2RI3A

Crystal structure of the 3-mbt repeats from human l3mbtl1 with n358q point mutation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
315
structure length
313
Chain Sequence
b'SWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMQPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
molecule tags Transcription
source organism Homo sapiens
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
total genus 75
structure length 313
sequence length 315
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A03
3MP1A 4QQ6A 3BDLA 3UWNA 2QQSA 3LGLA 4C5IA 2DIQA 3GOXA 2BUDA 4BDZA 2RO0A 3E9FA 3QKJA 3QBYA 3LX7A 3OY9A 5J26A 4L59A 4BACA 4RG2A 5M9OA 3KUFA 4IUTA 1RI0A 3OYHA 5KCHA 1KHCA 2RJEA 2QQRA 2RHUA 2X4WA 2GF7A 4IUUA 3OYLA 2JTFA 2RI5A 2YRVA 3OYNA 2PQWA 2DIGA 3MP8A 4CRIA 1N27A 4E7JA 4BDYA 1H3ZA 1G5VA 2P0KA 2EKOA 2EQJA 4C5EA 5IAYA 3E9GA 1WJQA 2R5MA 2F5KA 2GFAA 3OYMA 2RHZA 4N4GA 4II1A 3DB4A 2E5QA 5D6WA 3OYBA 4B9WA 5FROA 4PL6A 2WACA 2RI2A 3OA6A 2VYTA 3QIIA 4OVAA 2EFIA 2X35A 1SSFA 3OYKA 2K3YA 4QQDA 2L8DA 5D6YA 2D9TA 3OYFA 4GY5A 4BE0A 5FRNA 4N4IA 3H8ZA 2NLUA 4ZTJA 3H6ZA 2EQMA 3DB3A 1WJSA 3S3NA 3EAEA 3OYCA 3M9QA 3CEYA 3OB9A 4A4EA 2LRQA 3FDRA 4BE1A 3S3OA 3ZEHA 2RHXA 3LH0A 2R57A 4A4GA 5KE3A 3FEOA 5KH6A 1XNIA 3L2VA 3MEUA 4EDUA 4LD6A 2CKKA 4IUVA 3OS0A 5KE2A 2XDPA 3OYAA 2FHDA 5J39A 3PMIA 3O8VA 3OYIA 1OYXA 2HQXA 3PNWC 2O4XB 4FU6A 4E7KA 2RJDA 2LVMA 3OYDA 4C5GA 2X4XA 3LLRA 4Q5WA 2EQUA 2R58A 2RJFA 2XK0A 2HQEA 4NS5A 3MP6A 2L89A 2X4YA 4QQGA 3DLMA 1WGSA 4B9XA 3NTKA 1WJRA 2M16A 2BKDN 3FLGA 3ME9A 3OS1A 3L2RA 5C0MA 2L3RA 2E6NA 3FC3A 2EQKA 2RI3A 4BE2A 2RJCA 2RHIA 2IG0A 3PFSA 2MWPA 4Z02A 2LDMA 3OMCA 3P8DA 4C5HA 2LTOA 4N4HA 3P8HA 2B8AA 4E7LA 3ASKA 3UT1A 3OS2A 2BIVA 3MO8A 2RHYA 5D6XA 1OZ3A 4A4HA 3C4SA 5IN1A 4E7HA 3OYJA 3OQ5A 3F70A 1OI1A 2DAQA 4QW2A 3S3MA 4IKFA 5CIUA 2O4XA 3L2UA 3L2WA 2GFUA 4UC4A 4IUPA 2R5AA 3L42A 3PMTA 4FL6A 3OMGA 4BD3A 2JZ2A 2LCCA 4E7IA 2K3XA 4PLLA 3META 3QJ6A 3OYGA 4HCZA 3NTHA 1OZ2A 3S6WA 4ZTFA 2M1HA 5C6SA 2G3RA 1MHNA 3MEWA 3MEVA 3NTIA 4QVZA 3SD4A 3OYEA 3L2QA 5FRMA 4PLIA 2MWOA 3MEAA 3Q1JA 3LYIA 4X34A 4A4FA 2M0OA 5KCOA 4IURA 4IUQA 3LGFA
