2RI3A

Crystal structure of the 3-mbt repeats from human l3mbtl1 with n358q point mutation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
315
structure length
313
Chain Sequence
SWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMQPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 75
structure length 313
sequence length 315
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A03
2R5MA 4IUQA 3Q1JA 4BE0A 2BUDA 2VYTA 3SD4A 4E7IA 2B8AA 2CKKA 3GOXA 3MP8A 2JTFA 3OYDA 2LCCA 3DB3A 2RHIA 3S3MA 2E5QA 4E7HA 3QBYA 3QJ6A 3L42A 5KCHA 1MHNA 4IKFA 3UT1A 5J26A 2RHXA 5D6WA 2DIGA 3OS0A 5IAYA 3H8ZA 3C4SA 3L2VA 4CRIA 3OYHA 3OYBA 3L2WA 3FDRA 2HQEA 3PNWC 4N4IA 4N4GA 4PLIA 3OS2A 1RI0A 3LYIA 3OY9A 5FRMA 2HQXA 1WJSA 2MWPA 4A4FA 4C5HA 3CEYA 2X4WA 3OYMA 2M16A 3META 4E7JA 4IUPA 2IG0A 4Q5WA 4FL6A 3MEUA 5M9OA 3MO8A 3NTHA 3ASKA 2LRQA 4C5GA 2RI2A 3F70A 4N4HA 3OQ5A 3OYGA 3LLRA 2JZ2A 2GFAA 3FLGA 3MEWA 2D9TA 3O8VA 2DIQA 3MEVA 5D6XA 3OYAA 2LVMA 4A4HA 2K3XA 4B9WA 5IN1A 4IUUA 2F5KA 1OZ3A 2RJEA 2R58A 4BDYA 1KHCA 2X4YA 4IUVA 3L2QA 2M1HA 2DAQA 4PL6A 4E7KA 2NLUA 4OVAA 4NS5A 4IURA 3EAEA 2R5AA 5FROA 3ZEHA 4ZTFA 2QQSA 2R57A 3FC3A 2M0OA 2G3RA 3QKJA 3OYEA 3OYLA 3MP6A 3OYKA 3OYNA 3FEOA 3OYIA 3PMIA 2EFIA 2LTOA 3LH0A 2P0KA 2K3YA 2RHZA 2RHUA 3P8DA 4QW2A 5KE3A 3S3OA 2RO0A 5KE2A 5CIUA 3OYCA 3MEAA 2RJCA 5D6YA 3LGLA 3LX7A 2O4XB 2GF7A 2RI5A 4BDZA 4QQDA 3H6ZA 4A4EA 4BD3A 1OYXA 3PFSA 3OYFA 2E6NA 4QVZA 2BKDN 1XNIA 3KUFA 2X35A 3E9FA 4C5IA 3S3NA 2YRVA 5FRNA 2EQKA 2RJDA 2XK0A 4BE2A 3LGFA 2MWOA 4QQGA 3NTIA 3L2RA 3ME9A 3BDLA 4BACA 3OS1A 1WJQA 4E7LA 2EQJA 3OMCA 4GY5A 2EQMA 5C0MA 4BE1A 4PLLA 3OB9A 1N27A 5C6SA 4HCZA 2X4XA 1WGSA 2LDMA 3NTKA 2RHYA 3OA6A 3DLMA 2QQRA 3E9GA 3QIIA 4L59A 3UWNA 3L2UA 2L8DA 3S6WA 2EKOA 2GFUA 4C5EA 2WACA 3OMGA 4IUTA 4A4GA 1WJRA 4RG2A 4EDUA 3OYJA 4II1A 1G5VA 4LD6A 3P8HA 4Z02A 3DB4A 2RJFA 4UC4A 2L89A 1OI1A 2BIVA 3PMTA 4X34A 1SSFA 2XDPA 2O4XA 4B9XA 2PQWA 2RI3A 1H3ZA 4FU6A 4QQ6A 5J39A 3M9QA 1OZ2A 3MP1A 5KH6A 2FHDA 5KCOA 2EQUA 2L3RA 4ZTJA
chains in the Genus database with same CATH superfamily
1M9SA 3GOXA 2E6ZA 2E5QA 2NYSA 3G6EQ 3A5ZB 4C8QE 5GANj 2P0QA 5CKFA 4YTLA 1VQKT 1QQJA 2MAMA 2MWPA 4JPBW 2VWFA 2CT4A 4D6WA 4FL6A 2FPFA 2LRQA 2L2PA 2NUPA 3R6NA 3FLGA 2DIQA 2FRYA 2PTKA 4LDXA 1LNXA 1NJIC 1X2QA 4J9IA 1UGVA 4F7UA 5CCAA 1YJ9A 1N8RU 2HD0A 1U5SA 5CK9A 1VQ5Q 3EAEA 1IXDA 2DL3A 4ZTFA 3ZEHA 1YCSB 1I4K1 1YFNA 2K2MA 4RTVA 4JJBA 1VQKQ 2H3JA 1X6GA 4J7FA 2KMTA 1XQHA 3FJ5A 2I2LA 1QVFA 2QDLA 2HAXA 2RO0A 4F16A 1VQLQ 1UG1A 1YWOA 3VUBA 2BZ8A 4MZMA 3THKA 1UGPB 4WTOB 2PZ1A 3VRZA 3GNGA 4PJOF 3J80E 2HL3A 1VQOT 4M7DB 2RN8A 5C0MA 2PVDB 4XU2A 1RAAB 4F7UE 2BZYA 1UB4A 2KROA 4WCIA 1VQ9T 1KG1A 4HVVA 4DOVA 2OTLA 3AHUA 1ZX6A 3EFSA 3CPFA 3EG0A 4M7DC 2G6FX 1VQ8T 2XDPA 2E12A 5DM7R 2D0QB 1VQ7Q 2RI3A 1D09B 4LDYA 2DVEA 3MP1A 4O5VA 2W0ZA 2R5MA 3X24B 2VYTA 2MIOA 2ZPGB 4NL2A 3SD4A 1YITT 3CCQQ 3NFCA 2K9GA 1YHQQ 4BY6B 1K9MR 1UHFA 1WDXA 5EC7A 2E5KA 4MDXA 4IKFA 4XU1A 2V26A 5CKEA 3EFOA 4NOYA 4DEYA 4ATOA 2HQEA 4N4IA 1IB8A 2K5LA 4LDWA 4LE9A 1M3AA 4M78G 3HKSA 1SHGA 2DL4A 4ORZA 2EBPA 3OYGA 3LLRA 2J7IA 3OW2P 2W10A 3OW2S 1Q7YU 5AT1B 1JJ2P 5FWBA 1K73C 3J7AF 4JJCA 1N6AA 2KVQG 2D6FA 2V1QA 4Y92A 2MOXA 3I35A 3I55Q 1UGQB 1GL5A 4C92C 2RM4A 4Z8AA 2P0KA 4C0GA 2M02A 1OX9A 2RHZA 5KE2A 3OYCA 2RJCA 1N5ZA 5D6YA 3DKMA 4QQDA 1CSKA 4M7DG 3PFSA 3EG9B 3OYFA 3VS7A 3CCQA 3CCST 1QMCA 2K5FA 2E65A 4BE2A 2CH4A 1YI2Q 2DILA 2OTLQ 2D0NA 4BE1A 3G71T 2ESWA 3TREA 1WIEA 3M4GA 3A98A 4LXCA 2KSSA 3H0HA 3OMGA 2ZPHB 4CC2A 4M78C 1PD0A 2COZA 3RBBB 4KRTA 1OV3A 1SSFA 4XTXA 4PJOE 3V7SA 3M57A 3I56T 4E2FB 2VXFA 3GF5A 5GMKi 1X6OA 3CD6Q 2RHXA 4M7AB 2DL8A 2HMAA 4FYWB 3SHWA 2YUOA 2VC8A 4JZ3A 1WI7A 3M5AA 1UTIA 2HBWA 2QK0A 1YNZA 1YI2A 3PTAA 1HD3A 3PGGA 5IN1A 2CGHA 4ZGEB 5LJ5h 1B7TA 4IUVA 1OPKA 4LDUA 4M77D 4OB2B 2DJQA 2FPEA 1LCKA 3JCMJ 2O88A 2FPDA 2HKQB 1VUBA 5CVIA 3EH1A 5FLXE 1BK2A 1QCOA 1GBQA 3S3OA 3P8DA 1TSFA 5J3BA 1WQ7A 1KHIA 2KY9A 4DQ2A 5FU6B 2F1LA 2CP6A 3V8KA 3G7ZA 1EX4A 2F5TX 2J6FA 3CC7Q 3GIBA 2GQIA 4KH0B 1YP5A 1GFDA 3JSCA 1PM3A 4DA4A 4F7UB 2EYYA 1UDLA 1TH7A 2LZ6B 2RQRA 4JRPA 1X01A 1V76A 2E64A 1G8XA 3DB4A 3G71Q 4XU0A 2L89A 3CPWA 4XU3A 2A28A 3MCAB 3VS2A 1H3ZA 4FU6A 3RR6A 3CD6A 2DJZA 5DLQE 4PJOA 2CKKA 2E10A 3H0FA 1MHNA 3NHNA 2FL7A 1VQPQ 1NEGA 2KI7A 3TVTA 3QYGB 4J9HA 1I0CA 2QTXA 3VKIA 2FB7A 2PUOB 2LT1A 1UHCA 4Z88A 5GJWB 1M90U 3JB9J 2LMJA 3MO8A 3VS0A 1M2OA 1NLPC 3I5RA 1Q95G 3F70A 2LP5A 4HKEA 4MZPA 3O8VA 2QGGA 4OMQA 3HRSA 1Y0MA 4E47A 3JCMc 2C0IA 4XAXB 1VQOA 4M7DA 4AFZC 3RKWA 1H8KA 4L5GA 1KQ1A 2EAYA 1KC8C 1JQQA 2EW3A 2EKHA 2KGTA 3EG1A 3SEMA 3QKJA 1JO8A 4C8QF 4OP0A 2FZGB 1E6GA 3QUIA 5KE3A 3CC7A 3MEAA 3KXTA 4J6WA 2BKDN 1BI2A 4DBFA 2FZKB 1QVFS 2JTEA 2CP5A 4O6JA 4M7AF 3GNFB 2OAWA 4RCCA 3M0QA 1YJNQ 3HP9A 3CC4A 1RAGB 1VQ8Q 1I5LA 1JJ2S 2VGNA 3IQLA 1PSFA 4M7DF 1XJWB 3DLMA 1ZBJA 1Y07A 1VQ9Q 1IHVA 1YN8A 1K9AA 2XD0A 1JEGA 1VQOQ 1ZUKA 4MDWA 4XTZA 4KGXB 1KFZA 1AZGB 3NMZC 1OOTA 2XDBA 4QQ6A 3JCMX 4OMNA 1ZSGA 2DRMA 2DTHA 2A3LA 5GMKe 1ARKA 1M2VB 2KXCA 2GNCA 3WVDB 2ATCB 3BFMA 4JDSA 1W2BP 2LQWA 2PNIA 4M7AD 1YJWQ 3RMSA 3M53A 1NLOC 2DEQA 3EHRA 1RI0A 1T0JA 3CCLT 2CP3A 3UPUA 1WHHA 2K79A 4A4FA 3OYMA 3META 4AFSC 2LJ1A 2DXTA 2EGCA 3NTHA 1YIJT 4Y91A 2LX7A 1FYNA 1VQ5T 1MGQA 3UDCA 2WSFE 3RDVA 2J06A 1VIEA 4IUUA 3CC4Q 3CC4T 2AKKA 2X4YA 1VYTA 3GLXA 2OTJA 4J8OA 1QLYA 2EYWA 5GANd 1YIJA 2RQTA 3TU4K 4CC3A 1ZA2B 3FC3A 1VQ9A 1K73R 4ELZC 3MP6A 3GP8A 3FIFA 5LL6S 1VA7A 3CXCS 3C0CA 2BE9B 5CIUA 3KFVA 1NJIR 1Q86U 4D8KA 2K5IA 3G6ET 1WFWA 2L5QA 2DNUA 1Y7XA 3HTRA 3S3NA 1OPLA 2CSIA 4FSSA 3PVLA 2OI3A 3UATA 3CCVT 4PLLA 2RPNA 3VRYA 4ZGDB 4A54A 4F14A 5CKDA 3RESA 3S6WA 3I5SA 1OEBA 1KJWA 3EGDA 2DBKA 2D1XA 1SPKA 3BE3A 1YCYA 3QJYA 4N0AC 3A8MB 2H8HA 4PJMA 2ENMA 2KK4A 1WXUA 1VQ7A 1PG5B 1V29B 1KSWA 4BI3A 1LPLA 2ED1A 2HDAA 3HL8A 2C0OA 2DYBA 2RHIA 5LJ3h 1OULA 3VJPA 4E7HA 1NBEB 4B6MA 2ZCFB 2DZ9A 4LN2A 1C0MA 3MHXA 4EMGA 1AWJA 3T9NA 2RQWA 3OY9A 4J9BA 1WJSA 4KGZB 2DM1A 2JJ9A 3M59A 2EVRA 4BB7A 2P4RA 4CC7A 4HT9A 4PJOC 1WXBA 2JTMA 3MEUA 5KYWB 2XU8A 4HCCA 4J6XA 1UJ0A 3MEWA 3ER0A 2D9TA 3L2ZA 3VS4A 5GAN7 4M77C 3EGDB 4A53A 5KYYB 1W2BS 2SEMA 1KHCA 1MMGA 1PRMC 5A0DA 4RTXA 1IREB 2IIMA 1Q86R 4JUVA 4FYYB 3CCVA 2FO0A 5A0GA 4J83A 3I9QA 1PD1A 3LWHA 4GBQA 2KBTA 2RK1A 1IGUA 1VQPT 2VV5A 1QW1A 3G6EA 3A1PA 4A63B 3ULRB 1WX6A 1X75C 2RNAA 3A8GB 4R56A 4C0DC 5FU7C 2AT1B 4C8QB 1Q81R 4M75D 1JJ2A 1U3OA 1SRMA 5GAOl 2GGRA 1T3LA 2X51A 1BBZA 4M75F 3L2RA 2IPOB 3LWIA 2JNGA 3QDRB 1RAIB 3UA7A 1JRIA 2LJ3A 6AT1B 2EKOA 3MJXA 2CH4W 2DFUA 3OYJA 1GRIA 2YXYA 1WHLA 1YJ9Q 2VKNA 5KYWA 4UC4A 3QXEB 3R6OA 2BIVA 