2RHYA

Crystal structure of the 3-mbt repeats from human l3mbtl1 bound to monomethyl-lysine
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
315
structure length
313
Chain Sequence
SWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 79
structure length 313
sequence length 315
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhyA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhyA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhyA03
3MEWA 2RHXA 4QVZA 4Z02A 3MP6A 4BE1A 3UWNA 4IUUA 4QQ6A 2B8AA 3PMTA 1WJQA 2R5AA 3CEYA 3MP1A 3OYDA 1SSFA 4IUQA 2R57A 2DAQA 2VYTA 2EQKA 1XNIA 4PLIA 2RI2A 2LRQA 2X4XA 2BIVA 2RHYA 5D6WA 4II1A 4UC4A 3QIIA 5IAYA 3L2VA 2O4XA 3LLRA 5D6XA 2M0OA 2RJCA 3L42A 5D6YA 3OA6A 2CKKA 2EFIA 2K3YA 5KE2A 3UT1A 1KHCA 3DB3A 3GOXA 4QQDA 3OY9A 2MWOA 5KH6A 2GFAA 3L2UA 2BUDA 4N4IA 4OVAA 3FEOA 4HCZA 3OYIA 4QW2A 2EKOA 3PMIA 4N4HA 5J39A 1N27A 2E5QA 3KUFA 3P8HA 2IG0A 3S6WA 2E6NA 1H3ZA 3SD4A 3BDLA 3OS2A 4E7HA 2R58A 3FDRA 5KE3A 4N4GA 1OZ2A 2JTFA 3FC3A 3MEVA 4IUVA 5FROA 3OYMA 2XK0A 3OYHA 2PQWA 3MP8A 3QJ6A 4RG2A 3P8DA 5J26A 3OYEA 5FRNA 2GF7A 3H6ZA 4QQGA 3H8ZA 3F70A 3MEUA 4Q5WA 2RHUA 3LGLA 5KCHA 2GFUA 3OYBA 2BKDN 3META 2LDMA 4BD3A 3L2QA 2RJDA 3L2WA 5KCOA 4E7JA 4GY5A 1G5VA 2RHZA 3NTIA 2X4WA 4X34A 3C4SA 4A4GA 3L2RA 2P0KA 4BDYA 4C5GA 4E7IA 4CRIA 3NTKA 3MEAA 3NTHA 2EQMA 5M9OA 3OYCA 2X35A 2NLUA 1WGSA 3OQ5A 4B9WA 3EAEA 3OS1A 1WJSA 3PNWC 2EQJA 4A4EA 2LCCA 2RO0A 4BDZA 3OYFA 3S3OA 4FU6A 3FLGA 2M16A 3E9GA 3E9FA 3OMGA 2D9TA 3M9QA 3OS0A 2WACA 5FRMA 3ASKA 2LTOA 2YRVA 4ZTJA 3S3NA 3OYJA 2O4XB 4FL6A 3MO8A 4IUTA 3PFSA 4PL6A 4C5IA 4IURA 3LX7A 2R5MA 4L59A 3OYLA 4C5HA 4EDUA 4BE2A 2X4YA 3S3MA 2K3XA 2RHIA 3O8VA 2QQSA 3LH0A 2RJEA 2L8DA 2QQRA 4A4FA 4C5EA 2F5KA 2DIQA 3LGFA 3DB4A 4ZTFA 2L89A 4E7KA 3OYGA 3DLMA 3ZEHA 3Q1JA 4LD6A 3QKJA 3LYIA 5CIUA 4A4HA 5C6SA 3OYNA 1MHNA 2FHDA 3ME9A 2RI5A 2JZ2A 2DIGA 2L3RA 3OMCA 3QBYA 2HQEA 4IUPA 2EQUA 2M1HA 5IN1A 2RJFA 5C0MA 4BE0A 2LVMA 1RI0A 4E7LA 1OZ3A 1OYXA 4BACA 4IKFA 1OI1A 4PLLA 3OB9A 3OYAA 4B9XA 2RI3A 2G3RA 3OYKA 2HQXA 2XDPA 2MWPA 4NS5A 1WJRA
chains in the Genus database with same CATH superfamily
3CC7Q 2E64A 3I35A 2CP6A 5GAN7 1JO8A 5GANg 4ZN1A 1QP2A 3BE3A 1B34A 4PKCC 3CEYA 3UF4A 2K79A 1QVFP 2RI2A 3A8GB 2XDDA 2EWNA 5D6WA 4E47A 2YRCA 3FB9A 2M0OA 3L42A 5GAMj 2OTJT 1G3TA 4LUEA 1IRXA 4A54A 1YHQT 1MMGA 1AWWA 2P4TA 4C92D 4JLIA 2L3PA 4M77D 3CC4Q 2HZYA 3JCMV 3M0SA 2C0OA 2DXTA 2DXUA 3CCSQ 2JUFA 5KYXB 4XU0A 3QZ9B 4C8QC 3P8DA 1Q82U 4OF1A 1VQOA 1VQNQ 3JCMQ 3A8OB 4HCCA 2QASA 4PJOC 1FMKA 2D6FA 2ZPEB 4GY5A 2A0FB 4LXCA 4X34A 3CBMA 3QHSA 1HD3A 1N5ZA 1IB8A 1WPYA 2X35A 2K6DA 2HSPA 5GAOr 4DBHA 2FPFA 4M7AB 3M55A 3M9QA 4Y28E 5LJ3j 4FT4A 2BZXA 3CMEQ 4C0FA 1I5OB 3BDUA 2XI9A 4ELZC 3ZL7C 3X20B 2D8HA 3CCEQ 1MMDA 2QEXA 2IPOB 2DIQA 4XAXB 4XTWA 2LNHB 1BYMA 1TS9A 2RF0A 4ZTFA 4V2SA 3QKJA 5CVIA 4BY6B 5I21A 1YN8A 1V76A 5DY9A 2GTOA 1YI2T 3PE0A 3FJ5A 1UDLA 4M77E 1OI1A 1JU5C 2FPDA 4LDXA 5GMKi 1E6GA 2KMTA 1MV3A 3HP9A 4NS5A 3MHXA 5CKFA 1YJWQ 2AZVA 3VKIA 5CCAA 1W1FA 2CZ1B 4NL2A 4M7AC 2OTLA 3HPWA 2EAYA 1K8AR 2O4XA 2RJCA 1N6AA 2YUQA 4NL3A 3H41A 4M75D 1UECA 2LT4A 2NUPB 3H0FA 4KULA 1OEBA 1X27A 3HFNA 2JT4A 3QUIA 4LDVA 4RTTA 4ESRA 3SD4A 3CC2T 2QQBA 5FW9A 5AYFA 2JVVA 3I55T 1VQ5A 1VQ9T 1X69A 1AHJB 4C0DB 4DBQA 4C8QE 3G71Q 3HFOA 2YUPA 2EPDA 4PJOE 3KXTA 3VU3C 2L2PA 1WDXA 1IGQA 1KD1R 2EQMA 1MUZA 1RI9A 2EKHA 1TTHB 4D8KA 1VQPT 2OAUA 2WSEE 5GJWB 1RADB 2QK0A 3CPFA 4WF2A 1M90C 1M2OA 2ZPFB 6AT1B 2ATCB 4A4KA 3S3NA 1UUEA 2XIDA 1BIAA 2DVEA 2YHTA 5GAOm 4L5GA 2QEXT 3QXEB 1OULA 1BIBA 3CC7T 3LH0A 1KC8R 4OB3B 1AT1B 1QCOA 3ER0A 3GPLA 3ME9A 4C0DC 4MZMA 2L3RA 1Y0MA 3EHRA 3GF5A 1QVGP 4WCIA 4B9XA 3OYKA 2BE9B 3UPUA 3CPWP 4KBMB 2DTOA 2RHXA 3CC4T 4BE1A 2HAXA 1IXDA 3CCST 1X6GA 2KGTA 4M7AE 1AWXA 3M5AA 2VWFA 2KXCA 1VQNT 3CCUA 3OA6A 2MAMA 2LX9A 2FO0A 2V8KA 1ZQ1A 1RAHB 2H3JA 5IHNA 2F2WA 2XD0A 1FWZA 1Q86R 3QZ5B 2IG0A 4M78G 4JRIA 1OZ2A 4OMOA 2DD4A 1SF9A 1FXXA 4JDSA 1RAGB 4J9HA 2PVOB 3CMET 2WSFE 1KK7A 2RJDA 1G5VA 2AKKA 2QQAA 4MMKA 4DEYA 2M02A 2NWMA 2F5TX 3CCET 2GTJA 4KRTA 2Y4XA 2P84A 2LMJA 4R0KA 1BU1A 4KGZB 2J7IA 1VYUA 4BDZA 1PD1A 1W6XA 2K4YA 3PT9A 5LJ5h 1GFDA 3UDCA 2Y90A 3I56Q 4EMKB 2O4XB 2O9VA 4MDWA 1IHVA 2HDAA 3VRZA 1PC0A 1ZUKA 1YJWT 4Z8AA 1S1NA 1UJ0A 2F5KA 1WHMA 2A36A 2L89A 2NUTA 2RD1A 1B3QA 4RTWA 4RTXA 4OB0B 2RN8A 3OYNA 1K0XA 1B7TA 3VS1A 2KEAA 5IN1A 3JB9H 1QKXA 2JS0A 1TH7A 2LJ3A 4E7LA 4JJBA 1K73U 3URGA 2JMAA 5IHKA 3UATA 3M56A 2QA4Q 3RESA 2D8JA 2C0IA 5CKEA 2R5AA 2O01E 3MP1A 2LCSA 1X75C 4PLIA 3VRYA 2LRQA 1IREB 2CZ6B 3M0QA 1JBMA 3HHTB 2DL7A 3G71T 3PIPA 1YJ9A 4ELYC 1OPLA 1T3LA 1UFFA 3G6EA 2SRCA 3P8HA 3S6WA 3RBBB 3TSWA 3CXCS 1U06A 2DL3A 1S72Q 2JTFA 5CQYA 2KE9A 3OYMA 5A0GA 2K5LA 4J83A 2XDBA 4QQGA 1EZZB 3F70A 3LGLA 4O6JA 1QMCA 4FIBA 4AMCA 3L2QA 3VS5A 1IO6A 1M2VB 1ABOA 4C5GA 1UGVA 5M9OA 2O88A 4AT1B 2FB7A 1YJNA 1M9SA 2BZ8A 2PUOB 4A4EA 2RO0A 4RTZA 3EFOB 5CKBA 3H0HA 2EYZA 4C8QA 3CCQQ 2AT1B 2D9TA 1NLPC 2YRVA 1LPLA 4LUDA 1ZLMA 4PJOA 1BK2A 1VQ4Q 3MKDA 3REBB 2DZ9A 4IUTA 3EG1A 3CMAA 2R5MA 3HSBA 4BE2A 2CYZB 1PD0A 5GAN3 1NZ9A 3ZBDA 2EYXA 1UHFA 4LD6A 5C6SA 1BCMA 2JZ2A 1RI0A 3VS4A 1GFCA 1YITA 1ARKA 3OYAA 3QSUA 1X01A 2G3RA 2PTKA 4KUDK 1V1CA 2DJQA 3MEWA 4C8QF 3MP6A 4XU1A 4F7UG 3PMTA 1NYGA 2VKNA 4PJOF 5KYXA 3BW1A 4AFQC 5GANj 2KYMA 4FCYA 2MF2A 5ECAA 1X6OA 4II1A 3CD6A 2RPNA 4J6YA 1OPKA 5D6XA 2ZGWA 2L0AA 2L5QA 1ABQA 1RUWA 1YWPA 4GLMA 2L3QA 2FG0A 3OW2P 3X28B 2VXFA 3FDRA 3FC3A 2EIFA 1TWBA 2DTIA 4J7IA 5J26A 3CXCA 3SDZA 1U5SA 4B6MA 4FT2A 3CCQA 2MK5A 3I56T 3V8LA 2A3LA 2RQRA 3THKA 2ZZDA 2J6OA 1QWFA 3CBOA 2MCNA 1MNEA 1KJWA 2YSQA 2C06A 2DYIA 4ZNXA 1QCFA 3P8BB 3FRNA 1SHGA 3HRSA 4O5VA 3X26B 1WZOA 2PVDB 3IQLA 1WXTA 1AEYA 1KHIA 2QI2A 3E9FA 4J8OA 1D0XA 2GBQA 2E10A 4FYYB 4DOWA 2JM9A 2M0YA 2JTMA 3JSCA 4M7AF 1ZSGA 1XQHA 2QA4T 4A63B 2F1LA 4A4FA 1VIFA 2HBPA 2KYBA 3CPWA 5CIUA 4X9CA 3RDVA 1VQOQ 1T3SA 1ZX6A 4EMHA 4AG2C 2NUPA 3V8KA 2PUKB 3V7CA 3GP8A 4WTOB 4ATOA 4QVZA 5LJ5d 1CSKA 1Y71A 1Q95G 4FW1A 1RAEB 1FX7A 3M4YA 1C0MA 4IUQA 1S72T 2ZPGB 2FRWA 2X4XA 4GLKA 4UC4A 2V1RA 1R0CB 2FPEA 5L23A 4QVCA 1I81A 2E6NA 1WIEA 4Y91A 5CR2A 1PKSA 4CC2A 5CAIA 3RKXA 1M8VA 2RK1A 4PJLA 4ZN3A 3OYYA 3CCQT 1SEMA 3H6ZA 1U1TA 3KFVA 1H3HA 1VQ4T 1M1FA 1AVZC 2E5KA 2QTVA 5EC7A 5CO7A 3UA6A 3U23A 2NLUA 5A2QE 4B9WA 4M7DG 3A8LB 8AT1B 2OTLQ 1Y96A 3EG9B 3CCJA 3JB9J 1RACB 1LNXA 3ASKA 2LTOA 1KIKA 4HCBA 4FL6A 2CZ0B 5GAOp 1NJIR 2EYQA 1KQ2A 4AFZC 1K73R 5GMKh 1C6VX 2F2XA 4JZ4A 4HKEA 4C5EA 2A7YA 2QXFA 2RNAA 1VQ5Q 1LJOA 2HD0A 4XTYA 3LYIA 4FYXB 2RI5A 2OAWA 3GIBA 4F04B 4HT9A 3M0PA 1JEGA 5CKDA 3VUBA 3MCAB 4JJNK 3CCLQ 2DK3A 2KQWA 