chains in the Genus database with same CATH superfamily
3M0RA 2ROLA 1JQQA 4OMLA 3CCQT 4FCYA 4CC2A 2QQRA 2JTFA 2PQWA 4PJMA 5LJ3e 4CRIA 1NEBA 1I1JA 1KQSP 1JXMA 2BZ8A 3GP8A 1ZUKA 4C92G 1LJOA 2E5QA 4RTYA 2O9SA 1K9MU 1UEBA 1Y96A 1OPLA 1YI2A 4BE0A 3L1AA 3M0SA 1Y07A 2A7YA 2CP3A 2NLUA 4XAXB 5FU6C 3RUXA 1QQJA 3OB9A 3JB9I 4LUDA 2OTLA 2MI6A 3CCLT 5GJWB 2VC8A 4DBQA 3G71A 4EDUA 2E3HA 3WXMB 1IB8A 2HBPA 3RNJA 4QT7A 3RKXA 1UHCA 3J81E 3E19A 1UTIA 2KXDA 4C8QG 2CDTA 4C0ZA 2J6KA 4MMLA 3A8OB 4KRTA 2HQEA 2DLPA 2DEUA 1D1AA 5GAN2 7AT1B 2VV5A 3VS1A 4J6WA 3I56Q 3CCJA 2OAUA 3CCQQ 5GAMf 1WA7A 1OZ3A 3HHTB 4AFUC 1KC8U 2DL8A 2DXCA 1SSHA 1QVPA 4FL6A 2C06A 2Z0WA 4BD3A 2JZ2A 4OGCA 1GFCA 1Z9QA 1EZZB 4JDSA 4ZTFA 2HSPA 3OYEA 3HRUA 5IHIA 1CKBA 3CCUT 1B34B 5IT9E 1M1FA 2BZYA 4IURA 5I21A 1UJ0A 1VA7A 1X27A 2NUTB 3E2UA 3M4YA 1D0XA 3JCMg 2EPDA 4M75F 4ME7A 1VQLT 5I11A 1YHQT 1QVGS 2KEAA 2YWWA 2A36A 2F5KA 4N4GA 4XTXA 1X69A 3OYBA 2P4TA 2HNIA 2BTTA 4BI3A 4F7UE 2DRMA 1BYMA 1TXQA 1I8FA 1QLYA 3HSBA 3TEEA 1YHQA 1VQ4A 5GMKl 1UUEA 1ARKA 2DTOA 3S3NA 1BB9A 2DYIA 5KYYA 5AYFA 4C92B 2I2LA 4M7AF 1K9MC 2CKKA 1IZ6A 1SHGA 4J9BA 4J9HA 3M59A 5AT1B 1X01A 1ZUYA 3EG9A 2BE7D 1KSWA 2G6FX 2YUOA 2RK2A 2DNUA 2CUBA 1HJDA 2VWFA 2DXUA 2V8JA 2DA9A 5GAOr 3DLMA 2QA4Q 4PJLA 2BKDN 2DTIA 3OSSC 1QVGA 3FC3A 2CP2A 4BE2A 4FW1A 4F7UA 2MWPA 1M30A 2DJZA 2YT6A 2M51A 3JB9G 1U06A 2LTOA 3ASKA 1Q95G 3MO8A 1RABB 3CCRQ 3CCEQ 3SDZA 4EMHA 1ZSGA 3EFOA 4JPBW 4E7ZA 4M77F 1TH7A 4R56A 4F16A 2DO3A 2LC4A 3NTHA 2XICA 1H92A 1VQNQ 4OGEA 3T9NA 3MEVA 3CC2T 5LJ5g 4ZGEB 3MEAA 3CCST 2K4YA 1YHQQ 2QQSA 4C0DB 2J7IA 2HBWA 3TREA 4FM4B 2FPEA 1OULA 2PVGB 4NL3A 2KROA 3MP8A 1CKAA 2JTEA 2CYZB 1Q7YU 4J6YA 3QPHA 2DKGA 4MDWA 1Q81R 4KGXB 5LJ3g 4PKCC 1ZSZA 5IH2A 2HSEB 2CP0A 2LP5A 