3L1AA 2DPPB 2L3PA 1WHMA 5GAOp 1VQ4Q 3JCMg 2PQWA 4K11A 3RKYA 4DEXA 3M9QA 1UE9A 2F69A 5GAN4 3CC7T 3CCRT 4CC4B 1SRLA 3CC2T 2DXCA 2JTFA 3CC2A 5GAOn 3CCRA 3QBYA 2YWWA 4JS5A 4TVRA 4OMPA 2V8IA 2J6KA 4OGCA 1XTDA 4C5HA 2X4WA 4E6RA 1VQ6T 2DE0X 4IUPA 4MZTA 1QKXA 1HK9A 2RI2A 3BW1A 4M78E 1WZOA 2H3EB 4FT2A 1PSEA 4KGVB 1G3WA 1FMVA 1ACMB 4C92F 1G3TA 4HVWA 1U1SA 1UGRB 3OS5A 2RF0A 4R55A 2DXBA 1S72T 2DERA 1M90C 2ZPBB 5KYNA 4OGEA 1VQ4A 2EWNA 1Q81C 1ZHIA 2OAUA 3AT1B 3CD6T 2ZPEB 4BD3A 1AEYA 4N0AA 1BI1A 3CC2Q 2RK2A 3CCRQ 2HQHA 1KIKA 3VS5A 2MWOA 4F7UG 1JXMA 1HSQA 1MMAA 1VYVA 3ME9A 3VS3A 1HYOA 2ABLA 2MYSA 1R0CB 4E7LA 2Y90A 2EQMA 2FRWA 2OTJT 1ZSZA 2L3QA 5FW9A 5LJ5f 3JB9D 5LJ3f 3LW5E 2LCSA 2GTOA 4ELYC 2DTIA 3L2UA 1GBRA 4ZNXA 3TCJA 2YSQA 1WJRA 2I0NA 4J9EA 4AG1C 1OQKA 5IT9E 2LX9A 4B9XA 2OTLT 1PC0A 4FYVB 5KH6A 5KCOA 2L3RA 3I55A 2ROTA 1AVZC 1C6VX 1I5OB 1ZUUA 1MMNA 5IHIA 1N9SA 1UUEA 4JRIA 2ZPFB 3REAB 4DBQA 5IAYA 3HRUA 3C94A 2RQUA 3VV0A 3J81E 4DBRA 2ROLA 1JXOA 4DBHA 2EYZA 5HCKA 3ASKA 3HPWA 2KAFA 3OQ5A 2JZ2A 3JV3A 4OMLA 3OYAA 3E1SA 2LT4A 1X69A 2EYXA 3QWYA 1Q81U 4E7KA 3QG1A 1M1KC 1H92A 1QCFA 2QQSA 2QTVA 4V2SA 3EFOB 3OYNA 2K6DA 3PMIA 5IH2A 1WXTA 4JJDA 3EHQA 5FU6C 2B86A 2RHUA 3CBPA 2CS7A 5GAMf 4BDZA 3LX7A 2K57A 4QVZA 3MPUB 1YITQ 1I8FA 5HK0A 4RMOA 3UA6A 1KQSP 4JRKA 5KYYA 3NTIA 1YJNA 4C0DB 2DEUA 1M30A 2CZ0B 5AYFA 4C0ZA 1D3BA 4M4ZA 3RUXA 1ABOA 2RHYA 2QQRA 1WHGA 3GBQA 2A37A 4A4GA 3A8OB 2ZPIB 5GAMe 5GAMg 4LUDA 5LJ5j 4AMCA 2XHCA 2PUKB 2AK5A 4FCYA 1BCMA 4D8DA 3PVQA 2EQUA 2DYIA 4C8QC 4J7IA 3RERA 3M0RA 4AFUC 5I11A 4OF1A 1GXIE 4RTTA 1W4SA 4HVUA 5GAMj 1H3HA 3JRZA 1KC8U 2LQ8A 2K3BA 3V7CA 1UJYA 1K9MC 3LYIA 5KYXB 2CZ1B 4PK4A 3G4SQ 2GTJA 3D7SB 1ZA1B 2DD4A 1LVKA 5LJ3j 2Z0WA 2HEQA 1QWEA 2CZ6B 1YITA 3JCMV 2PVOB 2GFAA 3CCJT 3SWNB 4RTYA 1RUWA 1OU9A 5IXBA 3JCMf 4XTVA 2DAQA 2NLUA 2P84A 5CKBA 3JCMP 1TUDA 4RTZA 1YIJQ 1W1FA 2JXBA 3EGXB 3P8BB 1PKSA 1RAEB 3G4ST 4M7AA 3OYEA 3QWXX 3FEOA 5GMKh 2RD1A 1QCNA 2L0AA 2LNVA 2QXFA 2DF6A 3VS6A 5GANf 2HZYA 2O01E 4OMFB 5GAOm 1YJWT 3BDUA 1NYFA 3H6ZA 1F1BB 1VQPA 1OYXA 3JCMe 1BIAA 2ED0A 4AG2C 4C92E 1BIBA 5LJ5e 2RJDA 2AHJB 4QQGA 3NPFA 3QSUA 1VQNA 2RH2A 3CCUA 3OS1A 5GAOr 1WJQA 3JB9I 5IHNA 4OMOA 2KRMA 4J9GA 1N27A 1MUZA 2QEXT 2Y4XA 3OA6A 1AWXA 3E9GA 3QIIA 3VU3C 1R0BG 1G3SA 2YUPA 4M77E 2EGAA 4M7AE 1PCXA 1H641 2QAZA 3PMTA 7AT1B 2CDTA 2NWMA 2X4JA 4RTWA 3V7RA 1YJNT 1D1CA 1ZUYA 2B8AA 4ZN1A 5CO7A 3OYDA 4GLKA 1M1KU 3CMEQ 1FXXA 1JU5C 4XTYA 4PJLA 4FSXA 4LDVA 1O9SA 3C4SA 2KNBB 3L2WA 3FDRA 5FRMA 3VYHB 2O9SA 3I56A 2M16A 4E7JA 2CZ7B 1X2KA 3FJPA 1FX7A 4PJJA 2AZSA 4DOWA 1QKWA 4A4HA 4B9WA 1WHKA 1VQNQ 1BI3A 5GANh 5GMKl 3CCET 2HL5C 1NJIU 4C92B 1GCPA 4EPCA 1LJOA 1K73U 2KQWA 2VGMA 1SF9A 2GBQA 3CCMQ 2JVVA 3HHTB 4QVDA 1IO6A 4OB3B 1K9MU 1S72A 1M8VA 5EG2A 4JS4A 5I2MA 1QVPA 2YHTA 1IHWA 1KD1R 2X35A 1D0XA 4PJOB 4FT4A 3V8JA 5FRNA 3LGFA 4OB1B 4BACA 1WHJA 4GY5A 4JLIA 4R0KA 1RAFB 2HSEB 1U8RA 3UF4A 3V8LA 1A0NB 2XDDA 1K0XA 4L59A 4QVCA 2L8DA 1B34B 1VQ6A 1RABB 3QZ9B 1G5VA 1TOVA 1HXDA 4LD6A 4C0FA 2OTJQ 2NUPB 4Z02A 3CPWP 3PT9A 3VYGA 4Z89A 1Q86C 3EGUA 1Q7YR 2QQBA 3EG3A 1E6HA 1SSHA 4RUGA 4EIKA 1Z9QA 4M75A 2EJFA 3S3MA 3G1JA 4FW1A 1KQ2A 2VVKA 4LUEA 3JCMh 3UT1A 1WA7A 2JM9A 3OYYA 3OYHA 4HCBA 3RKXA 3H0IA 2JOYA 2A0FB 1W6XA 5CQYA 3M56A 1NPPA 1S72Q 2M0YA 1YWPA 5DY9A 2J6OA 4RCBA 4M7DE 4BI4A 3MEVA 2V1RA 4XQ3A 4M78D 2F5KA 1OZ3A 2E3IA 2XICA 3OBWA 2M1HA 1SKUB 4PL6A 4M77B 4GLMA 1M5Q1 5GAN2 2COWA 3CCSA 4NL3A 1UGSB 2YRDA 2DKGA 2M0OA 1B34A 1VQ6Q 2FZCB 1LOJA 4IIOA 8ATCB 4JJNK 1WYXA 3CMAQ 5CKHA 2K3YA 4QW2A 4MMKA 2LJ0A 5GAOq 2CP2A 5FWCA 1IGQA 1K0SA 1HJDA 2OX7A 3SDZA 3RMQA 2A7YA 4C8QD 4PFPA 3BDLA 1VQ4T 1FWZA 3HSBA 3OMCA 1TS9A 2MF2A 3HFOA 1YJ9T 4HCZA 2X4XA 2EJ9A 2LDMA 3UWNA 1SG5A 4IUTA 4EDUA 4M78F 2D8JA 4FIBA 2DTOA 1VQ5A 1R8OB 1BI0A 1OI1A 2FG0A 4FW2A 1I81A 4M7AG 3FB9A 3A8LB 1AOJA 2FHDA 3E2UA 4ANJA 3EG9A 2K4YA 1K8AU 3Q1JA 5GAN6 2QA4A 3CCSQ 4J9FA 4HXJA 1FMWA 5HKCA 3QJ6A 4PJNA 2BTTA 3O5ZA 4JLGA 2JMCA 2P4TA 3WXMB 1WLPB 3OS0A 4F17A 3CCMT 3CMAA 2E41A 3OYBA 3JB9F 2CP0A 3I55T 2E1HA 4XTWA 1M3CA 1NEBA 4RTUA 4C92D 4E7ZA 4XTUA 5M9OA 2EJGA 4J9DA 3CCEQ 2XKOC 5CQXA 2RB6A 3M0UA 1VQNT 4RKUE 2CYZB 4IURA 4FM4B 5FROA 2DRKA 1OU8A 2JUFA 3SWNA 5I22A 3TSWA 3OYIA 3CCJA 2RMOA 1M27C 1O75A 1EIFA 1M8MA 1QP3A 4J5YA 2KT1A 1QWFA 2MCNA 2GF7A 3CCLA 4ME7A 2QASA 4JRQA 3CXCA 1IZ6A 2KYMA 2YRVA 1NPRA 2YLCA 1K8AR 3U23A 3ZBDA 1VQ7T 5GJVB 4C8QG 3ZL7C 4AFQC 5KYUB 1M3BA 2L3SA 2X3WD 1VIFA 2X9HA 1G3YA 5C6SA 1U1TA 4EMKC 2LQKA 1AD5A 1D1BA 4EMKB 1D1AA 2GFUA 1Y71A 2WACA 3CCEA 4KBMB 1WNLA 2QQ9A 8AT1B 2FVUA 3PIPA 2DMOA 2KE9A 3RIRA 4P5NA 1KQSS 1TUCA 2KT8A 2LQNA 4IUQA 2Y4YA 4BI8B 3MP8A 3CPWS 1QVGA 1M1GA 5D7UA 1QVGP 1VQLT 1M4ZA 5D6WA 2DIGA 2SRCA 3GPLA 3JCMQ 4CRIA 3JAME 3L2VA 1Y96B 4N4GA 1IRXA 1GCQC 3PNWC 3OS2A 2QGFB 2HQXA 2DVJA 2CUBA 2LC4A 3EH2A 1B07A 1TG0A 3G4SA 2K2VA 2ECZA 4EMKA 3FRNA 4N4HA 2LNHB 2DLPA 4X9CA 1G2BA 3JCMW 2CREA 3M0PA 1ZQ1A 2RA2A 2XIDA 2JN0A 1ZSZB 4OVAA 5KYUA 3CCJQ 1GFCA 2JMAA 1MV3A 1BKBA 4HA8A 1W2BA 5GAN3 4Y28E 1RLPC 4L6V5 2HCKA 2NUTB 2EFIA 3CCLQ 5LJ5d 5LJ3d 3DLLA 2LTOA 3LH0A 2KR3A 2OJ2A 3EG2A 4M75G 1JB0E 1R77A 3LGLA 2RI5A 4BY6C 4M77G 1XNIA 2V8JA 5HK3A 3JB9H 3KUFA 2EQKA 5LJ3g 1T3SA 2E70A 1KD1U 3CCUQ 1PNJA 1AWWA 1PKTA 2KRSA 3M58A 2ZAEA 1K76A 3KBGA 1CKBA 1WGSA 3WVEB 1ZSZC 3JB9G 3PE0A 1BCOA 1KQSA 4C5EA 4II1A 1RLQC 2EQIA 2YUQA 4M75E 5GAMh 2O4XA 2VASA 3LH5A 4WF2A 2YLBA 2HBPA 1Q82R 4BE0A 2BUDA 4E7IA 1YHQA 4XK8E 5I21A 1NG2A 2FEIA 2XMFA 1UFFA 1SHFA 2NUTA 3H8ZA 1YBYA 4RG8A 1VOMA 4QKUA 2F2XA 3NGPA 4J6YA 4C92G 2HKNA 1M2VA 1N8RC 3CEYA 2A08A 4Q5WA 2C0TA 2NUZA 4M75C 5HY6A 3REBB 3M55A 3M54A 3QZ5B 5D6XA 2HSPA 2LVMA 3OSSC 1EZZB 5GMKj 1VYUA 2BZXA 1RAHB 5GANe 4NS5A 5A0LA 1P92A 2O2OA 2EPDA 3OW2A 1BU1A 2G3RA 2EYQA 3PIOA 3CBMA 1M1KR 2JW4A 3TSZA 4E7SA 3BY7A 1X43A 2D8HA 4IIMA 1KD1C 2FYKA 3CCMA 5A2QE 1MNEA 2BE7D 2O4XB 1X6BA 2E6NA 3N5BB 2VXEA 1UECA 2QA4T 1KC8R 1TUGB 2DL7A 2KXDA 1Q82U 2JS0A 4M75B 1PRLC 2QQAA 1EFNA 3X25B 2C06A 2PU9B 1W70A 1OX8A 5CR2A 3HFNA 3OBYA 3NTKA 3QDFA 1MV0B 2F2VA 2DD5A 1NE8A 2EGEA 4VUBA 2MI6A 5LJ5g 4X9DA 2EIFA 1RACB 4OB0B 4PJOG 1QVGS 1Z9ZA 5I2SA 4KUIA 5J39A 2WSCE 4LD9K 4BDYA 4M77A 3L2QA 2XG8D 4MMLA 1N9RA 2GQVA 5FU7B 3VUZA 1PHTA 1TU0B 3M0SA 4PFZA 2KDSA 2QI2A 3OSVA 5KCHA 3L42A 1I1JA 5GAN5 5ECAA 3CBOA 2M51A 3CMAT 1C1AA 2YUNA 2RQVA 1TXQA 1K8AC 3HRTA 2O9VA 2IG0A 3SB2A 1MNDA 3MKDA 3A8HB 2K3XA 4KT0E 2YRCA 4KUDK 1VQMT 1VQMQ 2RJEA 2HNIA 2X3XD 4ESRA 1K4US 1S1NA 2CUDA 1D3BB 4M77F 4AT1B 2R5AA 5GANg 5L8RE 4A4KA 3E19A 4HT8A 3OYKA 4M78B 1AT1B 1D0YA 4KULA 1B3QA 1GCQA 1WQWA 3CMEA 1YJWA 4A4EA 3QPHA 1K1ZA 2CSQA 4X1VA 4HCKA 