2XDPA 4C8QD 1OOTA 4K11A 3V7SA 1VIEA 2HKQB 1D3BB 1T0JA 2RB6A 3UWNA 2CT4A 4PJOD 4YTLA 1WJQA 1NLOC 3A98A 1PM3A 1K1ZA 1VQ7A 1ACMB 2BIVA 2MMPA 5A0DA 3ZFJA 1Q81R 2LJ0A 4JRPA 2K3YA 1KHCA 2E3HA 3DB3A 4QQDA 3T9NA 3CCVA 1NM7A 1QWEA 2BUDA 4OVAA 1VA7A 3FEOA 3OYIA 1UGSB 4J9FA 2DO3A 4N4HA 4IIOA 2E5QA 3VS3A 1CKBA 1H3ZA 4CI0C 1GRIA 3OS2A 2QYZA 1ZA1B 4R56A 4N4GA 1H641 2L3SA 2W0ZA 2CUBA 4QVDA 1JRIA 1UGPB 8ATCB 1K9MC 2YRDA 4OGEA 1O9SA 3PGGA 4EMKA 2ECZA 2GFUA 3META 4JZ3A 2CSQA 1PCXA 3TCJA 2LT1A 3NGPA 1U3OA 2JXBA 5FWBA 2A28A 2ZPIB 4JLGA 3OSVA 4FW2A 4BY6C 1VQOT 1M3CA 1ZA2B 4X1VA 2E41A 3OMGA 3CCUQ 1BI3A 2CP0A 1N8RC 2RQTA 1H8KA 2DETA 4M7AD 1LVKA 1ZSZA 2QG9B 3QDRB 1M30A 2RA2A 3HRUA 1MV0B 4M7DB 5CQXA 1PSEA 3CCLA 4J9GA 3DB4A 3WVDB 3DLMA 3Q1JA 5LJ5f 1M1KC 2DIGA 2PZ1A 2DJZA 2EQIA 1BI1A 1TUGB 1NE8A 3I5RA 3GLXA 4PLLA 2LZ6B 3H0IA 2VGNA 2DE0X 2NYSA 2KNBB 4LDUA 4RG8A 1TU0B 2GCXA 1N8RU 1QVFS 2VYTA 3OW2A 1W2BA 1Y96B 4ORZA 1WYXA 1QW1A 2EJFA 1M4ZA 2X3WD 5LJ5e 4M78A 1M2VA 2EJGA 1PWTA 3OBWA 1UHCA 3EGDA 2QGGA 3KUFA 3NPFA 1PNJA 3REAB 2E12A 3HRTA 1M90U 1M1KU 2OTLT 3TU4K 3EFOA 2KROA 4OB2B 3QO3A 2KBTA 4HT8A 1ZBXA 1GBRA 3EHQA 2VASA 3JB9F 4FSXA 3OYBA 3EGUA 5LJ5g 5HKCA 3EGXA 1KQSP 2H3EB 3QYHB 3MEAA 5GAOn 4C0ZA 1Q7YR 2CT3A 2OJ2A 3EAEA 2ED1A 1VQ5T 4R55A 1K76A 1JJ2P 1VQMA 2MOXA 1YJ9Q 3QDFA 1TUCA 1G8XA 2KVQG 2XG8D 3MO8A 4LD9K 3LX7A 3CCLT 2CSIA 3G6EQ 2K2VA 2K3XA 3O8VA 2Y4YA 5LJ3h 1BCOA 2QQRA 3MJXA 2QGFB 2DA9A 1SRMA 1NBEB 3J81E 3GBQA 2FRYA 5KYYB 2M9UA 2K7AA 1WQ7A 4E7SA 5GAOq 2KR3A 3VS6A 1RAIB 4FM4B 3FJPA 1N9SA 1VUBA 2CZ7B 1JB0E 1MNDA 1TSFA 4JRKA 1G3SA 1YJNQ 2O9SA 1W70A 2JJ9A 3M53A 1SSFA 2DAQA 2EQKA 2FL7A 1VQLA 2F69A 2KRMA 2E4HA 5IAYA 2EGAA 2DXBA 4MZTA 3CMAQ 1QVFA 1D09B 1BKBA 2AHJB 2X9HA 4QW2A 1ZSZB 1IHWA 2LQKA 2ROTA 2DKGA 5IHIA 1K0SA 2PQWA 3QG1A 3CCUT 3OS5A 4XK8E 2GF7A 1QP3A 3H8ZA 4EMKC 1YITQ 4GBQA 4OB1B 1Q82R 2LDMA 4PNOA 5L8RE 3L2WA 3L2RA 3EH2A 4CRIA 2B86A 3G4SQ 1PKTA 4JUVA 2V26A 3RKYA 1PRLC 5DLQE 2ZPHB 3CD6Q 4FU6A 1MMNA 4J6WA 1NPRA 1K8AC 3RIRA 1JXOA 2QDYB 3CQTA 2E3IA 3OYJA 1SKUB 2I2LA 1ZSZC 1UG1A 1YNZA 4M78B 3S3MA 2IIMA 1XJWB 2DZCA 2RJEA 2L8DA 3EGDB 3L2ZA 4OMQA 4J5YA 4F14A 1YIJQ 3ZEHA 2HQEA 1VQ8A 1RL2A 1QVGS 1OZ3A 5I2SA 1JQQA 4IKFA 4C92G 4EMGA 1M3AA 2DILA 3CPWS 4M77G 1WJRA 1AOJA 3EGXB 4BI3A 1KD1C 5IXBA 4Z02A 2B8AA 3V8JA 3BFMA 2JTEA 1K8AU 5GAN2 3JCMP 1W4SA 3VJPA 3CCMA 3JCMf 1EFNA 4DQ2A 3EFRA 4FSSA 3X25B 3LLRA 4HVVA 2COYA 2EGCA 5KE2A 2LNVA 1RAAB 2JW4A 3OY9A 2DNUA 4RTUA 4M78C 5EG2A 1VQKQ 1R0BG 1N27A 3JV3A 5GAOl 2LQ8A 5LL6S 3G4SA 1KC8C 3EG9A 5GAN6 1OU8A 4DBFA 1O75A 3I9QA 3KBGA 2KK4A 2CP7A 2J06A 4DOVA 1NEBA 3JB9D 1YJ9T 2ESWA 3C95A 2E65A 1OX9A 2HMAA 5KCHA 3JCMe 4C8QG 4BD3A 2DL5A 1Z9QA 1KD1U 3G6ET 4PJOG 2P0KA 1TUDA 3J80E 2ZPBB 2ENMA 3A8HB 1GL5A 4LDWA 4OMMA 3G7ZA 3CCRQ 3HTRA 3M57A 3RMQA 1WX6A 2WSCE 5KYUA 1SSHA 1LCKA 1WNLA 2M16A 1YIJA 2DRMA 4RUGA 5GMKm 2DMOA 2YT6A 2HBWA 1UGQB 3JCMb 2ED0A 4L59A 4EDUA 1KC8U 1D3BA 3H9NA 1Q86C 1YJNT 4NOYA 5KYWB 3SWNB 2GNCA 4DEXA 4E7JA 2VUBA 3QJYA 3RUXA 2KT1A 4M75G 2LVMA 3EG0A 3CMAT 3G1JA 2OTJA 1TOVA 2V1QA 2HCKA 5FU6B 2AK5A 2FZGB 1VQKA 1QVGA 1HSQA 3CCJQ 1J3TA 3NHNA 4PK4A 3EG3A 2JM8A 1XNIA 2YLCA 2RQVA 1M90R 2E6ZA 2X51A 2COZA 3JCMh 4C92B 2NUZA 4M7AG 5IH2A 5LJ3d 4M77B 1YITT 4HVUA 1M3BA 1NG2A 1Q86U 1T0HA 4M78E 1CKAA 4CC3A 2HEQA 4D8DA 3G4ST 1MGQA 4PJNA 1QVPA 1AWJA 4E7HA 3C12A 5GMKe 1KQSA 3SWNC 3I55Q 3C94A 1HYOA 3CCRA 4IUVA 2XK0A 3OYHA 3CD6T 1WFWA 4HCKA 4PJMA 3EH1A 2EGEA 4LE9A 5DM7R 2DERA 3LWIA 2M51A 1JJ2A 1G3WA 4PFZA 5FU6C 4M7DA 2O2OA 5DLOA 5KCOA 4F7UB 2LCLA 1GXIE 1KQ1A 2DTHA 2OI3A 3OQ5A 2CP2A 3VS0A 3OS1A 2YUNA 3INZA 1WI7A 1NYFA 1YIJT 2ZCFB 2D0NA 1VQ7Q 4J6XA 1RLQC 3FLGA 4C92C 4Z89A 4ZTJA 2DFUA 1YI2A 1ZHIA 2COWA 3CCVQ 3E19A 4E7ZA 4L6V5 1SHFA 2V8JA 4XU2A 3HKSA 2RHIA 4J9BA 4XTZA 5AT1B 2DD5A 1WHJA 1N9RA 5GAN4 3RKWA 4EPCA 1QKWA 1TG0A 2FYKA 3C0CA 4HXJA 5GAN8 4M7DF 3M58A 3QBYA 3M54A 2EQUA 2RJFA 1I1JA 1UE9A 4RTVA 3OB9A 3VS2A 4J9DA 1VQKT 2MWPA 1H92A 2KAFA 2I0NA 2LC4A 7AT1B 3BY7A 3CC2A 2H8HA 3NFCA 4J7FA 2GGRA 2JNGA 4M75B 4D6WA 3I55A 5KYUB 2RHYA 1VQ9A 3QIIA 2DF6A 4OMPA 3JRZA 2EW3A 5D6YA 2IVWA 2EFIA 1G3YA 3RR6A 2ROLA 1TXQA 4EIKA 5GANh 2EKOA 3PMIA 1OV3A 4XTUA 3X24B 2LX7A 3OW2S 5IT9E 1W2BS 1UEBA 4X9DA 2SEMA 3BDLA 5FLXE 1WHLA 3CCRT 3AHUA 1PRMC 2JMCA 1VQPA 1UB4A 4ANJA 1OQKA 1D1AA 3MEUA 3JCMX 1UTIA 1M27C 3TVTA 2BKDN 2FVUA 1KSWA 2QDLA 2FEIA 3TEEA 1KFZA 2HSEB 1AD5A 5LJ5j 2DL4A 4N0AA 5GAMf 3CC7A 2FZKB 4JJCA 3ULRB 2XKOC 4KUIA 4M75C 5KYYA 2VXEA 1U8RA 3JB9I 2D0QB 1G83A 4C0GA 4C92E 3JCMc 1NEGA 4HA8A 1Y7XA 4KH1B 2ABLA 2RH2A 1OX8A 4P5NA 1IGUA 2X4YA 2DPPB 1D1CA 2QQSA 4IIMA 3CC4A 4QT7A 3CCJT 1XOVA 3O5ZA 1PG5B 2F2VA 3CCSA 5GAMe 1MHNA 2FHDA 2J6FA 1VQ6Q 1VQNA 2JOYA 5GMKl 1OYXA 1YFNA 2BE7D 1SRLA 3UA7A 5GAN5 2YLBA 4J9IA 2RI3A 4F7UE 2HL3A 5LJ3f 2LQWA 3OBYA 1K9MU 4QQ6A 1BB9A 1YCYA 1C1AA 1GBQA 1AZEA 1VQMQ 2K57A 1WXBA 2OX7A 5GAMg 4PFPA 3VV0A 1JXMA 2CKKA 1X2KA 2CH4A 3HL8A 3UT1A 1MMAA 3CMEA 2GFAA 2KT8A 1WHHA 2EYWA 2DBKA 2P0PA 4OP0A 5I2MA 3CCEA 3CXCP 2CUDA 4OGCA 1B34B 2KXDA 5LJ3e 1VQ7T 2D1XA 3SEMA 4RG2A 5GJVB 1GCQC 3GNFB 4JRQA 2YDLA 3PVLA 3CCVT 4KGVB 1FMWA 3M59A 4RCCA 3J7AF 1WQWA 1DJ7B 4M7DC 4XTXA 1EIFA 3NTHA 3JCMd 1YJWA 1WGSA 1AZGB 1OU9A 5GAMh 5FWCA 2KSSA 3PNWC 2RMOA 3TSZA 1VQLQ 2QTXA 1G2BA 4RCBA 5LJ3g 3OYFA 4M75E 3A1PA 3R6NA 4CC4B 5FRMA 2RM4A 2DLPA 2YWWA 1KG1A 2K5IA 1VQ6A 4PL6A 4XU3A 2X4JA 3OYLA 4VUBA 1QCNA 1WA7A 4PJJA 1M5Q1 2DXCA 2RK2A 2DVJA 4J9EA 1PHTA 1PSFA 4M7DD 3JB9G 3D7SB 2LP5A 4M78F 4CC7A 4ZGJB 2BZYA 3OMCA 1YCSB 2E1HA 1E6HA 3G71A 4A53A 2K5FA 2VB6A 3LWHA 4JS4A 2KDSA 1YP5A 1ZUYA 3E1SA 4AFUC 1YBYA 4F17A 2HQHA 3SB2A 2VC8A 3GNGA 4IUUA 4ZGEB 2AKLA 1GCPA 2QAZA 1QQJA 2XICA 1FYNA 3JAME 2P0QA 2DEQA 2EYYA 2MWOA 5KH6A 1NJIC 2X3XD 1K73C 5J39A 1RAFB 2K9GA 2KY9A 3M0RA 4HVWA 4LNPA 1I0CA 2R58A 3E2UA 3SHWA 1D0YA 2DM1A 1WHGA 1WHKA 4OMFB 3WXMB 4FYWB 1K4US 9ATCB 3MP8A 2W10A 1VQ8Q 5FRNA 4BI8B 3RMSA 2VGMA 5CK9A 4MMLA 2RHZA 4BDYA 2PVGB 4E7IA 4M7DE 4DA4A 3OYCA 5KYWA 2JS2A 4N0AC 3SWNA 1RLPC 3M0TA 3CCMQ 2VV5A 3S3OA 4OMNA 5GANd 3E9GA 3OS0A 2DX1A 1VQ6T 1Q81C 2K3BA 1NJIU 1VYVA 3DLLA 2CS7A 2YXYA 4KGXB 4IURA 5I22A 4DBRA 2DBMA 1EX4A 1IZ6A 2DL8A 2RQUA 3VYHB 1X2QA 3LGFA 4E7KA 1VQMT 2AIRB 3QPHA 4C92A 5CKHA 5IXFA 4M77A 4XTVA 3QWYA 1X6BA 4ME7A 2KRNA 1HJDA 3TQ7P 1QLYA 3N5BB 2C0TA 1WLPB 1SG5A 2RQWA 2G6FX 3JCMW 4LN2A 3LH5A 3R6OA 2LQNA 2DEUA 1UJYA 1AWOA 1Q81U 3L2VA 4KT0E 2KI7A 3M0UA 4QKUA 4Z88A 3MPUB 3I56A 3GOXA 1M8MA 3L2UA 3CBPA 4F7UA 2CH4W 2GQVA 3OSSC 4C92F 3EG2A 2XMFA 4M77F 3NMZC 1BI2A 5KE3A 1VQLT 4ZGDB 5FROA 1R77A 5D7UA 2ZAEA 3VYGA 3OYEA 4Q5WA 2RHUA 3RNJA 2OTJQ 2K2MA 3EFSA 1YHQQ 