 1XA3A 1DWPA 4IGIA 3M83A 4M36A 5F5LA 1G8JA 1U63A 5ALHA 4S05A 1OSNA 3AETA 3QELA 4XTCS 3PLNA 3HB7A 4A26A 1EHIA 4YRMA 1N7IA 2B5VA 4BZZA 2IXDA 3L40A 1VL5A 4ZOLA 2ZBPA 4IPTA 3WTCA 3ZQUA 4CRWB 3NJ4A 2P6UA 1R0BA 1Z2DA 4EKNB 3KQQA 3PQ5A 1WW3A 3UMMA 2ZLBA 1VGVA 2A67A 4LQ4A 1ZNZA 3EMVA 4UW9A 3QSYA 1QG6A 1C0KA 4KH1A 1I3NA 2VHYA 1S01A 4RM2A 5AO9A 1JXAA 4U7DA 3I09A 1I6WA 4TYMA 5KYVA 2CLFB 3A05A 1H93A 3MXOA 3HWRA 2IQ5A 2OM2A 5AJUA 3ZBTA 4N4AA 2GZ3A 3PKIA 4P53A 5J2UF 2LIPA 1A9OA 3PU6A 1A8QA 4LPSA 2XPCA 3INYA 1QGOA 5HX7A 4DPKA 2VDWB 3SZUA 2R66A 3CW8X 3ISVA 1QMPA 4IWNA 1PZNA 1ODLA 4HH3C 4TZ6A 5HKKD 4BB5A 4RTMA 1I94B 4FFSA 3SY8A 1OWNA 3F6EX 3LNCA 4LXGA 3NTQA 1X7YB 1MXFA 1Z82A 4Q12A 4GKVA 1BD4A 1XAJA 1U7OA 4OK5A 1FDIA 3HXKA 2GKGA 1PR0A 1KVQA 1RWKA 2DF8A 3DHNA 4QGGA 2PD4A 1YE3A 1UBCA 1U1EA 1O03A 1D4ZA 2J09A 4IWYA 5D6NA 1T9AA 5HS6A 6CHYA 1WX1A 2FFQA 4FOPA 4ZEOA 1GSHA 1CZOA 4R8VA 1SELA 2JL1A 2FSFA 3SC4A 3W8EA 1B14A 2PGAA