1T0HA 2XI9A 3SWNC 3C95A 4PJOD 3EFRA 1AHJB 3E9FA 4C5IA 3CXCP 3I56Q 4M78A 2JT4A 3TQ7P 2E3HA 2YDLA 2J05A 4OMMA 3C12A 2AZVA 2KRNA 1SEMA 2QG9B 3QO3A 5CAIA 2DX1A 5GAMd 1XOVA 2KYBA 4KH1B 4RG2A 3G71A 3P8HA 1BYMA 1N8RR 5GMKm 4X34A 1ZBXA 1VQMA 4M7DD 5GAN8 2QEXA 1RADB 1YI2T 2QDYB 1JBMA 9ATCB 5L23A 2VUBA 5KYXA 3URGA 2QA4Q 3M0TA 3EGXA 2LCCA 3DB3A 3CQTA 4C8QA 5LJ3e 2DZCA 1NZ9A 3JCMb 5J26A 2P0PA 1NYGA 2ZGWA 2KEAA 1Q82C 2GCXA 4BUGA 1WPYA 4F04B 3INZA 1AWOA 4PLIA 1RI9A 2DA9A 3M4YA 3TEEA 3RNJA 1PWTA 4ZGJB 4C5GA 2DXUA 4M7AC 4CI0C 2IVWA 2V8KA 1G83A 1I07A 1Y96A 1M1FA 2R58A 3H9NA 1M90R 1CKAA 1X27A 2WSEE 3X26B 2DBMA 2QYZA 4PNOA 4F7UF 1TTHB 1MMDA 2R57A 1J3TA 2AKLA 3OYLA 2VB6A 4EMHA 4J9CA 2DETA 2DL5A 3H41A 4PKCC 2CT3A 3QYHB 2F2WA 4LNPA 4ZN3A 3CMET 2JM8A 4C92A 1DJ7B 4FYXB 1VQKA 2ZZDA 1ABQA 1YHQT 2A36A 3JCMd 3CCQT 2MK5A 3X28B 4QT7A 2YT6A 1ZLMA 2XK0A 2PVGB 5IHKA 1VQLA 1QP2A 2K7AA 3ZFJA 1VQ8A 4PFOA 3VS1A 2EQJA 1AZEA 2E4HA 2MPXC 1NM7A 3OB9A 3SFMA 2CP7A 3QHSA 5DLOA 1BB9A 1UEBA 2LCLA 1D0ZA 1FMKA 2DK3A 1Y57A 2O31A 1KK7A 2DO3A 2QEXQ 4JZ4A 1Q7YC 1E7OA 5IXFA 3X20B 2RJFA 2M9UA 2AIRB 2JS2A 3CCUT 1U06A 1V1CA 3CCVQ 2MMPA 2COYA 1QVFP 1OZ2A 1RL2A 1TWBA 4ZTJA
chains in the Genus database with same CATH topology
4IUQA 2Y4YA 2DTHA 2A3LA 4BI8B 5GMKe 1M9SA 3MP8A 4C8QC 3GOXA 3WVDB 4J7IA 2E6ZA 3CPWS 3RERA 1QVGA 2E5QA 1M1GA 3BFMA 4JDSA 4OF1A 1VQLT 1GXIE 1W4SA 4M7AD 1M4ZA 5D6WA 2DIGA 5GAMj 3GPLA 3RMSA 3A5ZB 3M53A 3JCMQ 4CRIA 4C8QE 3JRZA 3JAME 3L2VA 2P0QA 5GANj 5CKFA 2DEQA 2LQ8A 4YTLA 1KC8U 1Y96B 4N4GA 3PNWC 3V7CA 3OS2A 1VQKT 1RI0A 3LYIA 1K9MC 3CCLT 2HQXA 3UPUA 2CZ1B 2LC4A 2MAMA 2MWPA 4A4FA 3OYMA 3META 4D6WA 2K2VA 3G4SA 4FL6A 2DD4A 5LJ3j 2DXTA 3NTHA 2LRQA 4EMKA 1YIJT 2CZ6B 3FRNA 4N4HA 4Y91A 1YITA 1VQ5T 3JCMV 2PVOB 2GFAA 3FLGA 1MGQA 4X9CA 2DIQA 3CCJT 3UDCA 2WSFE 3SWNB 3JCMW 4LDXA 1LNXA 1NJIC 1ZQ1A 2RA2A 1VIEA 4IUUA 3CC4T 2XIDA 2X4YA 3JCMf 4F7UA 2JN0A 3GLXA 4XTVA 2DAQA 5CCAA 1YJ9A 2NLUA 4OVAA 5CKBA 1N8RU 2OTJA 4J8OA 2HD0A 3JCMP 1BKBA 5CK9A 5GANd 3EAEA 1YIJA 4HA8A 3ZEHA 3TU4K 4ZTFA 1W2BA 3P8BB 5GAN3 3FC3A 4Y28E 1I4K1 1VQ9A 3G4ST 4M7AA 4L6V5 3OYEA 4ELZC 3MP6A 3GP8A 3FIFA 3FEOA 2EFIA 5GMKh 2RD1A 5LL6S 2LNVA 2H3JA 2QXFA 4J7FA 5LJ3d 2KMTA 5LJ5d 5GANf 2O01E 3DLLA 3CXCS 2LTOA 1XQHA 3LH0A 2I2LA 1QVFA 4M75G 2HAXA 4OMFB 2RO0A 5CIUA 5GAOm 1YJWT 1JB0E 3BDUA 3LGLA 1Q86U 2K5IA 2RI5A 3G6ET 3H6ZA 4KUDK 1VQPA 1OYXA 4BY6C 2L5QA 3JCMe 4M77G 1BIAA 1Y7XA 1XNIA 2V8JA 5HK3A 3JB9H 3KUFA 1YITT 3VUBA 3S3NA 4C92E 1BIBA 2EQKA 2RJDA 5LJ5e 4MZMA 2AHJB 4QQGA 5LJ3g 3CCVT 1UGPB 3QSUA 2E70A 1VQNA 3GNGA 2RH2A 3CCUA 4PJOF 3J80E 3OS1A 1VQOT 5GAOr 1WJQA 3JB9I 1KD1U 4M7DB 5C0MA 4PLLA 2PVDB 4XU2A 3M58A 1N27A 4F7UE 4ZGDB 3KBGA 1UB4A 4A54A 2QEXT 2Y4XA 1WGSA 1VQ9T 3WVEB 5CKDA 1KG1A 2OTLA 4DOVA 3JB9G 3OA6A 3AHUA 3E9GA 3QIIA 3VU3C 3EFSA 3RESA 1KQSA 3S6WA 1G3SA 3CPFA 4C5EA 4M77E 4II1A 4M7AE 1YCYA 1H641 3QJYA 4N0AC 3A8MB 4M7DC 3PMTA 1VQ8T 4M75E 5GAMh 2X4JA 2XDPA 2O4XA 2E12A 2KK4A 3V7RA 5DM7R 2D0QB 2RI3A 1YJNT 1VQ7A 4LDYA 4WF2A 2DVEA 1V29B 2YLBA 3MP1A 2HBPA 4O5VA 4BI3A 2R5MA 3X24B 4BE0A 2BUDA 2VYTA 2ZPGB 3HL8A 2B8AA 4NL2A 3SD4A 5CO7A 4ZN1A 4E7IA 3NFCA 3OYDA 1YHQA 4BY6B 2RHIA 4GLKA 5LJ3h 3VJPA 4E7HA 1M1KU 4XK8E 5I21A 4MDXA 4IKFA 2ZCFB 1FXXA 4XU1A 2DZ9A 4XTYA 4FSXA 5CKEA 4LDVA 3H8ZA 1O9SA 3C4SA 3MHXA 1YBYA 4NOYA 4RG8A 4EMGA 4ATOA 3L2WA 3FDRA 2HQEA 5FRMA 4N4IA 3VYHB 2K5LA 3T9NA 3OY9A 4LDWA 4J6YA 1WJSA 4C92G 1N8RC 3I56A 3CEYA 3M59A 4M78G 2M16A 4E7JA 2CZ7B 4BB7A 4PJOC 3HKSA 4HT9A 4Q5WA 2JTMA 3MEUA 4M75C 3FJPA 5HY6A 1FX7A 2XU8A 4HCCA 4J6XA 3OYGA 3LLRA 3ER0A 3MEWA 4DOWA 3M55A 2D9TA 3L2ZA 5GAN7 3M54A 3QZ5B 5D6XA 3OW2S 2LVMA 3OSSC 4M77C 4A4HA 4B9WA 1Q7YU 4A53A 1W2BS 5GMKj 1BI3A 5GANh 5GMKl 1K73C 1KHCA 3J7AF 5GANe 3CCET 1NJIU 1N6AA 4NS5A 5A0LA 1P92A 2KVQG 2D6FA 5A0DA 3OW2A 4C92B 1IREB 4EPCA 2G3RA 4JUVA 2EYQA 3CCVA 1LJOA 1K73U 3PIOA 2KQWA 3CBMA 1UGQB 4C92C 5A0GA 4J83A 2VGMA 2RM4A 3LWHA 3BY7A 2P0KA 4C0GA 2RHZA 1KD1C 2JVVA 2FYKA 3CCMA 5KE2A 2RK1A 3HHTB 3OYCA 5A2QE 2RJCA 5D6YA 4QVDA 1VQPT 2VV5A 1QW1A 2O4XB 3DKMA 4OB3B 4QQDA 3G6EA 1K9MU 4M7DG 3PFSA 3OYFA 2E6NA 1X75C 1S72A 1M8VA 3N5BB 2VXEA 5EG2A 3CCQA 4JS4A 2QA4T 5I2MA 1QVPA 2YHTA 2K5FA 3A8GB 4R56A 4C0DC 5FU7C 3CCST 2X35A 4PJOB 4FT4A 3V8JA 4C8QB 4M75D 1JJ2A 5FRNA 2E65A 4BE2A 1Q82U 3LGFA 4M75B 4OB1B 5GAOl 2QQAA 4M75F 3L2RA 3X25B 4BACA 2C06A 3LWIA 2JNGA 2PU9B 4GY5A 4BE1A 3QDRB 4JLIA 3G71T 3TREA 5CR2A 1U8RA 1JRIA 3M4GA 3V8LA 3HFNA 3OBYA 3NTKA 2XDDA 4L59A 4QVCA 2L8DA 1B34B 1VQ6A 2EKOA 2KSSA 2DD5A 3OMGA 1NE8A 2MI6A 3QZ9B 4VUBA 3OYJA 5LJ5g 4X9DA 2ZPHB 1G5VA 1HXDA 2EIFA 4LD6A 4M78C 4C0FA 4Z02A 4OB0B 4UC4A 3QXEB 4PJOG 3PT9A 3R6OA 2BIVA 3L1AA 2DPPB 3VYGA 1QVGS 1SSFA 4XTXA 5GAOp 3JCMg 4PJOE 2PQWA 3V7SA 3M57A 1Q86C 3RKYA 5I2SA 4KUIA 5J39A 2VXFA 3M9QA 2WSCE 3I56T 4BDYA 2F69A 4M77A 5GAN4 3L2QA 4LD9K 3CC7T 2XG8D 3GF5A 2QQBA 4MMLA 3CCRT 1N9RA 2GQVA 5FU7B 3CC2T 2DXCA 2JTFA 3VUZA 3CC2A 4M75A 2EJFA 2KDSA 2QI2A 5GAOn 3CCRA 3OSVA 3QBYA 3L42A 5KCHA 3S3MA 1KQ2A 5GAN5 5GMKi 1X6OA 4JS5A 3JCMh 4TVRA 3UT1A 2RHXA 4M7AB 3CBOA 3OYYA 2V8IA 3OYHA 3RKXA 4HCBA 3CD6T 3CMAT 2JOYA 5CQYA 2VC8A 4OGCA 1XTDA 3M56A 4C5HA 1K8AC 1NPPA 2X4WA 3HRTA 3M5AA 1VQ6T 4IUPA 2IG0A 4MZTA 3SB2A 5DY9A 1HK9A 2RI2A 4RCBA 3BW1A 4M7DE 4M78E 3A8HB 4BI4A 3MEVA 4XQ3A 1YI2A 3PTAA 2K3XA 4KT0E 3PGGA 5IN1A 2CGHA 4FT2A 1PSEA 4M78D 1VQMT 4ZGEB 2F5KA 1OZ3A 2RJEA 2HNIA 2XICA 5LJ5h 1G3WA 4IUVA 4LDUA 3OBWA 4M77D 4C92F 2M1HA 4OB2B 4PL6A 4M77B 1G3TA 1M5Q1 5GAN2 1D3BB 1U1SA 4M77F 1UGRB 3CCSA 2R5AA 3OS5A 5GANg 4R55A 5L8RE 4A4KA 4NL3A 1UGSB 3JCMJ 2DXBA 2DKGA 3E19A 1S72T 2M0OA 1B34A 1VUBA 4HT8A 5CVIA 1M90C 2ZPBB 1LOJA 5FLXE 3OYKA 4JJNK 4OGEA 5CKHA 2K3YA 3P8DA 4M78B 4QW2A 5J3BA 3S3OA 2EWNA 1VQ4A 1Q81C 1ZHIA 1WQ7A 4KULA 2OAUA 1KHIA 1WQWA 2KY9A 2ZPEB 4DQ2A 4MMKA 3CMEA 4A4EA 1YJWA 4BD3A 3QPHA 5FU6B 5GAOq 3V8KA 2XI9A 4N0AA 1BI1A 3SWNC 3C95A 3G7ZA 4PJOD 2F5TX 2RK2A 3EFRA 1AHJB 3E9FA 3SDZA 4C5IA 3RMQA 2A7YA 3GIBA 4C8QD 2MWOA 4F7UG 4M78A 3JSCA 4DA4A 3ME9A 3BDLA 1VQ4T 1FWZA 3HSBA 4E7LA 4F7UB 2Y90A 3OMCA 2EQMA 2MF2A 2OTJT 3HFOA 5LJ5f 3JB9D 5LJ3f 3C12A 3LW5E 4HCZA 2X4XA 1YJ9T 2EJ9A 2LDMA 1TH7A 4ELYC 3QO3A 3UWNA 5CAIA 2DTIA 3L2UA 3TCJA 1XOVA 4IUTA 5GAMd 4EDUA 1WJRA 4M78F 4RG2A 4FIBA 4JRPA 1X01A 3G71A 2E64A 3P8HA 2DTOA 1VQ5A 1R8OB 1BI0A 3DB4A 2L89A 4XU0A 5IT9E 1OI1A 1BYMA 3CPWA 2LX9A 5GMKm 4X34A 1ZBXA 4XU3A 1VQMA 4B9XA 3MCAB 1I81A 2OTLT 4M7DD 1H3ZA 5GAN8 4M7AG 3FB9A 4FU6A 2QEXA 3A8LB 1YI2T 3CD6A 5KH6A 2FHDA 2QDYB 1JBMA 5KCOA 2L3RA 3I55A 2K4YA 2DJZA 1K8AU 2VUBA 3Q1JA 5GAN6 5DLQE 3URGA 2QA4A 4PJOA 2CKKA 2E10A 2LCCA 3DB3A 5HKCA 4C8QA 