1KQSS 2CREA 2X4WA 1VOMA 3RERA 3NTKA 2J05A 3PVQA 3TREA 2CP5A 2QA4A 4F16A 2QQ9A 4LDYA 3A8MB 1A0NB 2P4RA 2LCCA 1JJ2S 1Y57A 2HKNA 1X43A 5GMKj 3PTAA 4F7UF 1FMVA 4MZPA 5A0LA 1BBZA 3FIFA 4C5IA 3L1AA 1I4K1 1XTDA 2YUOA 2KRSA 1ZUUA 1I5LA 4C5HA 3V7RA 3I5SA 4Y92A 3AT1B 3LW5E 2CDTA 2GQIA 1SPKA 5KYNA 1Z9ZA 2A37A 2PNIA 2HL5C 1K9MR 4M75A 4M78D 3OYGA 4A4HA 2AZSA 3QYGB 1S72A 3QWXX 1D0ZA 4MDXA 3M4GA 2LJ1A 2DYBA 1LOJA 2EVRA 4BE0A 5GAMd 3JCMg 2HQXA 4E6RA 1K9AA 5FU7B 2EBPA 2JN0A 3PIOA 2A08A 1W2BP 2MPXC 4E2FB 5J3BA 1U1SA 1Q7YC 4M7AA 3OYDA 2R57A 1NPPA 4M4ZA 2CGHA 1F1BB 4RTYA 1BI0A 2NUTB 4FYVB 1N8RR 3VS7A 1VQ8T 1YI2Q 2DRKA 2MI6A 2J6KA 1WXUA 2V8IA 1VQ4A 4N4IA 5HY6A 4HCZA 4M75F 2EJ9A 1YHQA 4BB7A 1R8OB 1VYTA 4KH0B 4JPBW 4BI4A 1YWOA 2E70A 3CCMT 3WVEB 3MEVA 2CP3A 4AFSC 3QJ6A 3SFMA 1M1KR 2FZCB 1HK9A 3VUZA 1Y07A 2HNIA 4AG1C 5GANf 1I8FA 2BTTA 3NTIA 2PU9B 5FU7C 3C4SA 4RKUE 4A4GA 5I11A 5HK0A 1Q7YU 3CC2Q 5HK3A 1HXDA 1E7OA 1D1BA 1WJSA 2EQJA 4J9CA 2VVKA 1M1GA 4TVRA 1VQ9Q 1GCQA 3DKMA 1P92A 2WACA 4PFOA 2Z0WA 2O31A 2XHCA 4JS5A 3PFSA 4JJDA 1B07A 1UGRB 2MIOA 3JCMJ 5GANe 1VQPQ 4XQ3A 1V29B 4C8QB 4OMLA 3A5ZB 4IUPA 2M1HA 5C0MA 4M77C 1ZBJA 2XU8A 1Q82C 4PJOB 4BUGA 4BACA 2MYSA 4RMOA 1RABB 5HCKA 1I07A 2QEXQ
chains in the Genus database with same CATH topology
1VQLT 3MEWA 4C8QF 2E64A 5LJ3f 3MP6A 3OBYA 4XU1A 1K9MU 4QQ6A 5GAN7 4F7UG 5GANg 3PMTA 4ZN1A 1YCYA 1QP2A 4PKCC 1B34A 3CEYA 4PJOF 3BW1A 1SSFA 3M53A 2DAQA 2EQKA 2FL7A 2K57A 5GANj 1VQLA 2RI2A 3A8GB 5GAMg 2F69A 2XDDA 2EWNA 2MF2A 5D6WA 1X6OA 4II1A 3VV0A 4E47A 4J6YA 5IAYA 3CD6A 3FB9A 5D6XA 2M0OA 3L42A 5GAMj 2CKKA 2DXBA 2ZGWA 4MZTA 3UT1A 3HL8A 2OTJT 1G3TA 1QVFA 3CMEA 1BKBA 2AHJB 2GFAA 2L5QA 4A54A 1YHQT 4QW2A 2P4TA 4C92D 2LQKA 4JLIA 4M77D 2P0PA 4OP0A 3JCMV 5I2MA 2DKGA 3X28B 3CCEA 2DXTA 2VXFA 3FDRA 2DXUA 2JUFA 3FC3A 4OGCA 1B34B 5LJ3e 1VQ7T 2EIFA 4XU0A 2PQWA 3QZ9B 3QG1A 2DTIA 4RG2A 4C8QC 3P8DA 3OS5A 4J7IA 4XK8E 5J26A 4OF1A 3GNFB 3CXCA 2GF7A 1VQOA 1QP3A 3H8ZA 3A8OB 3SDZA 4FT2A 3JCMQ 3CCQA 3I56T 4JRQA 4EMKC 4HCCA 4PJOC 3CCVT 4OB1B 3V8LA 2A3LA 2LDMA 2D6FA 3M59A 2ZPEB 2ZZDA 4PNOA 5L8RE 3L2WA 4RCCA 3J7AF 1WQWA 3CBOA 4GY5A 1DJ7B 4X34A 4M7DC 3CBMA 3L2RA 4XTXA 3QHSA 1EIFA 4CRIA 2C06A 3NTHA 3JCMd 1WPYA 2X35A 1YJWA 1WGSA 3P8BB 3FRNA 5GAMh 5GAOr 4JUVA 2KSSA 3HRSA 4O5VA 3PNWC 3RKYA 3X26B 2PVDB 2QTXA 4M7AB 5DLQE 2ZPHB 4RCBA 5LJ3g 3OYFA 4FU6A 4M75E 1KHIA 4J6WA 1NPRA 2QI2A 3E9FA 3M55A 3M9QA 4J8OA 1K8AC 5FRMA 4Y28E 5LJ3j 2E10A 4FT4A 2QDYB 3RIRA 2RM4A 4DOWA 1KG1A 2K5IA 3OYJA 4C0FA 1VQ6A 4PL6A 4XU3A 2I2LA 2JTMA 2X4JA 3BDUA 3JSCA 4M7AF 2XI9A 4ELZC 3OYLA 4M78B 4VUBA 1XQHA 4R56A 3X20B 3S3MA 2QA4T 2DZCA 1M5Q1 2DXCA 2RJEA 2L8DA 2RK2A 4A4FA 2QEXA 1VIFA 3L2ZA 2DIQA 4XAXB 4XTWA 2HBPA 1BYMA 1PSFA 4J5YA 3CPWA 4ZTFA 4M7DD 3JB9G 3ZEHA 5CIUA 4V2SA 3QKJA 5CVIA 4BY6B 5I21A 1Q82U 4X9CA 4M78F 5DY9A 4ZGJB 3OMCA 1YI2T 2HQEA 4EMHA 1VQ8A 2E1HA 1RL2A 3G71A 1OZ3A 4A53A 5I2SA 2K5FA 1QVGS 4M77E 1OI1A 4IKFA 3LWHA 3V8KA 4C92G 4LDXA 4JS4A 2PUKB 4EMGA 5GMKi 2KDSA 3V7CA 2KMTA 3CPWS 3E1SA 3HP9A 4M77G 3MHXA 1YBYA 4NS5A 5CKFA 1WJRA 4BI3A 3GP8A 3SB2A 4ATOA 4QVZA 5LJ5d 1KD1C 2VC8A 3GNGA 4Z02A 3VKIA 4IUUA 5CCAA 4ZGEB 2B8AA 1Y71A 2CZ1B 3V8JA 4NL2A 3BFMA 1FX7A 3M4YA 1S72T 4IUQA 4M7AC 1K8AU 2ZPGB 5GAN2 3JCMP 1W4SA 2OTLA 3VJPA 3CCMA 3HPWA 3JCMf 2EAYA 2X4XA 4GLKA 2XICA 4UC4A 4DQ2A 3EFRA 3X25B 2O4XA 3LLRA 2RJCA 3JAME 1N6AA 5KE2A 2LNVA 2P0QA 4NL3A 2DEQA 4M75D 3OY9A 2MWOA 5KH6A 1NJIC 4M78C 2LT4A 4KULA 5EG2A 1K73C 5J39A 1N27A 3HFNA 4QVCA 3QUIA 5GAOl 1I81A 2E6NA 2KY9A 2LQ8A 4LDVA 4Y91A 3SD4A 5CR2A 3CC2T 2QQBA 5LL6S 5CAIA 3G4SA 5AYFA 2R58A 1KC8C 3RKXA 5GAN6 2RK1A 4OMFB 2JVVA 1M8VA 3I55T 3WXMB 4ZN3A 1VQ5A 1VQ9T 3MP8A 1O75A 3OYYA 1AHJB 3KBGA 2KK4A 3CCQT 4C0DB 4DOVA 3JB9D 1YJ9T 5FRNA 3H6ZA 1U1TA 4C8QE 3C95A 2E65A 3HFOA 4BI8B 5KCHA 3RMSA 2VGMA 1M1FA 1VQ4T 3JCMe 4C8QG 4BD3A 4PJOE 3KXTA 1KD1U 5CK9A 4MMLA 2RHZA 3G6ET 3VU3C 4BDYA 2PVGB 4PJOG 2P0KA 5CO7A 4E7IA 4M7DE 3J80E 2ZPBB 3A8HB 2EQMA 4LDWA 4DA4A 3G7ZA 3OYCA 2NLUA 5A2QE 4B9WA 4M7DG 4N0AC 3SWNA 1VQPT 3A8LB 2OAUA 2WSEE 3M57A 3RMQA 1Y96A 2WSCE 2VV5A 3CCJA 3CPFA 4WF2A 3S3OA 1M90C 3JB9J 5GANd 1WNLA 2M16A 3E9GA 3OS0A 1YIJA 5GMKm 1LNXA 3ASKA 2LTOA 1Q81C 1NJIU 2ZPFB 1VQ6T 4A4KA 3S3NA 3DLLA 4HCBA 2CS7A 1UGQB 4FL6A 2CZ0B 3JCMb 2XIDA 5GAOp 1BIAA 4IURA 2DVEA 2EYQA 2YHTA 1KQ2A 4L59A 5GAOm 4L5GA 4EDUA 5GMKh 1KC8U 1D3BA 3QXEB 2QEXT 1IZ6A 1Q86C 1BIBA 3CC7T 1YJNT 4HKEA 3LH0A 4NOYA 4C5EA 3VYHB 2A7YA 2QXFA 4OB3B 3LGFA 1LJOA 3SWNB 4E7KA 2HD0A 3ER0A 4XTYA 4E7JA 3QPHA 1VQMT 3LYIA 3GPLA 1KQSA 3ME9A 4C0DC 2VUBA 2RI5A 3QJYA 5CKHA 3RUXA 4C92A 4MZMA 2L3RA 3GIBA 4M77A 4XTVA 4M75G 2LVMA 3GF5A 4HT9A 4ME7A 3CMAT 2OTJA 5CKDA 3VUBA 3MCAB 3N5BB 4B9XA 4JJNK 5FU6B 2DK3A 2KQWA 3OYKA 3JCMW 2XDPA 4C8QD 3UPUA 3V7SA 4KBMB 1VIEA 2DTOA 2RHXA 1D3BB 3CC4T 1VQKA 4BE1A 2RB6A 3UWNA 1QVGA 3R6OA 2HAXA 4PJOD 4YTLA 1WJQA 3CCST 1XNIA 1Q81U 4M7AE 2YLCA 1QVFS 2E6ZA 3M5AA 1VQ7A 2BIVA 2MMPA 3JCMh 5A0DA 4C92B 4KT0E 3ZFJA 3L2VA 1VQNT 3CCUA 3OA6A 4M7AG 2MAMA 2LX9A 4JRPA 5LJ3d 2K3YA 4M77B 1YITT 1KHCA 3DB3A 3I56A 3GOXA 2V8KA 4QQDA 3T9NA 3CCVA 1Q86U 3L2UA 2BUDA 4OVAA 3CBPA 4F7UA 1ZQ1A 3FEOA 1UGSB 2H3JA 3OYIA 2DO3A 2GQVA 4N4HA 4M78E 2XD0A 1FWZA 2E5QA 3QZ5B 1MGQA 2IG0A 3OSSC 3G4ST 4C92F 1QVPA 1H3ZA 4CI0C 4M78G 3OS2A 4E7HA 4M77F 3C12A 5GMKe 1BI2A 3SWNC 5KE3A 4JRIA 1H641 1OZ2A 3C94A 4N4GA 4ZGDB 1JRIA 1UGPB 2DD4A 4QVDA 3CCRA 1FXXA 4IUVA 5FROA 1K9MC 2XK0A 3OYHA 3CD6T 4OGEA 3VYGA 4JDSA 1O9SA 3PGGA 4EMKA 3OYEA 4Q5WA 5DM7R 2RHUA 2PVOB 3CMET 2GFUA 3META 3LWIA 1JJ2A 2WSFE 1G3WA 3EFSA 2RJDA 5FU6C 5DLOA 4M7DA 5KCOA 1KQSS 1G5VA 3TCJA 2QQAA 2X4WA 4MMKA 4F7UB 2LCLA 2F5TX 1GXIE 3RERA 3NTKA 3CCET 1KQ1A 2DTHA 2LT1A 3TREA 2Y4XA 3OQ5A 2QA4A 2QQ9A 3OS1A 4LDYA 3INZA 3A8MB 2ZPIB 4JLGA 3OSVA 1YIJT 2LCCA 2ZCFB 4J6XA 4BY6C 2K4YA 4BDZA 1JJ2S 1VQOT 5GMKj 3PT9A 3FLGA 3PTAA 2E41A 4F7UF 3OMGA 5LJ5h 1BI3A 4C92C 1N8RC 3UDCA 4MZPA 4ZTJA 5A0LA 2Y90A 4EMKB 1YI2A 1ZHIA 3FIFA 3E19A 2O4XB 4M7AD 4MDWA 3L1AA 1I4K1 4L6V5 4C5IA 1XTDA 3QDRB 2V8JA 1I5LA 2RA2A 3HRUA 4C5HA 4XU2A 3V7RA 4M7DB 5CQXA 3LW5E 1PSEA 3CCLA 1YJWT 3HKSA 2RHIA 4XTZA 2F5KA 2DD5A 3DB4A 4M75A 3WVDB 2L89A 1N9RA 4M78D 3RKWA 3DLMA 2RD1A 3Q1JA 4A4HA 3QYGB 2FYKA 4EPCA 5GAN8 3OYNA 4OB0B 1S72A 4M7DF 3M58A 5LJ5f 1M1KC 2DIGA 4MDXA 3QBYA 3M54A 5IN1A 2EQUA 3M4GA 3JB9H 2DJZA 2RJFA 1LOJA 1TH7A 4BE0A 4E7LA 5GAMd 1BI1A 1K73U 1NE8A 3URGA 3GLXA 4PLLA 3OB9A 3JCMg 5GAN4 2HQXA 1VQKT 2MWPA 2VGNA 5FU7B 2JN0A 3PIOA 3M56A 3RESA 2KAFA 5J3BA 1U1SA 2LC4A 3BY7A 1Q7YC 5CKEA 4M7AA 3CC2A 2R5AA 2O01E 4LDUA 3MP1A 4RG8A 2GCXA 3NFCA 4J7FA 2R57A 3OYDA 1NPPA 1X75C 2CGHA 2VYTA 4PLIA 