3QJ6A 1MHNA 5LJ3e 2DZCA 1NZ9A 2FL7A 4JLGA 1N9SA 3JCMb 5J26A 2P0PA 2P4TA 2ZGWA 3WXMB 4JRIA 1Q82C 3OS0A 2GCXA 2ZPFB 5IAYA 3CCMT 3CMAA 2E41A 4BUGA 3QYGB 1WPYA 3C94A 3HRUA 3OYBA 2QTXA 3INZA 3VKIA 3JB9F 4PLIA 2FB7A 2PUOB 2LT1A 3VV0A 3I55T 2E1HA 4XTWA 3M4YA 1M90U 3J81E 3JB9J 3TEEA 4C92D 4XTUA 4ZGJB 5M9OA 3MO8A 3ASKA 3HPWA 2EJGA 4C5GA 3F70A 2KAFA 3OQ5A 4HKEA 2JZ2A 4MZPA 2DXUA 4M7AC 3O8VA 4CI0C 3HRSA 2IVWA 3OYAA 2V8KA 2XKOC 4E47A 3E1SA 3JCMc 5CQXA 4XAXB 1Y96A 1VQOA 4M7DA 2LT4A 1M1FA 2RB6A 1VQNT 2R58A 3RKWA 4L5GA 2WSEE 3X26B 1KQ1A 4RKUE 2EAYA 4E7KA 2CYZB 1Q81U 3QG1A 1KC8C 1M1KC 4IURA 4FM4B 4PNOA 4F7UF 5FROA 2QQSA 2JUFA 2R57A 3SWNA 3QKJA 3OYLA 4V2SA 3OYNA 3OYIA 4EMHA 3PMIA 3CCJA 4C8QF 4PKCC 1O75A 1EIFA 4OP0A 3QYHB 5FU6C 1QP3A 2RHUA 3CBPA 3QUIA 4J5YA 5KE3A 3CC7A 2CS7A 3MEAA 5GAMf 4ZN3A 4BDZA 3LX7A 2GF7A 2K57A 3KXTA 3CMET 3CCLA 4J6WA 1DJ7B 4C92A 1VQKA 2ZZDA 4QVZA 2BKDN 4ME7A 1YHQT 1BI2A 4JRQA 3CCQT 3JCMd 3X28B 1I8FA 3CXCA 1IZ6A 5HK0A 4RMOA 1QVFS 2YRVA 1NPRA 2YLCA 2XK0A 4O6JA 4M7AF 2PVGB 3GNFB 1VQLA 1QP2A 4JRKA 4RCCA 3ZFJA 3ZBDA 3NTIA 1VQ7T 4C8QG 1YJNA 3HP9A 4C0DB 3CC4A 1VQ8A 2CZ0B 5AYFA 4C0ZA 1I5LA 2EQJA 1D3BA 1VIFA 3OB9A 3SFMA 5C6SA 1G3YA 1U1TA 3QHSA 5DLOA 1JJ2S 1UEBA 4EMKC 2LCLA 2VGNA 1PSFA 2DK3A 2LQKA 3RUXA 4M7DF 2RHYA 4EMKB 3DLMA 2QQRA 1Y07A 2GFUA 2DO3A 1Y71A 2WACA 3A8OB 4A4GA 2ZPIB 1Q7YC 2XD0A 5GAMe 5GAMg 3X20B 2RJFA 2M9UA 5LJ5j 3CCEA 4KBMB 1WNLA 3CCUT 2XHCA 2PUKB 2QQ9A 4MDWA 2FVUA 4XTZA 3PIPA 2XDBA 2MMPA 3RIRA 4QQ6A 3JCMX 4P5NA 1KQSS 1OZ2A 1RL2A 2EQUA 4ZTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5M A;  4IUQ A;  3Q1J A;  4BE0 A;  2BUD A;  2VYT A;  3SD4 A;  4E7I A;  2B8A A;  2CKK A;  3GOX A;  3MP8 A;  2JTF A;  3OYD A;  2LCC A;  3DB3 A;  2RHI A;  3S3M A;  2E5Q A;  4E7H A;  3QBY A;  3QJ6 A;  3L42 A;  5KCH A;  1MHN A;  4IKF A;  3UT1 A;  5J26 A;  2RHX A;  5D6W A;  2DIG A;  3OS0 A;  5IAY A;  3H8Z A;  3C4S A;  3L2V A;  4CRI A;  3OYH A;  3OYB A;  3L2W A;  3FDR A;  2HQE A;  3PNW C;  4N4I A;  4N4G A;  4PLI A;  3OS2 A;  1RI0 A;  3LYI A;  3OY9 A;  5FRM A;  2HQX A;  1WJS A;  2MWP A;  4A4F A;  4C5H A;  3CEY A;  2X4W A;  3OYM A;  2M16 A;  3MET A;  4E7J A;  4IUP A;  2IG0 A;  4Q5W A;  4FL6 A;  3MEU A;  5M9O A;  3MO8 A;  3NTH A;  3ASK A;  2LRQ A;  4C5G A;  2RI2 A;  3F70 A;  4N4H A;  3OQ5 A;  3OYG A;  3LLR A;  2JZ2 A;  2GFA A;  3FLG A;  3MEW A;  2D9T A;  3O8V A;  2DIQ A;  3MEV A;  5D6X A;  3OYA A;  2LVM A;  4A4H A;  2K3X A;  4B9W A;  5IN1 A;  4IUU A;  2F5K A;  1OZ3 A;  2RJE A;  2R58 A;  4BDY A;  1KHC A;  2X4Y A;  4IUV A;  3L2Q A;  2M1H A;  2DAQ A;  4PL6 A;  4E7K A;  2NLU A;  4OVA A;  4NS5 A;  4IUR A;  3EAE A;  2R5A A;  5FRO A;  3ZEH A;  4ZTF A;  2QQS A;  2R57 A;  3FC3 A;  2M0O A;  2G3R A;  3QKJ A;  3OYE A;  3OYL A;  3MP6 A;  3OYK A;  3OYN A;  3FEO A;  3OYI A;  3PMI A;  2EFI A;  2LTO A;  3LH0 A;  2P0K A;  2K3Y A;  2RHZ A;  2RHU A;  3P8D A;  4QW2 A;  5KE3 A;  3S3O A;  2RO0 A;  5KE2 A;  5CIU A;  3OYC A;  3MEA A;  2RJC A;  5D6Y A;  3LGL A;  3LX7 A;  2O4X B;  2GF7 A;  2RI5 A;  4BDZ A;  4QQD A;  3H6Z A;  4A4E A;  4BD3 A;  1OYX A;  3PFS A;  3OYF A;  2E6N A;  4QVZ A;  2BKD N;  1XNI A;  3KUF A;  2X35 A;  3E9F A;  4C5I A;  3S3N A;  2YRV A;  5FRN A;  2EQK A;  2RJD A;  2XK0 A;  4BE2 A;  3LGF A;  2MWO A;  4QQG A;  3NTI A;  3L2R A;  3ME9 A;  3BDL A;  4BAC A;  3OS1 A;  1WJQ A;  4E7L A;  2EQJ A;  3OMC A;  4GY5 A;  2EQM A;  5C0M A;  4BE1 A;  4PLL A;  3OB9 A;  1N27 A;  5C6S A;  4HCZ A;  2X4X A;  1WGS A;  2LDM A;  3NTK A;  2RHY A;  3OA6 A;  3DLM A;  2QQR A;  3E9G A;  3QII A;  4L59 A;  3UWN A;  3L2U A;  2L8D A;  3S6W A;  2EKO A;  2GFU A;  4C5E A;  2WAC A;  3OMG A;  4IUT A;  4A4G A;  1WJR A;  4RG2 A;  4EDU A;  3OYJ A;  4II1 A;  1G5V A;  4LD6 A;  3P8H A;  4Z02 A;  3DB4 A;  2RJF A;  4UC4 A;  2L89 A;  1OI1 A;  2BIV A;  3PMT A;  4X34 A;  1SSF A;  2XDP A;  2O4X A;  4B9X A;  2PQW A;  2RI3 A;  1H3Z A;  4FU6 A;  4QQ6 A;  5J39 A;  3M9Q A;  1OZ2 A;  3MP1 A;  5KH6 A;  2FHD A;  5KCO A;  2EQU A;  2L3R A;  4ZTJ A; 
#chains in the Genus database with same CATH topology
 1M9S A;  3GOX A;  2E6Z A;  2E5Q A;  2NYS A;  3G6E Q;  3A5Z B;  4C8Q E;  5GAN j;  2P0Q A;  5CKF A;  4YTL A;  1VQK T;  1QQJ A;  2MAM A;  2MWP A;  4JPB W;  2VWF A;  2CT4 A;  4D6W A;  4FL6 A;  2FPF A;  2LRQ A;  2L2P A;  2NUP A;  3R6N A;  3FLG A;  2DIQ A;  2FRY A;  2PTK A;  4LDX A;  1LNX A;  1NJI C;  1X2Q A;  4J9I A;  1UGV A;  4F7U A;  5CCA A;  1YJ9 A;  1N8R U;  2HD0 A;  1U5S A;  5CK9 A;  1VQ5 Q;  3EAE A;  1IXD A;  2DL3 A;  4ZTF A;  3ZEH A;  1YCS B;  1I4K 1;  1YFN A;  2K2M A;  4RTV A;  4JJB A;  1VQK Q;  2H3J A;  1X6G A;  4J7F A;  2KMT A;  1XQH A;  3FJ5 A;  2I2L A;  1QVF A;  2QDL A;  2HAX A;  2RO0 A;  4F16 A;  1VQL Q;  1UG1 A;  1YWO A;  3VUB A;  2BZ8 A;  4MZM A;  3THK A;  1UGP B;  4WTO B;  2PZ1 A;  3VRZ A;  3GNG A;  4PJO F;  3J80 E;  2HL3 A;  1VQO T;  4M7D B;  2RN8 A;  5C0M A;  2PVD B;  4XU2 A;  1RAA B;  4F7U E;  2BZY A;  1UB4 A;  2KRO A;  4WCI A;  1VQ9 T;  1KG1 A;  4HVV A;  4DOV A;  2OTL A;  3AHU A;  1ZX6 A;  3EFS A;  3CPF A;  3EG0 A;  4M7D C;  2G6F X;  1VQ8 T;  2XDP A;  2E12 A;  5DM7 R;  2D0Q B;  1VQ7 Q;  2RI3 A;  1D09 B;  4LDY A;  2DVE A;  3MP1 A;  4O5V A;  2W0Z A;  2R5M A;  3X24 B;  2VYT A;  2MIO A;  2ZPG B;  4NL2 A;  3SD4 A;  1YIT T;  3CCQ Q;  3NFC A;  2K9G A;  1YHQ Q;  4BY6 B;  1K9M R;  1UHF A;  1WDX A;  5EC7 A;  2E5K A;  4MDX A;  4IKF A;  4XU1 A;  2V26 A;  5CKE A;  3EFO A;  4NOY A;  4DEY A;  4ATO A;  2HQE A;  4N4I A;  1IB8 A;  2K5L A;  4LDW A;  4LE9 A;  1M3A A;  4M78 G;  3HKS A;  1SHG A;  2DL4 A;  4ORZ A;  2EBP A;  3OYG A;  3LLR A;  2J7I A;  3OW2 P;  2W10 A;  3OW2 S;  1Q7Y U;  5AT1 B;  1JJ2 P;  5FWB A;  1K73 C;  3J7A F;  4JJC A;  1N6A A;  2KVQ G;  2D6F A;  2V1Q A;  4Y92 A;  2MOX A;  3I35 A;  3I55 Q;  1UGQ B;  1GL5 A;  4C92 C;  2RM4 A;  4Z8A A;  2P0K A;  4C0G A;  2M02 A;  1OX9 A;  2RHZ A;  5KE2 A;  3OYC A;  2RJC A;  1N5Z A;  5D6Y A;  3DKM A;  4QQD A;  1CSK A;  4M7D G;  3PFS A;  3EG9 B;  3OYF A;  3VS7 A;  3CCQ A;  3CCS T;  1QMC A;  2K5F A;  2E65 A;  4BE2 A;  2CH4 A;  1YI2 Q;  2DIL A;  2OTL Q;  2D0N A;  4BE1 A;  3G71 T;  2ESW A;  3TRE A;  1WIE A;  3M4G A;  3A98 A;  4LXC A;  2KSS A;  3H0H A;  3OMG A;  2ZPH B;  4CC2 A;  4M78 C;  1PD0 A;  2COZ A;  3RBB B;  4KRT A;  1OV3 A;  1SSF A;  4XTX A;  4PJO E;  3V7S A;  3M57 A;  3I56 T;  4E2F B;  2VXF A;  3GF5 A;  5GMK i;  1X6O A;  3CD6 Q;  2RHX A;  4M7A B;  2DL8 A;  2HMA A;  4FYW B;  3SHW A;  2YUO A;  2VC8 A;  4JZ3 A;  1WI7 A;  3M5A A;  1UTI A;  2HBW A;  2QK0 A;  1YNZ A;  1YI2 A;  3PTA A;  1HD3 A;  3PGG A;  5IN1 A;  2CGH A;  4ZGE B;  5LJ5 h;  1B7T A;  4IUV A;  1OPK A;  4LDU A;  4M77 D;  4OB2 B;  2DJQ A;  2FPE A;  1LCK A;  3JCM J;  2O88 A;  2FPD A;  2HKQ B;  1VUB A;  5CVI A;  3EH1 A;  5FLX E;  1BK2 A;  1QCO A;  1GBQ A;  3S3O A;  3P8D A;  1TSF A;  5J3B A;  1WQ7 A;  1KHI A;  2KY9 A;  4DQ2 A;  5FU6 B;  2F1L A;  2CP6 A;  3V8K A;  3G7Z A;  1EX4 A;  2F5T X;  2J6F A;  3CC7 Q;  3GIB A;  2GQI A;  4KH0 B;  1YP5 A;  1GFD A;  3JSC A;  1PM3 A;  4DA4 A;  4F7U B;  2EYY A;  1UDL A;  1TH7 A;  2LZ6 B;  2RQR A;  4JRP A;  1X01 A;  1V76 A;  2E64 A;  1G8X A;  3DB4 A;  3G71 Q;  4XU0 A;  2L89 A;  3CPW A;  4XU3 A;  2A28 A;  3MCA B;  3VS2 A;  1H3Z A;  4FU6 A;  3RR6 A;  3CD6 A;  2DJZ A;  5DLQ E;  4PJO A;  2CKK A;  2E10 A;  3H0F A;  1MHN A;  3NHN A;  2FL7 A;  1VQP Q;  1NEG A;  2KI7 A;  3TVT A;  3QYG B;  4J9H A;  1I0C A;  2QTX A;  3VKI A;  2FB7 A;  2PUO B;  2LT1 A;  1UHC A;  4Z88 A;  5GJW B;  1M90 U;  3JB9 J;  2LMJ A;  3MO8 A;  3VS0 A;  1M2O A;  1NLP C;  3I5R A;  1Q95 G;  3F70 A;  2LP5 A;  4HKE A;  4MZP A;  3O8V A;  2QGG A;  4OMQ A;  3HRS A;  1Y0M A;  4E47 A;  3JCM c;  2C0I A;  4XAX B;  1VQO A;  4M7D A;  4AFZ C;  3RKW A;  1H8K A;  4L5G A;  1KQ1 A;  2EAY A;  1KC8 C;  1JQQ A;  2EW3 A;  2EKH A;  2KGT A;  3EG1 A;  3SEM A;  3QKJ A;  1JO8 A;  4C8Q F;  4OP0 A;  2FZG B;  1E6G A;  3QUI A;  5KE3 A;  3CC7 A;  3MEA A;  3KXT A;  4J6W A;  2BKD N;  1BI2 A;  4DBF A;  2FZK B;  1QVF S;  2JTE A;  2CP5 A;  4O6J A;  4M7A F;  3GNF B;  2OAW A;  4RCC A;  3M0Q A;  1YJN Q;  3HP9 A;  3CC4 A;  1RAG B;  1VQ8 Q;  1I5L A;  1JJ2 S;  2VGN A;  3IQL A;  1PSF A;  4M7D F;  1XJW B;  3DLM A;  1ZBJ A;  1Y07 A;  1VQ9 Q;  1IHV A;  1YN8 A;  1K9A A;  2XD0 A;  1JEG A;  1VQO Q;  1ZUK A;  4MDW A;  4XTZ A;  4KGX B;  1KFZ A;  1AZG B;  3NMZ C;  1OOT A;  2XDB A;  4QQ6 A;  3JCM X;  4OMN A;  1ZSG A;  2DRM A;  2DTH A;  2A3L A;  5GMK e;  1ARK A;  1M2V B;  2KXC A;  2GNC A;  3WVD B;  2ATC B;  3BFM A;  4JDS A;  1W2B P;  2LQW A;  2PNI A;  4M7A D;  1YJW Q;  3RMS A;  3M53 A;  1NLO C;  2DEQ A;  3EHR A;  1RI0 A;  1T0J A;  3CCL T;  2CP3 A;  3UPU A;  1WHH A;  2K79 A;  4A4F A;  3OYM A;  3MET A;  4AFS C;  2LJ1 A;  2DXT A;  2EGC A;  3NTH A;  1YIJ T;  4Y91 A;  2LX7 A;  1FYN A;  1VQ5 T;  1MGQ A;  3UDC A;  2WSF E;  3RDV A;  2J06 A;  1VIE A;  4IUU A;  3CC4 Q;  3CC4 T;  2AKK A;  2X4Y A;  1VYT A;  3GLX A;  2OTJ A;  4J8O A;  1QLY A;  2EYW A;  5GAN d;  1YIJ A;  2RQT A;  3TU4 K;  4CC3 A;  1ZA2 B;  3FC3 A;  1VQ9 A;  1K73 R;  4ELZ C;  3MP6 A;  3GP8 A;  3FIF A;  5LL6 S;  1VA7 A;  3CXC S;  3C0C A;  2BE9 B;  5CIU A;  3KFV A;  1NJI R;  1Q86 U;  4D8K A;  2K5I A;  3G6E T;  1WFW A;  2L5Q A;  2DNU A;  1Y7X A;  3HTR A;  3S3N A;  1OPL A;  2CSI A;  4FSS A;  3PVL A;  2OI3 A;  3UAT A;  3CCV T;  4PLL A;  2RPN A;  3VRY A;  4ZGD B;  4A54 A;  4F14 A;  5CKD A;  3RES A;  3S6W A;  3I5S A;  1OEB A;  1KJW A;  3EGD A;  2DBK A;  2D1X A;  1SPK A;  3BE3 A;  1YCY A;  3QJY A;  4N0A C;  3A8M B;  2H8H A;  4PJM A;  2ENM A;  2KK4 A;  1WXU A;  1VQ7 A;  1PG5 B;  1V29 B;  1KSW A;  4BI3 A;  1LPL A;  2ED1 A;  2HDA A;  3HL8 A;  2C0O A;  2DYB A;  2RHI A;  5LJ3 h;  1OUL A;  3VJP A;  4E7H A;  1NBE B;  4B6M A;  2ZCF B;  2DZ9 A;  4LN2 A;  1C0M A;  3MHX A;  4EMG A;  1AWJ A;  3T9N A;  2RQW A;  3OY9 A;  4J9B A;  1WJS A;  4KGZ B;  2DM1 A;  2JJ9 A;  3M59 A;  2EVR A;  4BB7 A;  2P4R A;  4CC7 A;  4HT9 A;  4PJO C;  1WXB A;  2JTM A;  3MEU A;  5KYW B;  2XU8 A;  4HCC A;  4J6X A;  1UJ0 A;  3MEW A;  3ER0 A;  2D9T A;  3L2Z A;  3VS4 A;  5GAN 7;  4M77 C;  3EGD B;  4A53 A;  5KYY B;  1W2B S;  2SEM A;  1KHC A;  1MMG A;  1PRM C;  5A0D A;  4RTX A;  1IRE B;  2IIM A;  1Q86 R;  4JUV A;  4FYY B;  3CCV A;  2FO0 A;  5A0G A;  4J83 A;  3I9Q A;  1PD1 A;  3LWH A;  4GBQ A;  2KBT A;  2RK1 A;  1IGU A;  1VQP T;  2VV5 A;  1QW1 A;  3G6E A;  3A1P A;  4A63 B;  3ULR B;  1WX6 A;  1X75 C;  2RNA A;  3A8G B;  4R56 A;  4C0D C;  5FU7 C;  2AT1 B;  4C8Q B;  1Q81 R;  4M75 D;  1JJ2 A;  1U3O A;  1SRM A;  5GAO l;  2GGR A;  1T3L A;  2X51 A;  1BBZ A;  4M75 F;  3L2R A;  2IPO B;  3LWI A;  2JNG A;  3QDR B;  1RAI B;  3UA7 A;  1JRI A;  2LJ3 A;  6AT1 B;  2EKO A;  3MJX A;  2CH4 W;  2DFU A;  3OYJ A;  1GRI A;  2YXY A;  1WHL A;  1YJ9 Q;  2VKN A;  5KYW A;  4UC4 A;  3QXE B;  3R6O A;  2BIV A;  3L1A A;  2DPP B;  2L3P A;  1WHM A;  5GAO p;  1VQ4 Q;  3JCM g;  2PQW A;  4K11 A;  3RKY A;  4DEX A;  3M9Q A;  1UE9 A;  2F69 A;  5GAN 4;  3CC7 T;  3CCR T;  4CC4 B;  1SRL A;  3CC2 T;  2DXC A;  2JTF A;  3CC2 A;  5GAO n;  3CCR A;  3QBY A;  2YWW A;  4JS5 A;  4TVR A;  4OMP A;  2V8I A;  2J6K A;  4OGC A;  1XTD A;  4C5H A;  2X4W A;  4E6R A;  1VQ6 T;  2DE0 X;  4IUP A;  4MZT A;  1QKX A;  1HK9 A;  2RI2 A;  3BW1 A;  4M78 E;  1WZO A;  2H3E B;  4FT2 A;  1PSE A;  4KGV B;  1G3W A;  1FMV A;  1ACM B;  4C92 F;  1G3T A;  4HVW A;  1U1S A;  1UGR B;  3OS5 A;  2RF0 A;  4R55 A;  2DXB A;  1S72 T;  2DER A;  1M90 C;  2ZPB B;  5KYN A;  4OGE A;  1VQ4 A;  2EWN A;  1Q81 C;  1ZHI A;  2OAU A;  3AT1 B;  3CD6 T;  2ZPE B;  4BD3 A;  1AEY A;  4N0A A;  1BI1 A;  3CC2 Q;  2RK2 A;  3CCR Q;  2HQH A;  1KIK A;  3VS5 A;  2MWO A;  4F7U G;  1JXM A;  1HSQ A;  1MMA A;  1VYV A;  3ME9 A;  3VS3 A;  1HYO A;  2ABL A;  2MYS A;  1R0C B;  4E7L A;  2Y90 A;  2EQM A;  2FRW A;  2OTJ T;  1ZSZ A;  2L3Q A;  5FW9 A;  5LJ5 f;  3JB9 D;  5LJ3 f;  3LW5 E;  2LCS A;  2GTO A;  4ELY C;  2DTI A;  3L2U A;  1GBR A;  4ZNX A;  3TCJ A;  2YSQ A;  1WJR A;  2I0N A;  4J9E A;  4AG1 C;  1OQK A;  5IT9 E;  2LX9 A;  4B9X A;  2OTL T;  1PC0 A;  4FYV B;  5KH6 A;  5KCO A;  2L3R A;  3I55 A;  2ROT A;  1AVZ C;  1C6V X;  1I5O B;  1ZUU A;  1MMN A;  5IHI A;  1N9S A;  1UUE A;  4JRI A;  2ZPF B;  3REA B;  4DBQ A;  5IAY A;  3HRU A;  3C94 A;  2RQU A;  3VV0 A;  3J81 E;  4DBR A;  2ROL A;  1JXO A;  4DBH A;  2EYZ A;  5HCK A;  3ASK A;  3HPW A;  2KAF A;  3OQ5 A;  2JZ2 A;  3JV3 A;  4OML A;  3OYA A;  3E1S A;  2LT4 A;  1X69 A;  2EYX A;  3QWY A;  1Q81 U;  4E7K A;  3QG1 A;  1M1K C;  1H92 A;  1QCF A;  2QQS A;  2QTV A;  4V2S A;  3EFO B;  3OYN A;  2K6D A;  3PMI A;  5IH2 A;  1WXT A;  4JJD A;  3EHQ A;  5FU6 C;  2B86 A;  2RHU A;  3CBP A;  2CS7 A;  5GAM f;  4BDZ A;  3LX7 A;  2K57 A;  4QVZ A;  3MPU B;  1YIT Q;  1I8F A;  5HK0 A;  4RMO A;  3UA6 A;  1KQS P;  4JRK A;  5KYY A;  3NTI A;  1YJN A;  4C0D B;  2DEU A;  1M30 A;  2CZ0 B;  5AYF A;  4C0Z A;  1D3B A;  4M4Z A;  3RUX A;  1ABO A;  2RHY A;  2QQR A;  1WHG A;  3GBQ A;  2A37 A;  4A4G A;  3A8O B;  2ZPI B;  5GAM e;  5GAM g;  4LUD A;  5LJ5 j;  4AMC A;  2XHC A;  2PUK B;  2AK5 A;  4FCY A;  1BCM A;  4D8D A;  3PVQ A;  2EQU A;  2DYI A;  4C8Q C;  4J7I A;  3RER A;  3M0R A;  4AFU C;  5I11 A;  4OF1 