2JNGA 4M75B 1BI0A 3CCUT 4D6WA 2LRQA 3OW2A 1W2BA 1Y96B 1IREB 3I55A 3OYGA 2CZ6B 2RHYA 1VQ9A 1JBMA 3HHTB 3QIIA 1VQ8T 1QW1A 2MI6A 3JRZA 3G71T 3PIPA 5D6YA 1YJ9A 2EJFA 2EFIA 2IVWA 4ELYC 1M4ZA 2V8IA 1G3YA 5LJ5e 4M78A 2EJGA 1VQ4A 4N4IA 5HY6A 4HCZA 3OBWA 5GANh 4M75F 2EKOA 3PMIA 2EJ9A 4XTUA 3X24B 3G6EA 3KUFA 3P8HA 3S6WA 1UEBA 3OW2S 4BB7A 5IT9E 1YHQA 1W2BS 4X9DA 1R8OB 3CXCS 3BDLA 2E12A 5FLXE 3CCRT 4BI4A 3HRTA 3AHUA 1M90U 1M1KU 2OTLT 3TU4K 2JTFA 2E70A 5CQYA 3CCMT 1UB4A 3WVEB 3MEVA 1VQPA 3OYMA 5A0GA 2K5LA 3QJ6A 3SFMA 4J83A 2XDBA 4OB2B 3QO3A 1HK9A 4HT8A 1ZBXA 4QQGA 3F70A 3MEUA 3VUZA 3LGLA 3JCMX 4O6JA 3JB9F 4FSXA 3OYBA 2BKDN 1Y07A 4FIBA 2HNIA 5LJ5g 3L2QA 2FVUA 5HKCA 5GANf 1I8FA 3TEEA 3NTIA 2PU9B 5FU7C 3C4SA 4RKUE 4A4GA 1Q7YU 5HK0A 4C5GA 5LJ5j 3QYHB 3MEAA 5M9OA 4C0ZA 5GAOn 4N0AA 5GAMf 5HK3A 3CC7A 1HXDA 2FB7A 1M9SA 1YJNA 3EAEA 1WJSA 2XKOC 2EQJA 1VQ5T 1N8RU 2PUOB 4KUIA 4M75C 4A4EA 4R55A 2RO0A 1M1GA 2VXEA 4TVRA 1U8RA 5CKBA 3JB9I 4C8QA 2D0QB 1VQMA 3DKMA 2D9TA 1P92A 2WACA 4C0GA 4C92E 2YRVA 4PJOA 2XHCA 3JCMc 4HA8A 1Y7XA 2KVQG 2XG8D 2DZ9A 2RH2A 3MO8A 4IUTA 3PFSA 4JS5A 4P5NA 3CMAA 4LD9K 3LX7A 3CCLT 2R5MA 3HSBA 4BE2A 2X4YA 2K2VA 2K3XA 1UGRB 2DPPB 3O8VA 2Y4YA 5LJ3h 2QQSA 2CYZB 2QQRA 3JCMJ 5GANe 3CC4A 5GAN3 3CCJT 1NZ9A 1XOVA 3ZBDA 3J81E 4LD6A 4XQ3A 5C6SA 5GAMe 3CCSA 1V29B 1MHNA 2FHDA 2JZ2A 2M9UA 4C8QB 1WQ7A 3A5ZB 4IUPA 2M1HA 5GAOq 1VQNA 2JOYA 5C0MA 4M77C 1RI0A 5GMKl 1OYXA 2XU8A 1Q82C 4FM4B 4PJOB 4BUGA 4BACA 1YITA 3FJPA 1N9SA 1VUBA 2CZ7B 5GAN5 2YLBA 4RMOA 3OYAA 1X01A 3QSUA 1JB0E 2RI3A 2G3RA 4JRKA 4KUDK 1G3SA 4F7UE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEW A;  2RHX A;  4QVZ A;  4Z02 A;  3MP6 A;  4BE1 A;  3UWN A;  4IUU A;  4QQ6 A;  2B8A A;  3PMT A;  1WJQ A;  2R5A A;  3CEY A;  3MP1 A;  3OYD A;  1SSF A;  4IUQ A;  2R57 A;  2DAQ A;  2VYT A;  2EQK A;  1XNI A;  4PLI A;  2RI2 A;  2LRQ A;  2X4X A;  2BIV A;  2RHY A;  5D6W A;  4II1 A;  4UC4 A;  3QII A;  5IAY A;  3L2V A;  2O4X A;  3LLR A;  5D6X A;  2M0O A;  2RJC A;  3L42 A;  5D6Y A;  3OA6 A;  2CKK A;  2EFI A;  2K3Y A;  5KE2 A;  3UT1 A;  1KHC A;  3DB3 A;  3GOX A;  4QQD A;  3OY9 A;  2MWO A;  5KH6 A;  2GFA A;  3L2U A;  2BUD A;  4N4I A;  4OVA A;  3FEO A;  4HCZ A;  3OYI A;  4QW2 A;  2EKO A;  3PMI A;  4N4H A;  5J39 A;  1N27 A;  2E5Q A;  3KUF A;  3P8H A;  2IG0 A;  3S6W A;  2E6N A;  1H3Z A;  3SD4 A;  3BDL A;  3OS2 A;  4E7H A;  2R58 A;  3FDR A;  5KE3 A;  4N4G A;  1OZ2 A;  2JTF A;  3FC3 A;  3MEV A;  4IUV A;  5FRO A;  3OYM A;  2XK0 A;  3OYH A;  2PQW A;  3MP8 A;  3QJ6 A;  4RG2 A;  3P8D A;  5J26 A;  3OYE A;  5FRN A;  2GF7 A;  3H6Z A;  4QQG A;  3H8Z A;  3F70 A;  3MEU A;  4Q5W A;  2RHU A;  3LGL A;  5KCH A;  2GFU A;  3OYB A;  2BKD N;  3MET A;  2LDM A;  4BD3 A;  3L2Q A;  2RJD A;  3L2W A;  5KCO A;  4E7J A;  4GY5 A;  1G5V A;  2RHZ A;  3NTI A;  2X4W A;  4X34 A;  3C4S A;  4A4G A;  3L2R A;  2P0K A;  4BDY A;  4C5G A;  4E7I A;  4CRI A;  3NTK A;  3MEA A;  3NTH A;  2EQM A;  5M9O A;  3OYC A;  2X35 A;  2NLU A;  1WGS A;  3OQ5 A;  4B9W A;  3EAE A;  3OS1 A;  1WJS A;  3PNW C;  2EQJ A;  4A4E A;  2LCC A;  2RO0 A;  4BDZ A;  3OYF A;  3S3O A;  4FU6 A;  3FLG A;  2M16 A;  3E9G A;  3E9F A;  3OMG A;  2D9T A;  3M9Q A;  3OS0 A;  2WAC A;  5FRM A;  3ASK A;  2LTO A;  2YRV A;  4ZTJ A;  3S3N A;  3OYJ A;  2O4X B;  4FL6 A;  3MO8 A;  4IUT A;  3PFS A;  4PL6 A;  4C5I A;  4IUR A;  3LX7 A;  2R5M A;  4L59 A;  3OYL A;  4C5H A;  4EDU A;  4BE2 A;  2X4Y A;  3S3M A;  2K3X A;  2RHI A;  3O8V A;  2QQS A;  3LH0 A;  2RJE A;  2L8D A;  2QQR A;  4A4F A;  4C5E A;  2F5K A;  2DIQ A;  3LGF A;  3DB4 A;  4ZTF A;  2L89 A;  4E7K A;  3OYG A;  3DLM A;  3ZEH A;  3Q1J A;  4LD6 A;  3QKJ A;  3LYI A;  5CIU A;  4A4H A;  5C6S A;  3OYN A;  1MHN A;  2FHD A;  3ME9 A;  2RI5 A;  2JZ2 A;  2DIG A;  2L3R A;  3OMC A;  3QBY A;  2HQE A;  4IUP A;  2EQU A;  2M1H A;  5IN1 A;  2RJF A;  5C0M A;  4BE0 A;  2LVM A;  1RI0 A;  4E7L A;  1OZ3 A;  1OYX A;  4BAC A;  4IKF A;  1OI1 A;  4PLL A;  3OB9 A;  3OYA A;  4B9X A;  2RI3 A;  2G3R A;  3OYK A;  2HQX A;  2XDP A;  2MWP A;  4NS5 A;  1WJR A; 
#chains in the Genus database with same CATH topology
 3CC7 Q;  2E64 A;  3I35 A;  2CP6 A;  5GAN 7;  1JO8 A;  5GAN g;  4ZN1 A;  1QP2 A;  3BE3 A;  1B34 A;  4PKC C;  3CEY A;  3UF4 A;  2K79 A;  1QVF P;  2RI2 A;  3A8G B;  2XDD A;  2EWN A;  5D6W A;  4E47 A;  2YRC A;  3FB9 A;  2M0O A;  3L42 A;  5GAM j;  2OTJ T;  1G3T A;  4LUE A;  1IRX A;  4A54 A;  1YHQ T;  1MMG A;  1AWW A;  2P4T A;  4C92 D;  4JLI A;  2L3P A;  4M77 D;  3CC4 Q;  2HZY A;  3JCM V;  3M0S A;  2C0O A;  2DXT A;  2DXU A;  3CCS Q;  2JUF A;  5KYX B;  4XU0 A;  3QZ9 B;  4C8Q C;  3P8D A;  1Q82 U;  4OF1 A;  1VQO A;  1VQN Q;  3JCM Q;  3A8O B;  4HCC A;  2QAS A;  4PJO C;  1FMK A;  2D6F A;  2ZPE B;  4GY5 A;  2A0F B;  4LXC A;  4X34 A;  3CBM A;  3QHS A;  1HD3 A;  1N5Z A;  1IB8 A;  1WPY A;  2X35 A;  2K6D A;  2HSP A;  5GAO r;  4DBH A;  2FPF A;  4M7A B;  3M55 A;  3M9Q A;  4Y28 E;  5LJ3 j;  4FT4 A;  2BZX A;  3CME Q;  4C0F A;  1I5O B;  3BDU A;  2XI9 A;  4ELZ C;  3ZL7 C;  3X20 B;  2D8H A;  3CCE Q;  1MMD A;  2QEX A;  2IPO B;  2DIQ A;  4XAX B;  4XTW A;  2LNH B;  1BYM A;  1TS9 A;  2RF0 A;  4ZTF A;  4V2S A;  3QKJ A;  5CVI A;  4BY6 B;  5I21 A;  1YN8 A;  1V76 A;  5DY9 A;  2GTO A;  1YI2 T;  3PE0 A;  3FJ5 A;  1UDL A;  4M77 E;  1OI1 A;  1JU5 C;  2FPD A;  4LDX A;  5GMK i;  1E6G A;  2KMT A;  1MV3 A;  3HP9 A;  4NS5 A;  3MHX A;  5CKF A;  1YJW Q;  2AZV A;  3VKI A;  5CCA A;  1W1F A;  2CZ1 B;  4NL2 A;  4M7A C;  2OTL A;  3HPW A;  2EAY A;  1K8A R;  2O4X A;  2RJC A;  1N6A A;  2YUQ A;  4NL3 A;  3H41 A;  4M75 D;  1UEC A;  2LT4 A;  2NUP B;  3H0F A;  4KUL A;  1OEB A;  1X27 A;  3HFN A;  2JT4 A;  3QUI A;  4LDV A;  4RTT A;  4ESR A;  3SD4 A;  3CC2 T;  2QQB A;  5FW9 A;  5AYF A;  2JVV A;  3I55 T;  1VQ5 A;  1VQ9 T;  1X69 A;  1AHJ B;  4C0D B;  4DBQ A;  4C8Q E;  3G71 Q;  3HFO A;  2YUP A;  2EPD A;  4PJO E;  3KXT A;  3VU3 C;  2L2P A;  1WDX A;  1IGQ A;  1KD1 R;  2EQM A;  1MUZ A;  1RI9 A;  2EKH A;  1TTH B;  4D8K A;  1VQP T;  2OAU A;  2WSE E;  5GJW B;  1RAD B;  2QK0 A;  3CPF A;  4WF2 A;  1M90 C;  1M2O A;  2ZPF B;  6AT1 B;  2ATC B;  4A4K A;  3S3N A;  1UUE A;  2XID A;  1BIA A;  2DVE A;  2YHT A;  5GAO m;  4L5G A;  2QEX T;  3QXE B;  1OUL A;  1BIB A;  3CC7 T;  3LH0 A;  1KC8 R;  4OB3 B;  1AT1 B;  1QCO A;  3ER0 A;  3GPL A;  3ME9 A;  4C0D C;  4MZM A;  2L3R A;  1Y0M A;  3EHR A;  3GF5 A;  1QVG P;  4WCI A;  4B9X A;  3OYK A;  2BE9 B;  3UPU A;  3CPW P;  4KBM B;  2DTO A;  2RHX A;  3CC4 T;  4BE1 A;  2HAX A;  1IXD A;  3CCS T;  1X6G A;  2KGT A;  4M7A E;  1AWX A;  3M5A A;  2VWF A;  2KXC A;  1VQN T;  3CCU A;  3OA6 A;  2MAM A;  2LX9 A;  2FO0 A;  2V8K A;  1ZQ1 A;  1RAH B;  2H3J A;  5IHN A;  2F2W A;  2XD0 A;  1FWZ A;  1Q86 R;  3QZ5 B;  2IG0 A;  4M78 G;  4JRI A;  1OZ2 A;  4OMO A;  2DD4 A;  1SF9 A;  1FXX A;  4JDS A;  1RAG B;  4J9H A;  2PVO B;  3CME T;  2WSF E;  1KK7 A;  2RJD A;  1G5V A;  2AKK A;  2QQA A;  4MMK A;  4DEY A;  2M02 A;  2NWM A;  2F5T X;  3CCE T;  2GTJ A;  4KRT A;  2Y4X A;  2P84 A;  2LMJ A;  4R0K A;  1BU1 A;  4KGZ B;  2J7I A;  1VYU A;  4BDZ A;  1PD1 A;  1W6X A;  2K4Y A;  3PT9 A;  5LJ5 h;  1GFD A;  3UDC A;  2Y90 A;  3I56 Q;  4EMK B;  2O4X B;  2O9V A;  4MDW A;  1IHV A;  2HDA A;  3VRZ A;  1PC0 A;  1ZUK A;  1YJW T;  4Z8A A;  1S1N A;  1UJ0 A;  2F5K A;  1WHM A;  2A36 A;  2L89 A;  2NUT A;  2RD1 A;  1B3Q A;  4RTW A;  4RTX A;  4OB0 B;  2RN8 A;  3OYN A;  1K0X A;  1B7T A;  3VS1 A;  2KEA A;  5IN1 A;  3JB9 H;  1QKX A;  2JS0 A;  1TH7 A;  2LJ3 A;  4E7L A;  4JJB A;  1K73 U;  3URG A;  2JMA A;  5IHK A;  3UAT A;  3M56 A;  2QA4 Q;  3RES A;  2D8J A;  2C0I A;  5CKE A;  2R5A A;  2O01 E;  3MP1 A;  2LCS A;  1X75 C;  4PLI A;  3VRY A;  2LRQ A;  1IRE B;  2CZ6 B;  3M0Q A;  1JBM A;  3HHT B;  2DL7 A;  3G71 T;  3PIP A;  1YJ9 A;  4ELY C;  1OPL A;  1T3L A;  1UFF A;  3G6E A;  2SRC A;  3P8H A;  3S6W A;  3RBB B;  3TSW A;  3CXC S;  1U06 A;  2DL3 A;  1S72 Q;  2JTF A;  5CQY A;  2KE9 A;  3OYM A;  5A0G A;  2K5L A;  4J83 A;  2XDB A;  4QQG A;  1EZZ B;  3F70 A;  3LGL A;  4O6J A;  1QMC A;  4FIB A;  4AMC A;  3L2Q A;  3VS5 A;  1IO6 A;  1M2V B;  1ABO A;  4C5G A;  1UGV A;  5M9O A;  2O88 A;  4AT1 B;  2FB7 A;  1YJN A;  1M9S A;  2BZ8 A;  2PUO B;  4A4E A;  2RO0 A;  4RTZ A;  3EFO B;  5CKB A;  3H0H A;  2EYZ A;  4C8Q A;  3CCQ Q;  2AT1 B;  2D9T A;  1NLP C;  2YRV A;  1LPL A;  4LUD A;  1ZLM A;  4PJO A;  1BK2 A;  1VQ4 Q;  3MKD A;  3REB B;  2DZ9 A;  4IUT A;  3EG1 A;  3CMA A;  2R5M A;  3HSB A;  4BE2 A;  2CYZ B;  1PD0 A;  5GAN 3;  1NZ9 A;  3ZBD A;  2EYX A;  1UHF A;  4LD6 A;  5C6S A;  1BCM A;  2JZ2 A;  1RI0 A;  3VS4 A;  1GFC A;  1YIT A;  1ARK A;  3OYA A;  3QSU A;  1X01 A;  2G3R A;  2PTK A;  4KUD K;  1V1C A;  2DJQ A;  3MEW A;  4C8Q F;  3MP6 A;  4XU1 A;  4F7U G;  3PMT A;  1NYG A;  2VKN A;  4PJO F;  5KYX A;  3BW1 A;  4AFQ C;  5GAN j;  2KYM A;  4FCY A;  2MF2 A;  5ECA A;  1X6O A;  4II1 A;  3CD6 A;  2RPN A;  4J6Y A;  1OPK A;  5D6X A;  2ZGW A;  2L0A A;  2L5Q A;  1ABQ A;  1RUW A;  1YWP A;  4GLM A;  2L3Q A;  2FG0 A;  3OW2 P;  3X28 B;  2VXF A;  3FDR A;  3FC3 A;  2EIF A;  1TWB A;  2DTI A;  4J7I A;  5J26 A;  3CXC A;  3SDZ A;  1U5S A;  4B6M A;  4FT2 A;  3CCQ A;  2MK5 A;  3I56 T;  3V8L A;  2A3L A;  2RQR A;  3THK A;  2ZZD A;  2J6O A;  1QWF A;  3CBO A;  2MCN A;  1MNE A;  1KJW A;  2YSQ A;  2C06 A;  2DYI A;  4ZNX A;  1QCF A;  3P8B B;  3FRN A;  1SHG A;  3HRS A;  4O5V A;  3X26 B;  1WZO A;  2PVD B;  3IQL A;  1WXT A;  1AEY A;  1KHI A;  2QI2 A;  3E9F A;  4J8O A;  1D0X A;  2GBQ A;  2E10 A;  4FYY B;  4DOW A;  2JM9 A;  2M0Y A;  2JTM A;  3JSC A;  4M7A F;  1ZSG A;  1XQH A;  2QA4 T;  4A63 B;  2F1L A;  4A4F A;  1VIF A;  2HBP A;  2KYB A;  3CPW A;  5CIU A;  4X9C A;  3RDV A;  1VQO Q;  1T3S A;  1ZX6 A;  4EMH A;  4AG2 C;  2NUP A;  3V8K A;  2PUK B;  3V7C A;  3GP8 A;  4WTO B;  4ATO A;  4QVZ A;  5LJ5 d;  1CSK A;  1Y71 A;  1Q95 G;  4FW1 A;  1RAE B;  1FX7 A;  3M4Y A;  1C0M A;  4IUQ A;  1S72 T;  2ZPG B;  2FRW A;  2X4X A;  4GLK A;  4UC4 A;  2V1R A;  1R0C B;  2FPE A;  5L23 A;  4QVC A;  1I81 A;  2E6N A;  1WIE A;  4Y91 A;  5CR2 A;  1PKS A;  4CC2 A;  5CAI A;  3RKX A;  1M8V A;  2RK1 A;  4PJL A;  4ZN3 A;  3OYY A;  3CCQ T;  1SEM A;  3H6Z A;  1U1T A;  3KFV A;  1H3H A;  1VQ4 T;  1M1F A;  1AVZ C;  2E5K A;  2QTV A;  5EC7 A;  5CO7 A;  3UA6 A;  3U23 A;  2NLU A;  5A2Q E;  4B9W A;  4M7D G;  3A8L B;  8AT1 B;  2OTL Q;  1Y96 A;  3EG9 B;  3CCJ A;  3JB9 J;  1RAC B;  1LNX A;  3ASK A;  2LTO A;  1KIK A;  4HCB A;  4FL6 A;  2CZ0 B;  5GAO p;  1NJI R;  2EYQ A;  1KQ2 A;  4AFZ C;  1K73 R;  5GMK h;  1C6V X;  2F2X A;  4JZ4 A;  4HKE A;  4C5E A;  2A7Y A;  2QXF A;  2RNA A;  1VQ5 Q;  1LJO A;  2HD0 A;  4XTY A;  3LYI A;  4FYX B;  2RI5 A;  2OAW A;  3GIB A;  4F04 B;  4HT9 A;  3M0P A;  1JEG A;  5CKD A;  3VUB A;  3MCA B;  4JJN K;  3CCL Q;  2DK3 A;  2KQW A;  2XDP A;  4C8Q D;  1OOT A;  4K11 A;  3V7S A;  1VIE A;  2HKQ B;  1D3B B;  1T0J A;  2RB6 A;  3UWN A;  2CT4 A;  4PJO D;  4YTL A;  1WJQ A;  1NLO C;  3A98 A;  1PM3 A;  1K1Z A;  1VQ7 A;  1ACM B;  2BIV A;  2MMP A;  5A0D A;  3ZFJ A;  1Q81 R;  2LJ0 A;  4JRP A;  2K3Y A;  1KHC A;  2E3H A;  3DB3 A;  4QQD A;  3T9N A;  3CCV A;  1NM7 A;  1QWE A;  2BUD A;  4OVA A;  1VA7 A;  3FEO A;  3OYI A;  1UGS B;  4J9F A;  2DO3 A;  4N4H A;  4IIO A;  2E5Q A;  3VS3 A;  1CKB A;  1H3Z A;  4CI0 C;  1GRI A;  3OS2 A;  2QYZ A;  1ZA1 B;  4R56 A;  4N4G A;  1H64 1;  2L3S A;  2W0Z A;  2CUB A;  4QVD A;  1JRI A;  1UGP B;  8ATC B;  1K9M C;  2YRD A;  4OGE A;  1O9S A;  3PGG A;  4EMK A;  2ECZ A;  2GFU A;  3MET A;  4JZ3 A;  2CSQ A;  1PCX A;  3TCJ A;  2LT1 A;  3NGP A;  1U3O A;  2JXB A;  5FWB A;  2A28 A;  2ZPI B;  4JLG A;  3OSV A;  4FW2 A;  4BY6 C;  1VQO T;  1M3C A;  1ZA2 B;  4X1V A;  2E41 A;  3OMG A;  3CCU Q;  1BI3 A;  2CP0 A;  1N8R C;  2RQT A;  1H8K A;  2DET A;  4M7A D;  1LVK A;  1ZSZ A;  2QG9 B;  3QDR B;  1M30 A;  2RA2 A;  3HRU A;  1MV0 B;  4M7D B;  5CQX A;  1PSE A;  3CCL A;  4J9G A;  3DB4 A;  3WVD B;  3DLM A;  3Q1J A;  5LJ5 f;  1M1K C;  2DIG A;  2PZ1 A;  2DJZ A;  2EQI A;  1BI1 A;  1TUG B;  1NE8 A;  3I5R A;  3GLX A;  4PLL A;  2LZ6 B;  3H0I A;  2VGN A;  2DE0 X;  2NYS A;  2KNB B;  4LDU A;  4RG8 A;  1TU0 B;  2GCX A;  1N8R U;  1QVF S;  2VYT A;  3OW2 A;  1W2B A;  1Y96 B;  4ORZ A;  1WYX A;  1QW1 A;  2EJF A;  1M4Z A;  2X3W D;  5LJ5 e;  4M78 A;  1M2V A;  2EJG A;  1PWT A;  3OBW A;  1UHC A;  3EGD A;  2QGG A;  3KUF A;  3NPF A;  1PNJ A;  3REA B;  2E12 A;  3HRT A;  1M90 U;  1M1K U;  2OTL T;  3TU4 K;  3EFO A;  2KRO A;  4OB2 B;  3QO3 A;  2KBT A;  4HT8 A;  1ZBX A;  1GBR A;  3EHQ A;  2VAS A;  3JB9 F;  4FSX A;  3OYB A;  3EGU A;  5LJ5 g;  5HKC A;  3EGX A;  1KQS P;  2H3E B;  3QYH B;  3MEA A;  5GAO n;  4C0Z A;  1Q7Y R;  2CT3 A;  2OJ2 A;  3EAE A;  2ED1 A;  1VQ5 T;  4R55 A;  1K76 A;  1JJ2 P;  1VQM A;  2MOX A;  1YJ9 Q;  3QDF A;  1TUC A;  1G8X A;  2KVQ G;  2XG8 D;  3MO8 A;  4LD9 K;  3LX7 A;  3CCL T;  2CSI A;  3G6E Q;  2K2V A;  2K3X A;  3O8V A;  2Y4Y A;  5LJ3 h;  1BCO A;  2QQR A;  3MJX A;  2QGF B;  2DA9 A;  1SRM A;  1NBE B;  3J81 E;  3GBQ A;  2FRY A;  5KYY B;  2M9U A;  2K7A A;  1WQ7 A;  4E7S A;  5GAO q;  2KR3 A;  3VS6 A;  1RAI B;  4FM4 B;  3FJP A;  1N9S A;  1VUB A;  2CZ7 B;  1JB0 E;  1MND A;  1TSF A;  4JRK A;  1G3S A;  1YJN Q;  2O9S