A;  1GXI E;  4RTT A;  1W4S A;  4HVU A;  5GAM j;  1H3H A;  3JRZ A;  1KC8 U;  2LQ8 A;  2K3B A;  3V7C A;  1UJY A;  1K9M C;  3LYI A;  5KYX B;  2CZ1 B;  4PK4 A;  3G4S Q;  2GTJ A;  3D7S B;  1ZA1 B;  2DD4 A;  1LVK A;  5LJ3 j;  2Z0W A;  2HEQ A;  1QWE A;  2CZ6 B;  1YIT A;  3JCM V;  2PVO B;  2GFA A;  3CCJ T;  3SWN B;  4RTY A;  1RUW A;  1OU9 A;  5IXB A;  3JCM f;  4XTV A;  2DAQ A;  2NLU A;  2P84 A;  5CKB A;  3JCM P;  1TUD A;  4RTZ A;  1YIJ Q;  1W1F A;  2JXB A;  3EGX B;  3P8B B;  1PKS A;  1RAE B;  3G4S T;  4M7A A;  3OYE A;  3QWX X;  3FEO A;  5GMK h;  2RD1 A;  1QCN A;  2L0A A;  2LNV A;  2QXF A;  2DF6 A;  3VS6 A;  5GAN f;  2HZY A;  2O01 E;  4OMF B;  5GAO m;  1YJW T;  3BDU A;  1NYF A;  3H6Z A;  1F1B B;  1VQP A;  1OYX A;  3JCM e;  1BIA A;  2ED0 A;  4AG2 C;  4C92 E;  1BIB A;  5LJ5 e;  2RJD A;  2AHJ B;  4QQG A;  3NPF A;  3QSU A;  1VQN A;  2RH2 A;  3CCU A;  3OS1 A;  5GAO r;  1WJQ A;  3JB9 I;  5IHN A;  4OMO A;  2KRM A;  4J9G A;  1N27 A;  1MUZ A;  2QEX T;  2Y4X A;  3OA6 A;  1AWX A;  3E9G A;  3QII A;  3VU3 C;  1R0B G;  1G3S A;  2YUP A;  4M77 E;  2EGA A;  4M7A E;  1PCX A;  1H64 1;  2QAZ A;  3PMT A;  7AT1 B;  2CDT A;  2NWM A;  2X4J A;  4RTW A;  3V7R A;  1YJN T;  1D1C A;  1ZUY A;  2B8A A;  4ZN1 A;  5CO7 A;  3OYD A;  4GLK A;  1M1K U;  3CME Q;  1FXX A;  1JU5 C;  4XTY A;  4PJL A;  4FSX A;  4LDV A;  1O9S A;  3C4S A;  2KNB B;  3L2W A;  3FDR A;  5FRM A;  3VYH B;  2O9S A;  3I56 A;  2M16 A;  4E7J A;  2CZ7 B;  1X2K A;  3FJP A;  1FX7 A;  4PJJ A;  2AZS A;  4DOW A;  1QKW A;  4A4H A;  4B9W A;  1WHK A;  1VQN Q;  1BI3 A;  5GAN h;  5GMK l;  3CCE T;  2HL5 C;  1NJI U;  4C92 B;  1GCP A;  4EPC A;  1LJO A;  1K73 U;  2KQW A;  2VGM A;  1SF9 A;  2GBQ A;  3CCM Q;  2JVV A;  3HHT B;  4QVD A;  1IO6 A;  4OB3 B;  1K9M U;  1S72 A;  1M8V A;  5EG2 A;  4JS4 A;  5I2M A;  1QVP A;  2YHT A;  1IHW A;  1KD1 R;  2X35 A;  1D0X A;  4PJO B;  4FT4 A;  3V8J A;  5FRN A;  3LGF A;  4OB1 B;  4BAC A;  1WHJ A;  4GY5 A;  4JLI A;  4R0K A;  1RAF B;  2HSE B;  1U8R A;  3UF4 A;  3V8L A;  1A0N B;  2XDD A;  1K0X A;  4L59 A;  4QVC A;  2L8D A;  1B34 B;  1VQ6 A;  1RAB B;  3QZ9 B;  1G5V A;  1TOV A;  1HXD A;  4LD6 A;  4C0F A;  2OTJ Q;  2NUP B;  4Z02 A;  3CPW P;  3PT9 A;  3VYG A;  4Z89 A;  1Q86 C;  3EGU A;  1Q7Y R;  2QQB A;  3EG3 A;  1E6H A;  1SSH A;  4RUG A;  4EIK A;  1Z9Q A;  4M75 A;  2EJF A;  3S3M A;  3G1J A;  4FW1 A;  1KQ2 A;  2VVK A;  4LUE A;  3JCM h;  3UT1 A;  1WA7 A;  2JM9 A;  3OYY A;  3OYH A;  4HCB A;  3RKX A;  3H0I A;  2JOY A;  2A0F B;  1W6X A;  5CQY A;  3M56 A;  1NPP A;  1S72 Q;  2M0Y A;  1YWP A;  5DY9 A;  2J6O A;  4RCB A;  4M7D E;  4BI4 A;  3MEV A;  2V1R A;  4XQ3 A;  4M78 D;  2F5K A;  1OZ3 A;  2E3I A;  2XIC A;  3OBW A;  2M1H A;  1SKU B;  4PL6 A;  4M77 B;  4GLM A;  1M5Q 1;  5GAN 2;  2COW A;  3CCS A;  4NL3 A;  1UGS B;  2YRD A;  2DKG A;  2M0O A;  1B34 A;  1VQ6 Q;  2FZC B;  1LOJ A;  4IIO A;  8ATC B;  4JJN K;  1WYX A;  3CMA Q;  5CKH A;  2K3Y A;  4QW2 A;  4MMK A;  2LJ0 A;  5GAO q;  2CP2 A;  5FWC A;  1IGQ A;  1K0S A;  1HJD A;  2OX7 A;  3SDZ A;  3RMQ A;  2A7Y A;  4C8Q D;  4PFP A;  3BDL A;  1VQ4 T;  1FWZ A;  3HSB A;  3OMC A;  1TS9 A;  2MF2 A;  3HFO A;  1YJ9 T;  4HCZ A;  2X4X A;  2EJ9 A;  2LDM A;  3UWN A;  1SG5 A;  4IUT A;  4EDU A;  4M78 F;  2D8J A;  4FIB A;  2DTO A;  1VQ5 A;  1R8O B;  1BI0 A;  1OI1 A;  2FG0 A;  4FW2 A;  1I81 A;  4M7A G;  3FB9 A;  3A8L B;  1AOJ A;  2FHD A;  3E2U A;  4ANJ A;  3EG9 A;  2K4Y A;  1K8A U;  3Q1J A;  5GAN 6;  2QA4 A;  3CCS Q;  4J9F A;  4HXJ A;  1FMW A;  5HKC A;  3QJ6 A;  4PJN A;  2BTT A;  3O5Z A;  4JLG A;  2JMC A;  2P4T A;  3WXM B;  1WLP B;  3OS0 A;  4F17 A;  3CCM T;  3CMA A;  2E41 A;  3OYB A;  3JB9 F;  2CP0 A;  3I55 T;  2E1H A;  4XTW A;  1M3C A;  1NEB A;  4RTU A;  4C92 D;  4E7Z A;  4XTU A;  5M9O A;  2EJG A;  4J9D A;  3CCE Q;  2XKO C;  5CQX A;  2RB6 A;  3M0U A;  1VQN T;  4RKU E;  2CYZ B;  4IUR A;  4FM4 B;  5FRO A;  2DRK A;  1OU8 A;  2JUF A;  3SWN A;  5I22 A;  3TSW A;  3OYI A;  3CCJ A;  2RMO A;  1M27 C;  1O75 A;  1EIF A;  1M8M A;  1QP3 A;  4J5Y A;  2KT1 A;  1QWF A;  2MCN A;  2GF7 A;  3CCL A;  4ME7 A;  2QAS A;  4JRQ A;  3CXC A;  1IZ6 A;  2KYM A;  2YRV A;  1NPR A;  2YLC A;  1K8A R;  3U23 A;  3ZBD A;  1VQ7 T;  5GJV B;  4C8Q G;  3ZL7 C;  4AFQ C;  5KYU B;  1M3B A;  2L3S A;  2X3W D;  1VIF A;  2X9H A;  1G3Y A;  5C6S A;  1U1T A;  4EMK C;  2LQK A;  1AD5 A;  1D1B A;  4EMK B;  1D1A A;  2GFU A;  1Y71 A;  2WAC A;  3CCE A;  4KBM B;  1WNL A;  2QQ9 A;  8AT1 B;  2FVU A;  3PIP A;  2DMO A;  2KE9 A;  3RIR A;  4P5N A;  1KQS S;  1TUC A;  2KT8 A;  2LQN A;  4IUQ A;  2Y4Y A;  4BI8 B;  3MP8 A;  3CPW S;  1QVG A;  1M1G A;  5D7U A;  1QVG P;  1VQL T;  1M4Z A;  5D6W A;  2DIG A;  2SRC A;  3GPL A;  3JCM Q;  4CRI A;  3JAM E;  3L2V A;  1Y96 B;  4N4G A;  1IRX A;  1GCQ C;  3PNW C;  3OS2 A;  2QGF B;  2HQX A;  2DVJ A;  2CUB A;  2LC4 A;  3EH2 A;  1B07 A;  1TG0 A;  3G4S A;  2K2V A;  2ECZ A;  4EMK A;  3FRN A;  4N4H A;  2LNH B;  2DLP A;  4X9C A;  1G2B A;  3JCM W;  2CRE A;  3M0P A;  1ZQ1 A;  2RA2 A;  2XID A;  2JN0 A;  1ZSZ B;  4OVA A;  5KYU A;  3CCJ Q;  1GFC A;  2JMA A;  1MV3 A;  1BKB A;  4HA8 A;  1W2B A;  5GAN 3;  4Y28 E;  1RLP C;  4L6V 5;  2HCK A;  2NUT B;  2EFI A;  3CCL Q;  5LJ5 d;  5LJ3 d;  3DLL A;  2LTO A;  3LH0 A;  2KR3 A;  2OJ2 A;  3EG2 A;  4M75 G;  1JB0 E;  1R77 A;  3LGL A;  2RI5 A;  4BY6 C;  4M77 G;  1XNI A;  2V8J A;  5HK3 A;  3JB9 H;  3KUF A;  2EQK A;  5LJ3 g;  1T3S A;  2E70 A;  1KD1 U;  3CCU Q;  1PNJ A;  1AWW A;  1PKT A;  2KRS A;  3M58 A;  2ZAE A;  1K76 A;  3KBG A;  1CKB A;  1WGS A;  3WVE B;  1ZSZ C;  3JB9 G;  3PE0 A;  1BCO A;  1KQS A;  4C5E A;  4II1 A;  1RLQ C;  2EQI A;  2YUQ A;  4M75 E;  5GAM h;  2O4X A;  2VAS A;  3LH5 A;  4WF2 A;  2YLB A;  2HBP A;  1Q82 R;  4BE0 A;  2BUD A;  4E7I A;  1YHQ A;  4XK8 E;  5I21 A;  1NG2 A;  2FEI A;  2XMF A;  1UFF A;  1SHF A;  2NUT A;  3H8Z A;  1YBY A;  4RG8 A;  1VOM A;  4QKU A;  2F2X A;  3NGP A;  4J6Y A;  4C92 G;  2HKN A;  1M2V A;  1N8R C;  3CEY A;  2A08 A;  4Q5W A;  2C0T A;  2NUZ A;  4M75 C;  5HY6 A;  3REB B;  3M55 A;  3M54 A;  3QZ5 B;  5D6X A;  2HSP A;  2LVM A;  3OSS C;  1EZZ B;  5GMK j;  1VYU A;  2BZX A;  1RAH B;  5GAN e;  4NS5 A;  5A0L A;  1P92 A;  2O2O A;  2EPD A;  3OW2 A;  1BU1 A;  2G3R A;  2EYQ A;  3PIO A;  3CBM A;  1M1K R;  2JW4 A;  3TSZ A;  4E7S A;  3BY7 A;  1X43 A;  2D8H A;  4IIM A;  1KD1 C;  2FYK A;  3CCM A;  5A2Q E;  1MNE A;  2BE7 D;  2O4X B;  1X6B A;  2E6N A;  3N5B B;  2VXE A;  1UEC A;  2QA4 T;  1KC8 R;  1TUG B;  2DL7 A;  2KXD A;  1Q82 U;  2JS0 A;  4M75 B;  1PRL C;  2QQA A;  1EFN A;  3X25 B;  2C06 A;  2PU9 B;  1W70 A;  1OX8 