A;  1W70 A;  2JJ9 A;  3M53 A;  1SSF A;  2DAQ A;  2EQK A;  2FL7 A;  1VQL A;  2F69 A;  2KRM A;  2E4H A;  5IAY A;  2EGA A;  2DXB A;  4MZT A;  3CMA Q;  1QVF A;  1D09 B;  1BKB A;  2AHJ B;  2X9H A;  4QW2 A;  1ZSZ B;  1IHW A;  2LQK A;  2ROT A;  2DKG A;  5IHI A;  1K0S A;  2PQW A;  3QG1 A;  3CCU T;  3OS5 A;  4XK8 E;  2GF7 A;  1QP3 A;  3H8Z A;  4EMK C;  1YIT Q;  4GBQ A;  4OB1 B;  1Q82 R;  2LDM A;  4PNO A;  5L8R E;  3L2W A;  3L2R A;  3EH2 A;  4CRI A;  2B86 A;  3G4S Q;  1PKT A;  4JUV A;  2V26 A;  3RKY A;  1PRL C;  5DLQ E;  2ZPH B;  3CD6 Q;  4FU6 A;  1MMN A;  4J6W A;  1NPR A;  1K8A C;  3RIR A;  1JXO A;  2QDY B;  3CQT A;  2E3I A;  3OYJ A;  1SKU B;  2I2L A;  1ZSZ C;  1UG1 A;  1YNZ A;  4M78 B;  3S3M A;  2IIM A;  1XJW B;  2DZC A;  2RJE A;  2L8D A;  3EGD B;  3L2Z A;  4OMQ A;  4J5Y A;  4F14 A;  1YIJ Q;  3ZEH A;  2HQE A;  1VQ8 A;  1RL2 A;  1QVG S;  1OZ3 A;  5I2S A;  1JQQ A;  4IKF A;  4C92 G;  4EMG A;  1M3A A;  2DIL A;  3CPW S;  4M77 G;  1WJR A;  1AOJ A;  3EGX B;  4BI3 A;  1KD1 C;  5IXB A;  4Z02 A;  2B8A A;  3V8J A;  3BFM A;  2JTE A;  1K8A U;  5GAN 2;  3JCM P;  1W4S A;  3VJP A;  3CCM A;  3JCM f;  1EFN A;  4DQ2 A;  3EFR A;  4FSS A;  3X25 B;  3LLR A;  4HVV A;  2COY A;  2EGC A;  5KE2 A;  2LNV A;  1RAA B;  2JW4 A;  3OY9 A;  2DNU A;  4RTU A;  4M78 C;  5EG2 A;  1VQK Q;  1R0B G;  1N27 A;  3JV3 A;  5GAO l;  2LQ8 A;  5LL6 S;  3G4S A;  1KC8 C;  3EG9 A;  5GAN 6;  1OU8 A;  4DBF A;  1O75 A;  3I9Q A;  3KBG A;  2KK4 A;  2CP7 A;  2J06 A;  4DOV A;  1NEB A;  3JB9 D;  1YJ9 T;  2ESW A;  3C95 A;  2E65 A;  1OX9 A;  2HMA A;  5KCH A;  3JCM e;  4C8Q G;  4BD3 A;  2DL5 A;  1Z9Q A;  1KD1 U;  3G6E T;  4PJO G;  2P0K A;  1TUD A;  3J80 E;  2ZPB B;  2ENM A;  3A8H B;  1GL5 A;  4LDW A;  4OMM A;  3G7Z A;  3CCR Q;  3HTR A;  3M57 A;  3RMQ A;  1WX6 A;  2WSC E;  5KYU A;  1SSH A;  1LCK A;  1WNL A;  2M16 A;  1YIJ A;  2DRM A;  4RUG A;  5GMK m;  2DMO A;  2YT6 A;  2HBW A;  1UGQ B;  3JCM b;  2ED0 A;  4L59 A;  4EDU A;  1KC8 U;  1D3B A;  3H9N A;  1Q86 C;  1YJN T;  4NOY A;  5KYW B;  3SWN B;  2GNC A;  4DEX A;  4E7J A;  2VUB A;  3QJY A;  3RUX A;  2KT1 A;  4M75 G;  2LVM A;  3EG0 A;  3CMA T;  3G1J A;  2OTJ A;  1TOV A;  2V1Q A;  2HCK A;  5FU6 B;  2AK5 A;  2FZG B;  1VQK A;  1QVG A;  1HSQ A;  3CCJ Q;  1J3T A;  3NHN A;  4PK4 A;  3EG3 A;  2JM8 A;  1XNI A;  2YLC A;  2RQV A;  1M90 R;  2E6Z A;  2X51 A;  2COZ A;  3JCM h;  4C92 B;  2NUZ A;  4M7A G;  5IH2 A;  5LJ3 d;  4M77 B;  1YIT T;  4HVU A;  1M3B A;  1NG2 A;  1Q86 U;  1T0H A;  4M78 E;  1CKA A;  4CC3 A;  2HEQ A;  4D8D A;  3G4S T;  1MGQ A;  4PJN A;  1QVP A;  1AWJ A;  4E7H A;  3C12 A;  5GMK e;  1KQS A;  3SWN C;  3I55 Q;  3C94 A;  1HYO A;  3CCR A;  4IUV A;  2XK0 A;  3OYH A;  3CD6 T;  1WFW A;  4HCK A;  4PJM A;  3EH1 A;  2EGE A;  4LE9 A;  5DM7 R;  2DER A;  3LWI A;  2M51 A;  1JJ2 A;  1G3W A;  4PFZ A;  5FU6 C;  4M7D A;  2O2O A;  5DLO A;  5KCO A;  4F7U B;  2LCL A;  1GXI E;  1KQ1 A;  2DTH A;  2OI3 A;  3OQ5 A;  2CP2 A;  3VS0 A;  3OS1 A;  2YUN A;  3INZ A;  1WI7 A;  1NYF A;  1YIJ T;  2ZCF B;  2D0N A;  1VQ7 Q;  4J6X A;  1RLQ C;  3FLG A;  4C92 C;  4Z89 A;  4ZTJ A;  2DFU A;  1YI2 A;  1ZHI A;  2COW A;  3CCV Q;  3E19 A;  4E7Z A;  4L6V 5;  1SHF A;  2V8J A;  4XU2 A;  3HKS A;  2RHI A;  4J9B A;  4XTZ A;  5AT1 B;  2DD5 A;  1WHJ A;  1N9R A;  5GAN 4;  3RKW A;  4EPC A;  1QKW A;  1TG0 A;  2FYK A;  3C0C A;  4HXJ A;  5GAN 8;  4M7D F;  3M58 A;  3QBY A;  3M54 A;  2EQU A;  2RJF A;  1I1J A;  1UE9 A;  4RTV A;  3OB9 A;  3VS2 A;  4J9D A;  1VQK T;  2MWP A;  1H92 A;  2KAF A;  2I0N A;  2LC4 A;  7AT1 B;  3BY7 A;  3CC2 A;  2H8H A;  3NFC A;  4J7F A;  2GGR A;  2JNG A;  4M75 B;  4D6W A;  3I55 A;  5KYU B;  2RHY A;  1VQ9 A;  3QII A;  2DF6 A;  4OMP A;  3JRZ A;  2EW3 A;  5D6Y A;  2IVW A;  2EFI A;  1G3Y A;  3RR6 A;  2ROL A;  1TXQ A;  4EIK A;  5GAN h;  2EKO A;  3PMI A;  1OV3 A;  4XTU A;  3X24 B;  2LX7 A;  3OW2 S;  5IT9 E;  1W2B S;  1UEB A;  4X9D A;  2SEM A;  3BDL A;  5FLX E;  1WHL A;  3CCR T;  3AHU A;  1PRM C;  2JMC A;  1VQP A;  1UB4 A;  4ANJ A;  1OQK A;  1D1A A;  3MEU A;  3JCM X;  1UTI A;  1M27 C;  3TVT A;  2BKD N;  2FVU A;  1KSW A;  2QDL A;  2FEI A;  3TEE A;  1KFZ A;  2HSE B;  1AD5 A;  5LJ5 j;  2DL4 A;  4N0A A;  5GAM f;  3CC7 A;  2FZK B;  4JJC A;  3ULR B;  2XKO C;  4KUI A;  4M75 C;  5KYY A;  2VXE A;  1U8R A;  3JB9 I;  2D0Q B;  1G83 A;  4C0G A;  4C92 E;  3JCM c;  1NEG A;  4HA8 A;  1Y7X A;  4KH1 B;  2ABL A;  2RH2 A;  1OX8 A;  4P5N A;  1IGU A;  2X4Y A;  2DPP B;  1D1C A;  2QQS A;  4IIM A;  3CC4 A;  4QT7 A;  3CCJ T;  1XOV A;  3O5Z A;  1PG5 B;  2F2V A;  3CCS A;  5GAM e;  1MHN A;  2FHD A;  2J6F A;  1VQ6 Q;  1VQN A;  2JOY A;  5GMK l;  1OYX A;  1YFN A;  2BE7 D;  1SRL A;  3UA7 A;  5GAN 5;  2YLB A;  4J9I A;  2RI3 A;  4F7U E;  2HL3 A;  5LJ3 f;  2LQW A;  3OBY A;  1K9M U;  4QQ6 A;  1BB9 A;  1YCY A;  1C1A A;  1GBQ A;  1AZE A;  1VQM Q;  2K57 A;  1WXB A;  2OX7 A;  5GAM g;  4PFP A;  3VV0 A;  1JXM A;  2CKK A;  1X2K A;  2CH4 A;  3HL8 A;  3UT1 A;  1MMA A;  3CME A;  2GFA A;  2KT8 A;  1WHH A;  2EYW A;  2DBK A;  2P0P A;  4OP0 A;  5I2M A;  3CCE A;  3CXC P;  2CUD A;  4OGC A;  1B34 B;  2KXD A;  5LJ3 e;  1VQ7 T;  2D1X A;  3SEM A;  4RG2 A;  5GJV B;  1GCQ C;  3GNF B;  4JRQ A;  2YDL A;  3PVL A;  3CCV T;  4KGV B;  1FMW A;  3M59 A;  4RCC A;  3J7A F;  1WQW A;  1DJ7 B;  4M7D C;  4XTX A;  1EIF A;  3NTH A;  3JCM d;  1YJW A;  1WGS A;  1AZG B;  1OU9 A;  5GAM h;  5FWC A;  2KSS A;  3PNW C;  2RMO A;  3TSZ A;  1VQL Q;  2QTX A;  1G2B A;  4RCB A;  5LJ3 g;  3OYF A;  4M75 E;  3A1P A;  3R6N A;  4CC4 B;  5FRM A;  2RM4 A;  2DLP A;  2YWW A;  1KG1 A;  2K5I A;  1VQ6 A;  4PL6 A;  4XU3 A;  2X4J A;  3OYL A;  4VUB A;  1QCN A;  1WA7 A;  4PJJ A;  1M5Q 1;  2DXC A;  2RK2 A;  2DVJ A;  4J9E A;  1PHT A;  1PSF A;  4M7D D;  3JB9 G;  3D7S B;  2LP5 A;  4M78 F;  4CC7 A;  4ZGJ B;  2BZY A;  3OMC A;  1YCS B;  2E1H A;  1E6H A;  3G71 A;  4A53 A;  2K5F A;  2VB6 A;  3LWH A;  4JS4 A;  2KDS A;  1YP5 A;  1ZUY A;  3E1S A;  4AFU C;  1YBY A;  4F17 A;  2HQH A;  3SB2 A;  2VC8 A;  3GNG A;  4IUU A;  4ZGE B;  2AKL A;  1GCP A;  2QAZ A;  1QQJ A;  2XIC A;  1FYN A;  3JAM E;  2P0Q A;  2DEQ A;  2EYY A;  2MWO A;  5KH6 A;  1NJI C;  2X3X D;  1K73 C;  5J39 A;  1RAF B;  2K9G A;  2KY9 A;  3M0R A;  4HVW A;  4LNP A;  1I0C A;  2R58 A;  3E2U A;  3SHW A;  1D0Y A;  2DM1 A;  1WHG A;  1WHK A;  4OMF B;  3WXM B;  4FYW B;  1K4U S;  9ATC B;  3MP8 A;  2W10 A;  1VQ8 Q;  5FRN A;  4BI8 B;  3RMS A;  2VGM A;  5CK9 A;  4MML A;  2RHZ A;  4BDY A;  2PVG B;  4E7I A;  4M7D E;  4DA4 A;  3OYC A;  5KYW A;  2JS2 A;  4N0A C;  3SWN A;  1RLP C;  3M0T A;  3CCM Q;  2VV5 A;  3S3O A;  4OMN A;  5GAN d;  3E9G A;  3OS0 A;  2DX1 A;  1VQ6 T;  1Q81 C;  2K3B A;  1NJI U;  1VYV A;  3DLL A;  2CS7 A;  2YXY A;  4KGX B;  4IUR A;  5I22 A;  4DBR A;  2DBM A;  1EX4 A;  1IZ6 A;  2DL8 A;  2RQU A;  3VYH B;  1X2Q A;  3LGF A;  4E7K A;  1VQM T;  2AIR B;  3QPH A;  4C92 A;  5CKH A;  5IXF A;  4M77 A;  4XTV A;  3QWY A;  1X6B A;  4ME7 A;  2KRN A;  1HJD A;  3TQ7 P;  1QLY A;  3N5B B;  2C0T A;  1WLP B;  1SG5 A;  2RQW A;  2G6F X;  3JCM W;  4LN2 A;  3LH5 A;  3R6O A;  2LQN A;  2DEU A;  1UJY A;  1AWO A;  1Q81 U;  3L2V A;  4KT0 E;  2KI7 A;  3M0U A;  4QKU A;  4Z88 A;  3MPU B;  3I56 A;  3GOX A;  1M8M A;  3L2U A;  3CBP A;  4F7U A;  2CH4 W;  2GQV A;  3OSS C;  4C92 F;  3EG2 A;  2XMF A;  4M77 F;  3NMZ C;  1BI2 A;  5KE3 A;  1VQL T;  4ZGD B;  5FRO A;  1R77 A;  5D7U A;  2ZAE A;  3VYG A;  3OYE A;  4Q5W A;  2RHU A;  3RNJ A;  2OTJ Q;  2K2M A;  3EFS A;  1YHQ Q;  1KQS S;  2CRE A;  2X4W A;  1VOM A;  3RER A;  3NTK A;  2J05 A;  3PVQ A;  3TRE A;  2CP5 A;  2QA4 A;  4F16 A;  2QQ9 A;  4LDY A;  3A8M B;  1A0N B;  2P4R A;  2LCC A;  1JJ2 S;  1Y57 A;  2HKN A;  1X43 A;  5GMK j;  3PTA A;  4F7U F;  1FMV A;  4MZP A;  5A0L A;  1BBZ A;  3FIF A;  4C5I A;  3L1A A;  1I4K 1;  1XTD A;  2YUO A;  2KRS A;  1ZUU A;  1I5L A;  4C5H A;  3V7R A;  3I5S A;  4Y92 A;  3AT1 B;  3LW5 E;  2CDT A;  2GQI A;  1SPK A;  5KYN A;  1Z9Z A;  2A37 A;  2PNI A;  2HL5 C;  1K9M R;  4M75 A;  4M78 D;  3OYG A;  4A4H A;  2AZS A;  3QYG B;  1S72 A;  3QWX X;  1D0Z A;  4MDX A;  3M4G A;  2LJ1 A;  2DYB A;  1LOJ A;  2EVR A;  4BE0 A;  5GAM d;  3JCM g;  2HQX A;  4E6R A;  1K9A A;  5FU7 B;  2EBP A;  2JN0 A;  3PIO A;  2A08 A;  1W2B P;  2MPX C;  4E2F B;  5J3B A;  1U1S A;  1Q7Y C;  4M7A A;  3OYD A;  2R57 A;  1NPP A;  4M4Z A;  2CGH A;  1F1B B;  4RTY A;  1BI0 A;  2NUT B;  4FYV B;  1N8R R;  3VS7 A;  1VQ8 T;  1YI2 Q;  2DRK A;  2MI6 A;  2J6K A;  1WXU A;  2V8I A;  1VQ4 A;  4N4I A;  5HY6 A;  4HCZ A;  4M75 F;  2EJ9 A;  1YHQ A;  4BB7 A;  1R8O B;  1VYT A;  4KH0 B;  4JPB W;  4BI4 A;  1YWO A;  2E70 A;  3CCM T;  3WVE B;  3MEV A;  2CP3 A;  4AFS C;  3QJ6 A;  3SFM A;  1M1K R;  2FZC B;  1HK9 A;  3VUZ A;  1Y07 A;  2HNI A;  4AG1 C;  5GAN f;  1I8F A;  2BTT A;  3NTI A;  2PU9 B;  5FU7 C;  3C4S A;  4RKU E;  4A4G A;  5I11 A;  5HK0 A;  1Q7Y U;  3CC2 Q;  5HK3 A;  1HXD A;  1E7O A;  1D1B A;  1WJS A;  2EQJ A;  4J9C A;  2VVK A;  1M1G A;  4TVR A;  1VQ9 Q;  1GCQ A;  3DKM A;  1P92 A;  2WAC A;  4PFO A;  2Z0W A;  2O31 A;  2XHC A;  4JS5 A;  3PFS A;  4JJD A;  1B07 A;  1UGR B;  2MIO A;  3JCM J;  5GAN e;  1VQP Q;  4XQ3 A;  1V29 B;  4C8Q B;  4OML A;  3A5Z B;  4IUP A;  2M1H A;  5C0M A;  4M77 C;  1ZBJ A;  2XU8 A;  1Q82 C;  4PJO B;  4BUG A;  4BAC A;  2MYS A;  4RMO A;  1RAB B;  5HCK A;  1I07 A;  2QEX Q; 
#chains in the Genus database with same CATH homology
 1VQL T;  3MEW A;  4C8Q F;  2E64 A;  5LJ3 f;  3MP6 A;  3OBY A;  4XU1 A;  1K9M U;  4QQ6 A;  5GAN 7;  4F7U G;  5GAN g;  3PMT A;  4ZN1 A;  1YCY A;  1QP2 A;  4PKC C;  1B34 A;  3CEY A;  4PJO F;  3BW1 A;  1SSF A;  3M53 A;  2DAQ A;  2EQK A;  2FL7 A;  2K57 A;  5GAN j;  1VQL A;  2RI2 A;  3A8G B;  5GAM g;  2F69 A;  2XDD A;  2EWN A;  2MF2 A;  5D6W A;  1X6O A;  4II1 A;  3VV0 A;  4E47 A;  4J6Y A;  5IAY A;  3CD6 A;  3FB9 A;  5D6X A;  2M0O A;  3L42 A;  5GAM j;  2CKK A;  2DXB A;  2ZGW A;  4MZT A;  3UT1 A;  3HL8 A;  2OTJ T;  1G3T A;  1QVF A;  3CME A;  1BKB A;  2AHJ B;  2GFA A;  2L5Q A;  4A54 A;  1YHQ T;  4QW2 A;  2P4T A;  4C92 D;  2LQK A;  4JLI A;  4M77 D;  2P0P A;  4OP0 A;  3JCM V;  5I2M A;  2DKG A;  3X28 B;  3CCE A;  2DXT A;  2VXF A;  3FDR A;  2DXU A;  2JUF A;  3FC3 A;  4OGC A;  1B34 B;  5LJ3 e;  1VQ7 T;  2EIF A;  4XU0 A;  2PQW A;  3QZ9 B;  3QG1 A;  2DTI A;  4RG2 A;  4C8Q C;  3P8D A;  3OS5 A;  4J7I A;  4XK8 E;  5J26 A;  4OF1 A;  3GNF B;  3CXC A;  2GF7 A;  1VQO A;  1QP3 A;  3H8Z A;  3A8O B;  3SDZ A;  4FT2 A;  3JCM Q;  3CCQ A;  3I56 T;  4JRQ A;  4EMK C;  4HCC A;  4PJO C;  3CCV T;  4OB1 B;  3V8L A;  2A3L A;  2LDM A;  2D6F A;  3M59 A;  2ZPE B;  2ZZD A;  4PNO A;  5L8R E;  3L2W A;  4RCC A;  3J7A F;  1WQW A;  3CBO A;  4GY5 A;  1DJ7 B;  4X34 A;  4M7D C;  3CBM A;  3L2R A;  4XTX A;  3QHS A;  1EIF A;  4CRI A;  2C06 A;  3NTH A;  3JCM d;  1WPY A;  2X35 A;  1YJW A;  1WGS A;  3P8B B;  3FRN A;  5GAM h;  5GAO r;  4JUV A;  2KSS A;  3HRS A;  4O5V A;  3PNW C;  3RKY A;  3X26 B;  2PVD B;  2QTX A;  4M7A B;  5DLQ E;  2ZPH B;  4RCB A;  5LJ3 g;  3OYF A;  4FU6 A;  4M75 E;  1KHI A;  4J6W A;  1NPR A;  2QI2 A;  3E9F A;  3M55 A;  3M9Q A;  4J8O A;  1K8A C;  5FRM A;  4Y28 E;  5LJ3 j;  2E10 A;  4FT4 A;  2QDY B;  3RIR A;  2RM4 A;  4DOW A;  1KG1 A;  2K5I A;  3OYJ A;  4C0F A;  1VQ6 A;  4PL6 A;  4XU3 A;  2I2L A;  2JTM A;  2X4J A;  3BDU A;  3JSC A;  4M7A F;  2XI9 A;  4ELZ C;  3OYL A;  4M78 B;  4VUB A;  1XQH A;  4R56 A;  3X20 B;  3S3M A;  2QA4 T;  2DZC A;  1M5Q 1;  2DXC A;  2RJE A;  2L8D A;  2RK2 A;  4A4F A;  2QEX A;  1VIF A;  3L2Z A;  2DIQ A;  4XAX B;  4XTW A;  2HBP A;  1BYM A;  1PSF A;  4J5Y A;  3CPW A;  4ZTF A;  4M7D D;  3JB9 G;  3ZEH A;  5CIU A;  4V2S A;  3QKJ A;  5CVI A;  4BY6 B;  5I21 A;  1Q82 U;  4X9C A;  4M78 F;  5DY9 A;  4ZGJ B;  3OMC A;  1YI2 T;  2HQE A;  4EMH A;  1VQ8 A;  2E1H A;  1RL2 A;  3G71 A;  1OZ3 A;  4A53 A;  5I2S A;  2K5F A;  1QVG S;  4M77 E;  1OI1 A;  4IKF A;  3LWH A;  3V8K A;  4C92 G;  4LDX A;  4JS4 A;  2PUK B;  4EMG A;  5GMK i;  2KDS A;  3V7C A;  2KMT A;  3CPW S;  3E1S A;  3HP9 A;  4M77 G;  3MHX A;  1YBY A;  4NS5 A;  5CKF A;  1WJR A;  4BI3 A;  3GP8 A;  3SB2 A;  4ATO A;  4QVZ A;  5LJ5 d;  1KD1 C;  2VC8 A;  3GNG A;  4Z02 A;  3VKI A;  4IUU A;  5CCA A;  4ZGE B;  2B8A A;  1Y71 A;  2CZ1 B;  3V8J A;  4NL2 A;  3BFM A;  1FX7 A;  3M4Y A;  1S72 T;  4IUQ A;  4M7A C;  1K8A U;  2ZPG B;  5GAN 2;  3JCM P;  1W4S A;  2OTL A;  3VJP A;  3CCM A;  3HPW A;  3JCM f;  2EAY A;  2X4X A;  4GLK A;  2XIC A;  4UC4 A;  4DQ2 A;  3EFR A;  3X25 B;  2O4X A;  3LLR A;  2RJC A;  3JAM E;  1N6A A;  5KE2 A;  2LNV A;  2P0Q A;  4NL3 A;  2DEQ A;  4M75 D;  3OY9 A;  2MWO A;  5KH6 A;  1NJI C;  4M78 C;  2LT4 A;  4KUL A;  5EG2 A;  1K73 C;  5J39 A;  1N27 A;  3HFN A;  4QVC A;  3QUI A;  5GAO l;  1I81 A;  2E6N A;  2KY9 A;  2LQ8 A;  4LDV A;  4Y91 A;  3SD4 A;  5CR2 A;  3CC2 T;  2QQB A;  5LL6 S;  5CAI A;  3G4S A;  5AYF A;  2R58 A;  1KC8 C;  3RKX A;  5GAN 6;  2RK1 A;  4OMF B;  2JVV A;  1M8V A;  3I55 T;  3WXM B;  4ZN3 A;  1VQ5 A;  1VQ9 T;  3MP8 A;  1O75 A;  3OYY A;  1AHJ B;  3KBG A;  2KK4 A;  3CCQ T;  4C0D B;  4DOV A;  3JB9 D;  1YJ9 T;  5FRN A;  3H6Z A;  1U1T A;  4C8Q E;  3C95 A;  2E65 A;  3HFO A;  4BI8 B;  5KCH A;  3RMS A;  2VGM A;  1M1F A;  1VQ4 T;  3JCM