A;  5CR2 A;  3HFN A;  3OBY A;  3NTK A;  3QDF A;  1MV0 B;  2F2V A;  2DD5 A;  1NE8 A;  2EGE A;  4VUB A;  2MI6 A;  5LJ5 g;  4X9D A;  2EIF A;  1RAC B;  4OB0 B;  4PJO G;  1QVG S;  1Z9Z A;  5I2S A;  4KUI A;  5J39 A;  2WSC E;  4LD9 K;  4BDY A;  4M77 A;  3L2Q A;  2XG8 D;  4MML A;  1N9R A;  2GQV A;  5FU7 B;  3VUZ A;  1PHT A;  1TU0 B;  3M0S A;  4PFZ A;  2KDS A;  2QI2 A;  3OSV A;  5KCH A;  3L42 A;  1I1J A;  5GAN 5;  5ECA A;  3CBO A;  2M51 A;  3CMA T;  1C1A A;  2YUN A;  2RQV A;  1TXQ A;  1K8A C;  3HRT A;  2O9V A;  2IG0 A;  3SB2 A;  1MND A;  3MKD A;  3A8H B;  2K3X A;  4KT0 E;  2YRC A;  4KUD K;  1VQM T;  1VQM Q;  2RJE A;  2HNI A;  2X3X D;  4ESR A;  1K4U S;  1S1N A;  2CUD A;  1D3B B;  4M77 F;  4AT1 B;  2R5A A;  5GAN g;  5L8R E;  4A4K A;  3E19 A;  4HT8 A;  3OYK A;  4M78 B;  1AT1 B;  1D0Y A;  4KUL A;  1B3Q A;  1GCQ A;  1WQW A;  3CME A;  1YJW A;  4A4E A;  3QPH A;  1K1Z A;  2CSQ A;  4X1V A;  4HCK A;  1T0H A;  2XI9 A;  3SWN C;  3C95 A;  4PJO D;  3EFR A;  1AHJ B;  3E9F A;  4C5I A;  3CXC P;  3I56 Q;  4M78 A;  2JT4 A;  3TQ7 P;  2E3H A;  2YDL A;  2J05 A;  4OMM A;  3C12 A;  2AZV A;  2KRN A;  1SEM A;  2QG9 B;  3QO3 A;  5CAI A;  2DX1 A;  5GAM d;  1XOV A;  2KYB A;  4KH1 B;  4RG2 A;  3G71 A;  3P8H A;  1BYM A;  1N8R R;  5GMK m;  4X34 A;  1ZBX A;  1VQM A;  4M7D D;  5GAN 8;  2QEX A;  1RAD B;  1YI2 T;  2QDY B;  1JBM A;  9ATC B;  5L23 A;  2VUB A;  5KYX A;  3URG A;  2QA4 Q;  3M0T A;  3EGX A;  2LCC A;  3DB3 A;  3CQT A;  4C8Q A;  5LJ3 e;  2DZC A;  1NZ9 A;  3JCM b;  5J26 A;  2P0P A;  1NYG A;  2ZGW A;  2KEA A;  1Q82 C;  2GCX A;  4BUG A;  1WPY A;  4F04 B;  3INZ A;  1AWO A;  4PLI A;  1RI9 A;  2DA9 A;  3M4Y A;  3TEE A;  3RNJ A;  1PWT A;  4ZGJ B;  4C5G A;  2DXU A;  4M7A C;  4CI0 C;  2IVW A;  2V8K A;  1G83 A;  1I07 A;  1Y96 A;  1M1F A;  2R58 A;  3H9N A;  1M90 R;  1CKA A;  1X27 A;  2WSE E;  3X26 B;  2DBM A;  2QYZ A;  4PNO A;  4F7U F;  1TTH B;  1MMD A;  2R57 A;  1J3T A;  2AKL A;  3OYL A;  2VB6 A;  4EMH A;  4J9C A;  2DET A;  2DL5 A;  3H41 A;  4PKC C;  2CT3 A;  3QYH B;  2F2W A;  4LNP A;  4ZN3 A;  3CME T;  2JM8 A;  4C92 A;  1DJ7 B;  4FYX B;  1VQK A;  2ZZD A;  1ABQ A;  1YHQ T;  2A36 A;  3JCM d;  3CCQ T;  2MK5 A;  3X28 B;  4QT7 A;  2YT6 A;  1ZLM A;  2XK0 A;  2PVG B;  5IHK A;  1VQL A;  1QP2 A;  2K7A A;  3ZFJ A;  1VQ8 A;  4PFO A;  3VS1 A;  2EQJ A;  1AZE A;  2E4H A;  2MPX C;  1NM7 A;  3OB9 A;  3SFM A;  2CP7 A;  3QHS A;  5DLO A;  1BB9 A;  1UEB A;  2LCL A;  1D0Z A;  1FMK A;  2DK3 A;  1Y57 A;  2O31 A;  1KK7 A;  2DO3 A;  2QEX Q;  4JZ4 A;  1Q7Y C;  1E7O A;  5IXF A;  3X20 B;  2RJF A;  2M9U A;  2AIR B;  2JS2 A;  3CCU T;  1U06 A;  1V1C A;  3CCV Q;  2MMP A;  2COY A;  1QVF P;  1OZ2 A;  1RL2 A;  1TWB A;  4ZTJ A; 
#chains in the Genus database with same CATH homology
 4IUQ A;  2Y4Y A;  2DTH A;  2A3L A;  4BI8 B;  5GMK e;  1M9S A;  3MP8 A;  4C8Q C;  3GOX A;  3WVD B;  4J7I A;  2E6Z A;  3CPW S;  3RER A;  1QVG A;  2E5Q A;  1M1G A;  3BFM A;  4JDS A;  4OF1 A;  1VQL T;  1GXI E;  1W4S A;  4M7A D;  1M4Z A;  5D6W A;  2DIG A;  5GAM j;  3GPL A;  3RMS A;  3A5Z B;  3M53 A;  3JCM Q;  4CRI A;  4C8Q E;  3JRZ A;  3JAM E;  3L2V A;  2P0Q A;  5GAN j;  5CKF A;  2DEQ A;  2LQ8 A;  4YTL A;  1KC8 U;  1Y96 B;  4N4G A;  3PNW C;  3V7C A;  3OS2 A;  1VQK T;  1RI0 A;  3LYI A;  1K9M C;  3CCL T;  2HQX A;  3UPU A;  2CZ1 B;  2LC4 A;  2MAM A;  2MWP A;  4A4F A;  3OYM A;  3MET A;  4D6W A;  2K2V A;  3G4S A;  4FL6 A;  2DD4 A;  5LJ3 j;  2DXT A;  3NTH A;  2LRQ A;  4EMK A;  1YIJ T;  2CZ6 B;  3FRN A;  4N4H A;  4Y91 A;  1YIT A;  1VQ5 T;  3JCM V;  2PVO B;  2GFA A;  3FLG A;  1MGQ A;  4X9C A;  2DIQ A;  3CCJ T;  3UDC A;  2WSF E;  3SWN B;  3JCM W;  4LDX A;  1LNX A;  1NJI C;  1ZQ1 A;  2RA2 A;  1VIE A;  4IUU A;  3CC4 T;  2XID A;  2X4Y A;  3JCM f;  4F7U A;  2JN0 A;  3GLX A;  4XTV A;  2DAQ A;  5CCA A;  1YJ9 A;  2NLU A;  4OVA A;  5CKB A;  1N8R U;  2OTJ A;  4J8O A;  2HD0 A;  3JCM P;  1BKB A;  5CK9 A;  5GAN d;  3EAE A;  1YIJ A;  4HA8 A;  3ZEH A;  3TU4 K;  4ZTF A;  1W2B A;  3P8B B;  5GAN 3;  3FC3 A;  4Y28 E;  1I4K 1;  1VQ9 A;  3G4S T;  4M7A A;  4L6V 5;  3OYE A;  4ELZ C;  3MP6 A;  3GP8 A;  3FIF A;  3FEO A;  2EFI A;  5GMK h;  2RD1 A;  5LL6 S;  2LNV A;  2H3J A;  2QXF A;  4J7F A;  5LJ3 d;  2KMT A;  5LJ5 d;  5GAN f;  2O01 E;  3DLL A;  3CXC S;  2LTO A;  1XQH A;  3LH0 A;  2I2L A;  1QVF A;  4M75 G;  2HAX A;  4OMF B;  2RO0 A;  5CIU A;  5GAO m;  1YJW T;  1JB0 E;  3BDU A;  3LGL A;  1Q86 U;  2K5I A;  2RI5 A;  3G6E T;  3H6Z A;  4KUD K;  1VQP A;  1OYX A;  4BY6 C;  2L5Q A;  3JCM e;  4M77 G;  1BIA A;  1Y7X A;  1XNI A;  2V8J A;  5HK3 A;  3JB9 H;  3KUF A;  1YIT T;  3VUB A;  3S3N A;  4C92 E;  1BIB A;  2EQK A;  2RJD A;  5LJ5 e;  4MZM A;  2AHJ B;  4QQG A;  5LJ3 g;  3CCV T;  1UGP B;  3QSU A;  2E70 A;  1VQN A;  3GNG A;  2RH2 A;  3CCU A;  4PJO F;  3J80 E;  3OS1 A;  1VQO T;  5GAO r;  1WJQ A;  3JB9 I;  1KD1 U;  4M7D B;  5C0M A;  4PLL A;  2PVD B;  4XU2 A;  3M58 A;  1N27 A;  4F7U E;  4ZGD B;  3KBG A;  1UB4 A;  4A54 A;  2QEX T;  2Y4X A;  1WGS A;  1VQ9 T;  3WVE B;  5CKD A;  1KG1 A;  2OTL A;  4DOV A;  3JB9 G;  3OA6 A;  3AHU A;  3E9G A;  3QII A;  3VU3 C;  3EFS A;  3RES A;  1KQS A;  3S6W A;  1G3S A;  3CPF A;  4C5E A;  4M77 E;  4II1 A;  4M7A E;  1YCY A;  1H64 1;  3QJY A;  4N0A C;  3A8M B;  4M7D C;  3PMT A;  1VQ8 T;  4M75 E;  5GAM h;  2X4J A;  2XDP A;  2O4X A;  2E12 A;  2KK4 A;  3V7R A;  5DM7 R;  2D0Q B;  2RI3 A;  1YJN T;  1VQ7 A;  4LDY A;  4WF2 A;  2DVE A;  1V29 B;  2YLB A;  3MP1 A;  2HBP A;  4O5V A;  4BI3 A;  2R5M A;  3X24 B;  4BE0 A;  2BUD A;  2VYT A;  2ZPG B;  3HL8 A;  2B8A A;  4NL2 A;  3SD4 A;  5CO7 A;  4ZN1 A;  4E7I A;  3NFC A;  3OYD A;  1YHQ A;  4BY6 B;  2RHI A;  4GLK A;  5LJ3 h;  3VJP A;  4E7H A;  1M1K U;  4XK8 E;  5I21 A;  4MDX A;  4IKF A;  2ZCF B;  1FXX A;  4XU1 A;  2DZ9 A;  4XTY A;  4FSX A;  5CKE A;  4LDV A;  3H8Z A;  1O9S A;  3C4S A;  3MHX A;  1YBY A;  4NOY A;  4RG8 A;  4EMG A;  4ATO A;  3L2W A;  3FDR A;  2HQE A;  5FRM A;  4N4I A;  3VYH B;  2K5L A;  3T9N A;  3OY9 A;  4LDW A;  4J6Y A;  1WJS A;  4C92 G;  1N8R C;  3I56 A;  3CEY A;  3M59 A;  4M78 G;  2M16 A;  4E7J A;  2CZ7 B;  4BB7 A;  4PJO C;  3HKS A;  4HT9 A;  4Q5W A;  2JTM A;  3MEU A;  4M75 C;  3FJP A;  5HY6 A;  1FX7 A;  2XU8 A;  4HCC A;  4J6X A;  3OYG A;  3LLR A;  3ER0 A;  3MEW A;  4DOW A;  3M55 A;  2D9T A;  3L2Z A;  5GAN 7;  3M54 A;  3QZ5 B;  5D6X A;  3OW2 S;  2LVM A;  3OSS C;  4M77 C;  4A4H A;  4B9W A;  1Q7Y U;  4A53 A;  1W2B S;  5GMK j;  1BI3 A;  5GAN h;  5GMK l;  1K73 C;  1KHC A;  3J7A F;  5GAN e;  3CCE T;  1NJI U;  1N6A A;  4NS5 A;  5A0L A;  1P92 A;  2KVQ G;  