e;  4C8Q G;  4BD3 A;  4PJO E;  3KXT A;  1KD1 U;  5CK9 A;  4MML A;  2RHZ A;  3G6E T;  3VU3 C;  4BDY A;  2PVG B;  4PJO G;  2P0K A;  5CO7 A;  4E7I A;  4M7D E;  3J80 E;  2ZPB B;  3A8H B;  2EQM A;  4LDW A;  4DA4 A;  3G7Z A;  3OYC A;  2NLU A;  5A2Q E;  4B9W A;  4M7D G;  4N0A C;  3SWN A;  1VQP T;  3A8L B;  2OAU A;  2WSE E;  3M57 A;  3RMQ A;  1Y96 A;  2WSC E;  2VV5 A;  3CCJ A;  3CPF A;  4WF2 A;  3S3O A;  1M90 C;  3JB9 J;  5GAN d;  1WNL A;  2M16 A;  3E9G A;  3OS0 A;  1YIJ A;  5GMK m;  1LNX A;  3ASK A;  2LTO A;  1Q81 C;  1NJI U;  2ZPF B;  1VQ6 T;  4A4K A;  3S3N A;  3DLL A;  4HCB A;  2CS7 A;  1UGQ B;  4FL6 A;  2CZ0 B;  3JCM b;  2XID A;  5GAO p;  1BIA A;  4IUR A;  2DVE A;  2EYQ A;  2YHT A;  1KQ2 A;  4L59 A;  5GAO m;  4L5G A;  4EDU A;  5GMK h;  1KC8 U;  1D3B A;  3QXE B;  2QEX T;  1IZ6 A;  1Q86 C;  1BIB A;  3CC7 T;  1YJN T;  4HKE A;  3LH0 A;  4NOY A;  4C5E A;  3VYH B;  2A7Y A;  2QXF A;  4OB3 B;  3LGF A;  1LJO A;  3SWN B;  4E7K A;  2HD0 A;  3ER0 A;  4XTY A;  4E7J A;  3QPH A;  1VQM T;  3LYI A;  3GPL A;  1KQS A;  3ME9 A;  4C0D C;  2VUB A;  2RI5 A;  3QJY A;  5CKH A;  3RUX A;  4C92 A;  4MZM A;  2L3R A;  3GIB A;  4M77 A;  4XTV A;  4M75 G;  2LVM A;  3GF5 A;  4HT9 A;  4ME7 A;  3CMA T;  2OTJ A;  5CKD A;  3VUB A;  3MCA B;  3N5B B;  4B9X A;  4JJN K;  5FU6 B;  2DK3 A;  2KQW A;  3OYK A;  3JCM W;  2XDP A;  4C8Q D;  3UPU A;  3V7S A;  4KBM B;  1VIE A;  2DTO A;  2RHX A;  1D3B B;  3CC4 T;  1VQK A;  4BE1 A;  2RB6 A;  3UWN A;  1QVG A;  3R6O A;  2HAX A;  4PJO D;  4YTL A;  1WJQ A;  3CCS T;  1XNI A;  1Q81 U;  4M7A E;  2YLC A;  1QVF S;  2E6Z A;  3M5A A;  1VQ7 A;  2BIV A;  2MMP A;  3JCM h;  5A0D A;  4C92 B;  4KT0 E;  3ZFJ A;  3L2V A;  1VQN T;  3CCU A;  3OA6 A;  4M7A G;  2MAM A;  2LX9 A;  4JRP A;  5LJ3 d;  2K3Y A;  4M77 B;  1YIT T;  1KHC A;  3DB3 A;  3I56 A;  3GOX A;  2V8K A;  4QQD A;  3T9N A;  3CCV A;  1Q86 U;  3L2U A;  2BUD A;  4OVA A;  3CBP A;  4F7U A;  1ZQ1 A;  3FEO A;  1UGS B;  2H3J A;  3OYI A;  2DO3 A;  2GQV A;  4N4H A;  4M78 E;  2XD0 A;  1FWZ A;  2E5Q A;  3QZ5 B;  1MGQ A;  2IG0 A;  3OSS C;  3G4S T;  4C92 F;  1QVP A;  1H3Z A;  4CI0 C;  4M78 G;  3OS2 A;  4E7H A;  4M77 F;  3C12 A;  5GMK e;  1BI2 A;  3SWN C;  5KE3 A;  4JRI A;  1H64 1;  1OZ2 A;  3C94 A;  4N4G A;  4ZGD B;  1JRI A;  1UGP B;  2DD4 A;  4QVD A;  3CCR A;  1FXX A;  4IUV A;  5FRO A;  1K9M C;  2XK0 A;  3OYH A;  3CD6 T;  4OGE A;  3VYG A;  4JDS A;  1O9S A;  3PGG A;  4EMK A;  3OYE A;  4Q5W A;  5DM7 R;  2RHU A;  2PVO B;  3CME T;  2GFU A;  3MET A;  3LWI A;  1JJ2 A;  2WSF E;  1G3W A;  3EFS A;  2RJD A;  5FU6 C;  5DLO A;  4M7D A;  5KCO A;  1KQS S;  1G5V A;  3TCJ A;  2QQA A;  2X4W A;  4MMK A;  4F7U B;  2LCL A;  2F5T X;  1GXI E;  3RER A;  3NTK A;  3CCE T;  1KQ1 A;  2DTH A;  2LT1 A;  3TRE A;  2Y4X A;  3OQ5 A;  2QA4 A;  2QQ9 A;  3OS1 A;  4LDY A;  3INZ A;  3A8M B;  2ZPI B;  4JLG A;  3OSV A;  1YIJ T;  2LCC A;  2ZCF B;  4J6X A;  4BY6 C;  2K4Y A;  4BDZ A;  1JJ2 S;  1VQO T;  5GMK j;  3PT9 A;  3FLG A;  3PTA A;  2E41 A;  4F7U F;  3OMG A;  5LJ5 h;  1BI3 A;  4C92 C;  1N8R C;  3UDC A;  4MZP A;  4ZTJ A;  5A0L A;  2Y90 A;  4EMK B;  1YI2 A;  1ZHI A;  3FIF A;  3E19 A;  2O4X B;  4M7A D;  4MDW A;  3L1A A;  1I4K 1;  4L6V 5;  4C5I A;  1XTD A;  3QDR B;  2V8J A;  1I5L A;  2RA2 A;  3HRU A;  4C5H A;  4XU2 A;  3V7R A;  4M7D B;  5CQX A;  3LW5 E;  1PSE A;  3CCL A;  1YJW T;  3HKS A;  2RHI A;  4XTZ A;  2F5K A;  2DD5 A;  3DB4 A;  4M75 A;  3WVD B;  2L89 A;  1N9R A;  4M78 D;  3RKW A;  3DLM A;  2RD1 A;  3Q1J A;  4A4H A;  3QYG B;  2FYK A;  4EPC A;  5GAN 8;  3OYN A;  4OB0 B;  1S72 A;  4M7D F;  3M58 A;  5LJ5 f;  1M1K C;  2DIG A;  4MDX A;  3QBY A;  3M54 A;  5IN1 A;  2EQU A;  3M4G A;  3JB9 H;  2DJZ A;  2RJF A;  1LOJ A;  1TH7 A;  4BE0 A;  4E7L A;  5GAM d;  1BI1 A;  1K73 U;  1NE8 A;  3URG A;  3GLX A;  4PLL A;  3OB9 A;  3JCM g;  5GAN 4;  2HQX A;  1VQK T;  2MWP A;  2VGN A;  5FU7 B;  2JN0 A;  3PIO A;  3M56 A;  3RES A;  2KAF A;  5J3B A;  1U1S A;  2LC4 A;  3BY7 A;  1Q7Y C;  5CKE A;  4M7A A;  3CC2 A;  2R5A A;  2O01 E;  4LDU A;  3MP1 A;  4RG8 A;  2GCX A;  3NFC A;  4J7F A;  2R57 A;  3OYD A;  1NPP A;  1X75 C;  2CGH A;  2VYT A;  4PLI A;  2JNG A;  4M75 B;  1BI0 A;  3CCU T;  4D6W A;  2LRQ A;  3OW2 A;  1W2B A;  1Y96 B;  1IRE B;  3I55 A;  3OYG A;  2CZ6 B;  2RHY A;  1VQ9 A;  1JBM A;  3HHT B;  3QII A;  1VQ8 T;  1QW1 A;  2MI6 A;  3JRZ A;  3G71 T;  3PIP A;  5D6Y A;  1YJ9 A;  2EJF A;  2EFI A;  2IVW A;  4ELY C;  1M4Z A;  2V8I A;  1G3Y A;  5LJ5 e;  4M78 A;  2EJG A;  1VQ4 A;  4N4I A;  5HY6 A;  4HCZ A;  3OBW A;  5GAN h;  4M75 F;  2EKO A;  3PMI A;  2EJ9 A;  4XTU A;  3X24 B;  3G6E A;  3KUF A;  3P8H A;  3S6W A;  1UEB A;  3OW2 S;  4BB7 A;  5IT9 E;  1YHQ A;  1W2B S;  4X9D A;  1R8O B;  3CXC S;  3BDL A;  2E12 A;  5FLX E;  3CCR T;  4BI4 A;  3HRT A;  3AHU A;  1M90 U;  1M1K U;  2OTL T;  3TU4 K;  2JTF A;  2E70 A;  5CQY A;  3CCM T;  1UB4 A;  3WVE B;  3MEV A;  1VQP A;  3OYM A;  5A0G A;  2K5L A;  3QJ6 A;  3SFM A;  4J83 A;  2XDB A;  4OB2 B;  3QO3 A;  1HK9 A;  4HT8 A;  1ZBX A;  4QQG A;  3F70 A;  3MEU A;  3VUZ A;  3LGL A;  3JCM X;  4O6J A;  3JB9 F;  4FSX A;  3OYB A;  2BKD N;  1Y07 A;  4FIB A;  2HNI A;  5LJ5 g;  3L2Q A;  2FVU A;  5HKC A;  5GAN f;  1I8F A;  3TEE A;  3NTI A;  2PU9 B;  5FU7 C;  3C4S A;  4RKU E;  4A4G A;  1Q7Y U;  5HK0 A;  4C5G A;  5LJ5 j;  3QYH B;  3MEA A;  5M9O A;  4C0Z A;  5GAO n;  4N0A A;  5GAM f;  5HK3 A;  3CC7 A;  1HXD A;  2FB7 A;  1M9S A;  1YJN A;  3EAE A;  1WJS A;  2XKO C;  2EQJ A;  1VQ5 T;  1N8R U;  2PUO B;  4KUI A;  4M75 C;  4A4E A;  4R55 A;  2RO0 A;  1M1G A;  2VXE A;  4TVR A;  1U8R A;  5CKB A;  3JB9 I;  4C8Q A;  2D0Q B;  1VQM A;  3DKM A;  2D9T A;  1P92 A;  2WAC A;  4C0G A;  4C92 E;  2YRV A;  4PJO A;  2XHC A;  3JCM c;  4HA8 A;  1Y7X A;  2KVQ G;  2XG8 D;  2DZ9 A;  2RH2 A;  3MO8 A;  4IUT A;  3PFS A;  4JS5 A;  4P5N A;  3CMA A;  4LD9 K;  3LX7 A;  3CCL T;  2R5M A;  3HSB A;  4BE2 A;  2X4Y A;  2K2V A;  2K3X A;  1UGR B;  2DPP B;  3O8V A;  2Y4Y A;  5LJ3 h;  2QQS A;  2CYZ B;  2QQR A;  3JCM J;  5GAN e;  3CC4 A;  5GAN 3;  3CCJ T;  1NZ9 A;  1XOV A;  3ZBD A;  3J81 E;  4LD6 A;  4XQ3 A;  5C6S A;  5GAM e;  3CCS A;  1V29 B;  1MHN A;  2FHD A;  2JZ2 A;  2M9U A;  4C8Q B;  1WQ7 A;  3A5Z B;  4IUP A;  2M1H A;  5GAO q;  1VQN A;  2JOY A;  5C0M A;  4M77 C;  1RI0 A;  5GMK l;  1OYX A;  2XU8 A;  1Q82 C;  4FM4 B;  4PJO B;  4BUG A;  4BAC A;  1YIT A;  3FJP A;  1N9S A;  1VUB A;  2CZ7 B;  5GAN 5;  2YLB A;  4RMO A;  3OYA A;  1X01 A;  3QSU A;  1JB0 E;  2RI3 A;  2G3R A;  4JRK A;  4KUD K;  1G3S A;  4F7U E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...