2D6F A;  5A0D A;  3OW2 A;  4C92 B;  1IRE B;  4EPC A;  2G3R A;  4JUV A;  2EYQ A;  3CCV A;  1LJO A;  1K73 U;  3PIO A;  2KQW A;  3CBM A;  1UGQ B;  4C92 C;  5A0G A;  4J83 A;  2VGM A;  2RM4 A;  3LWH A;  3BY7 A;  2P0K A;  4C0G A;  2RHZ A;  1KD1 C;  2JVV A;  2FYK A;  3CCM A;  5KE2 A;  2RK1 A;  3HHT B;  3OYC A;  5A2Q E;  2RJC A;  5D6Y A;  4QVD A;  1VQP T;  2VV5 A;  1QW1 A;  2O4X B;  3DKM A;  4OB3 B;  4QQD A;  3G6E A;  1K9M U;  4M7D G;  3PFS A;  3OYF A;  2E6N A;  1X75 C;  1S72 A;  1M8V A;  3N5B B;  2VXE A;  5EG2 A;  3CCQ A;  4JS4 A;  2QA4 T;  5I2M A;  1QVP A;  2YHT A;  2K5F A;  3A8G B;  4R56 A;  4C0D C;  5FU7 C;  3CCS T;  2X35 A;  4PJO B;  4FT4 A;  3V8J A;  4C8Q B;  4M75 D;  1JJ2 A;  5FRN A;  2E65 A;  4BE2 A;  1Q82 U;  3LGF A;  4M75 B;  4OB1 B;  5GAO l;  2QQA A;  4M75 F;  3L2R A;  3X25 B;  4BAC A;  2C06 A;  3LWI A;  2JNG A;  2PU9 B;  4GY5 A;  4BE1 A;  3QDR B;  4JLI A;  3G71 T;  3TRE A;  5CR2 A;  1U8R A;  1JRI A;  3M4G A;  3V8L A;  3HFN A;  3OBY A;  3NTK A;  2XDD A;  4L59 A;  4QVC A;  2L8D A;  1B34 B;  1VQ6 A;  2EKO A;  2KSS A;  2DD5 A;  3OMG A;  1NE8 A;  2MI6 A;  3QZ9 B;  4VUB A;  3OYJ A;  5LJ5 g;  4X9D A;  2ZPH B;  1G5V A;  1HXD A;  2EIF A;  4LD6 A;  4M78 C;  4C0F A;  4Z02 A;  4OB0 B;  4UC4 A;  3QXE B;  4PJO G;  3PT9 A;  3R6O A;  2BIV A;  3L1A A;  2DPP B;  3VYG A;  1QVG S;  1SSF A;  4XTX A;  5GAO p;  3JCM g;  4PJO E;  2PQW A;  3V7S A;  3M57 A;  1Q86 C;  3RKY A;  5I2S A;  4KUI A;  5J39 A;  2VXF A;  3M9Q A;  2WSC E;  3I56 T;  4BDY A;  2F69 A;  4M77 A;  5GAN 4;  3L2Q A;  4LD9 K;  3CC7 T;  2XG8 D;  3GF5 A;  2QQB A;  4MML A;  3CCR T;  1N9R A;  2GQV A;  5FU7 B;  3CC2 T;  2DXC A;  2JTF A;  3VUZ A;  3CC2 A;  4M75 A;  2EJF A;  2KDS A;  2QI2 A;  5GAO n;  3CCR A;  3OSV A;  3QBY A;  3L42 A;  5KCH A;  3S3M A;  1KQ2 A;  5GAN 5;  5GMK i;  1X6O A;  4JS5 A;  3JCM h;  4TVR A;  3UT1 A;  2RHX A;  4M7A B;  3CBO A;  3OYY A;  2V8I A;  3OYH A;  3RKX A;  4HCB A;  3CD6 T;  3CMA T;  2JOY A;  5CQY A;  2VC8 A;  4OGC A;  1XTD A;  3M56 A;  4C5H A;  1K8A C;  1NPP A;  2X4W A;  3HRT A;  3M5A A;  1VQ6 T;  4IUP A;  2IG0 A;  4MZT A;  3SB2 A;  5DY9 A;  1HK9 A;  2RI2 A;  4RCB A;  3BW1 A;  4M7D E;  4M78 E;  3A8H B;  4BI4 A;  3MEV A;  4XQ3 A;  1YI2 A;  3PTA A;  2K3X A;  4KT0 E;  3PGG A;  5IN1 A;  2CGH A;  4FT2 A;  1PSE A;  4M78 D;  1VQM T;  4ZGE B;  2F5K A;  1OZ3 A;  2RJE A;  2HNI A;  2XIC A;  5LJ5 h;  1G3W A;  4IUV A;  4LDU A;  3OBW A;  4M77 D;  4C92 F;  2M1H A;  4OB2 B;  4PL6 A;  4M77 B;  1G3T A;  1M5Q 1;  5GAN 2;  1D3B B;  1U1S A;  4M77 F;  1UGR B;  3CCS A;  2R5A A;  3OS5 A;  5GAN g;  4R55 A;  5L8R E;  4A4K A;  4NL3 A;  1UGS B;  3JCM J;  2DXB A;  2DKG A;  3E19 A;  1S72 T;  2M0O A;  1B34 A;  1VUB A;  4HT8 A;  5CVI A;  1M90 C;  2ZPB B;  1LOJ A;  5FLX E;  3OYK A;  4JJN K;  4OGE A;  5CKH A;  2K3Y A;  3P8D A;  4M78 B;  4QW2 A;  5J3B A;  3S3O A;  2EWN A;  1VQ4 A;  1Q81 C;  1ZHI A;  1WQ7 A;  4KUL A;  2OAU A;  1KHI A;  1WQW A;  2KY9 A;  2ZPE B;  4DQ2 A;  4MMK A;  3CME A;  4A4E A;  1YJW A;  4BD3 A;  3QPH A;  5FU6 B;  5GAO q;  3V8K A;  2XI9 A;  4N0A A;  1BI1 A;  3SWN C;  3C95 A;  3G7Z A;  4PJO D;  2F5T X;  2RK2 A;  3EFR A;  1AHJ B;  3E9F A;  3SDZ A;  4C5I A;  3RMQ A;  2A7Y A;  3GIB A;  4C8Q D;  2MWO A;  4F7U G;  4M78 A;  3JSC A;  4DA4 A;  3ME9 A;  3BDL A;  1VQ4 T;  1FWZ A;  3HSB A;  4E7L A;  4F7U B;  2Y90 A;  3OMC A;  2EQM A;  2MF2 A;  2OTJ T;  3HFO A;  5LJ5 f;  3JB9 D;  5LJ3 f;  3C12 A;  3LW5 E;  4HCZ A;  2X4X A;  1YJ9 T;  2EJ9 A;  2LDM A;  1TH7 A;  4ELY C;  3QO3 A;  3UWN A;  5CAI A;  2DTI A;  3L2U A;  3TCJ A;  1XOV A;  4IUT A;  5GAM d;  4EDU A;  1WJR A;  4M78 F;  4RG2 A;  4FIB A;  4JRP A;  1X01 A;  3G71 A;  2E64 A;  3P8H A;  2DTO A;  1VQ5 A;  1R8O B;  1BI0 A;  3DB4 A;  2L89 A;  4XU0 A;  5IT9 E;  1OI1 A;  1BYM A;  3CPW A;  2LX9 A;  5GMK m;  4X34 A;  1ZBX A;  4XU3 A;  1VQM A;  4B9X A;  3MCA B;  1I81 A;  2OTL T;  4M7D D;  1H3Z A;  5GAN 8;  4M7A G;  3FB9 A;  4FU6 A;  2QEX A;  3A8L B;  1YI2 T;  3CD6 A;  5KH6 A;  2FHD A;  2QDY B;  1JBM A;  5KCO A;  2L3R A;  3I55 A;  2K4Y A;  2DJZ A;  1K8A U;  2VUB A;  3Q1J A;  5GAN 6;  5DLQ E;  3URG A;  2QA4 A;  4PJO A;  2CKK A;  2E10 A;  2LCC A;  3DB3 A;  5HKC A;  4C8Q A;  3QJ6 A;  1MHN A;  5LJ3 e;  2DZC A;  1NZ9 A;  2FL7 A;  4JLG A;  1N9S A;  3JCM b;  5J26 A;  2P0P A;  2P4T A;  2ZGW A;  3WXM B;  4JRI A;  1Q82 C;  3OS0 A;  2GCX A;  2ZPF B;  5IAY A;  3CCM T;  3CMA A;  2E41 A;  4BUG A;  3QYG B;  1WPY A;  3C94 A;  3HRU A;  3OYB A;  2QTX A;  3INZ A;  3VKI A;  3JB9 F;  4PLI A;  2FB7 A;  2PUO B;  2LT1 A;  3VV0 A;  3I55 T;  2E1H A;  4XTW A;  3M4Y A;  1M90 U;  3J81 E;  3JB9 J;  3TEE A;  4C92 D;  4XTU A;  4ZGJ B;  5M9O A;  3MO8 A;  3ASK A;  3HPW A;  2EJG A;  4C5G A;  3F70 A;  2KAF A;  3OQ5 A;  4HKE A;  2JZ2 A;  4MZP A;  2DXU A;  4M7A C;  3O8V A;  4CI0 C;  3HRS A;  2IVW A;  3OYA A;  2V8K A;  2XKO C;  4E47 A;  3E1S A;  3JCM c;  5CQX A;  4XAX B;  1Y96 A;  1VQO A;  4M7D A;  2LT4 A;  1M1F A;  2RB6 A;  1VQN T;  2R58 A;  3RKW A;  4L5G A;  2WSE E;  3X26 B;  1KQ1 A;  4RKU E;  2EAY A;  4E7K A;  2CYZ B;  1Q81 U;  3QG1 A;  1KC8 C;  1M1K C;  4IUR A;  4FM4 B;  4PNO A;  4F7U F;  5FRO A;  2QQS A;  2JUF A;  2R57 A;  3SWN A;  3QKJ A;  3OYL A;  4V2S A;  3OYN A;  3OYI A;  4EMH A;  3PMI A;  3CCJ A;  4C8Q F;  4PKC C;  1O75 A;  1EIF A;  4OP0 A;  3QYH B;  5FU6 C;  1QP3 A;  2RHU A;  3CBP A;  3QUI A;  4J5Y A;  5KE3 A;  3CC7 A;  2CS7 A;  3MEA A;  5GAM f;  4ZN3 A;  4BDZ A;  3LX7 A;  2GF7 A;  2K57 A;  3KXT A;  3CME T;  3CCL A;  4J6W A;  1DJ7 B;  4C92 A;  1VQK A;  2ZZD A;  4QVZ A;  2BKD N;  4ME7 A;  1YHQ T;  1BI2 A;  4JRQ A;  3CCQ T;  3JCM d;  3X28 B;  1I8F A;  3CXC A;  1IZ6 A;  5HK0 A;  4RMO A;  1QVF S;  2YRV A;  1NPR A;  2YLC A;  2XK0 A;  4O6J A;  4M7A F;  2PVG B;  3GNF B;  1VQL A;  1QP2 A;  4JRK A;  4RCC A;  3ZFJ A;  3ZBD A;  3NTI A;  1VQ7 T;  4C8Q G;  1YJN A;  3HP9 A;  4C0D B;  3CC4 A;  1VQ8 A;  2CZ0 B;  5AYF A;  4C0Z A;  1I5L A;  2EQJ A;  1D3B A;  1VIF A;  3OB9 A;  3SFM A;  5C6S A;  1G3Y A;  1U1T A;  3QHS A;  5DLO A;  1JJ2 S;  1UEB A;  4EMK C;  2LCL A;  2VGN A;  1PSF A;  2DK3 A;  2LQK A;  3RUX A;  4M7D F;  2RHY A;  4EMK B;  3DLM A;  2QQR A;  1Y07 A;  2GFU A;  2DO3 A;  1Y71 A;  2WAC A;  3A8O B;  4A4G A;  2ZPI B;  1Q7Y C;  2XD0 A;  5GAM e;  5GAM g;  3X20 B;  2RJF A;  2M9U A;  5LJ5 j;  3CCE A;  4KBM B;  1WNL A;  3CCU T;  2XHC A;  2PUK B;  2QQ9 A;  4MDW A;  2FVU A;  4XTZ A;  3PIP A;  2XDB A;  2MMP A;  3RIR A;  4QQ6 A;  3JCM X;  4P5N A;  1KQS S;  1OZ2 A;  1RL2 A;  2EQU A;  4ZTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...