1WFWA 1KC8R 3JCMX 4HVVA 2QEXT 2F69A 4AT1B 1VQMQ 3CCMQ 1U8RA 2JM9A 2DRKA 3H6ZA 3HP9A 3I5RA 3M9QA 3FDRA 3MHXA 4GLKA 1VQ9A 1FMWA 2GQVA 2ATCB 3JCMh 4LDXA 3L2VA 2CS7A 1QVFP 5HY6A 2LT4A 2COWA 1Z9ZA 3CC4Q 2O4XB 5GAMe 2LVMA 5LJ5f 2PU9B 4C8QF 4TVRA 1B3QA 3H0HA 5I2SA 5LJ3d 2IIMA 1ABOA 2YDLA 1V29B 3FLGA 1KQ1A 2RI3A 1UECA 2MF2A 2QAZA 4ZN3A 2LX9A 4N0AA 4E7LA 2K79A 4HA8A 4EPCA 3R6OA 2RHYA 2YHTA 2YUNA 2DAQA 2PVOB 4M4ZA 5LJ5h 3D7SB 1ZA2B 3FB9A 4F14A 4OF1A 8ATCB 2ZPFB 4MDXA 3HL8A 4HCZA 1H8KA 4RCBA 5D7UA 1VYTA 1MHNA 3GBQA 4NOYA 2XG8D 1ZA1B 3BY7A 1VQ4Q 2VXEA 2DIQA 2KNBB 1GL5A 3OY9A 1MMAA 3ER0A 4FSXA 4DBFA 5GAMj 5I22A 3EGUA 2XHCA 1UFFA 4IUTA 1M2OA 1JO8A 1Q82U 3EGDA 2IPOB 1P92A 1VQLQ 3EG3A 2DFUA 1V1CA 4ELYC 3E9GA 4M77C 1RADB 3M57A 2DVJA 1WIEA 2K5IA 5ECAA 4PFOA 4N0AC 3CXCP 2V26A 1VQMA 3QIIA 2PUKB 4OMMA 4OVAA 3CCUA 1O9SA 2RMOA 1NG2A 5A0LA 5FRNA 4M7AE 5FWCA 1MV0B 2EAYA 3VS4A 1H3HA 4M77D 4JLIA 3V7SA 4A4GA 3TSWA 1WXBA 3CPWA 1AHJB 2OTLQ 1SRMA 2DETA 2MK5A 4J9CA 5A2QE 1ABQA 5CKEA 1KD1C 1X2KA 4LE9A 3JSCA 2R58A 2EYQA 2KQWA 2SRCA 4B9XA 1WGSA 1OQKA 1C1AA 2L5QA 1VQKQ 2HEQA 3L2RA 1K8AU 1E7OA 5LJ5d 4RMOA 3GF5A 1VQNT 2DD4A 1G8XA 2HKNA 3VS7A 5D6XA 1G3TA 4E7HA 1TWBA 4PJOC 1M3CA 2M02A 3QXEB 1PRMC 3SEMA 1NM7A 1UJYA 2RPNA 1YJ9Q 3HFNA 4FYWB 1TUCA 4DQ2A 1MNEA 3CCEA 1T0JA 2QI2A 5DLOA 1WQWA 1WYXA 4M75C 3JCMV 4X34A 1FWZA 4IKFA 4PJOD 2MIOA 1YNZA 4LDVA 5GAN7 5KYYB 3QKJA 1M9SA 1M8VA 3OYHA 3FRNA 4BY6C 2QXFA 4KBMB 2ECZA 5FU6B 1X75C 4A54A 3R6NA 5CKBA 2K57A 1UGQB 2RM4A 1IREB 4M75D 3QZ5B 1R8OB 4M7AB 3V8JA 5GANe 2EQJA 2KRMA 1X6OA 1K1ZA 2P0PA 1Q82C 1AT1B 4J9GA 2M0YA 4P5NA 4XTVA 5A0GA 2R5MA 5CQYA 5D6WA 5I2MA 2GTJA 4ESRA 2ABLA 2RI2A 2E70A 1AD5A 1N9RA 4PJOF 3OYKA 2C0IA 5D6YA 1YFNA 4M78G 2RQVA 3EAEA 3QDFA 3CCSQ 1WDXA 1H641 2CREA 5GAN6 1VQ7T 1M1KR 4FT4A 4OMOA 2DERA 2NUZA 1KJWA 4FYYB 4IUVA 2XDPA 5LJ3h 4BI8B 3HKSA 1UB4A 4CI0C 3RESA 2FG0A 1OX9A 1K8AR 4M75A 1UGVA 2E6ZA 2L89A 2RD1A 3EG1A 3CQTA 1VQMT 1RAGB 4E2FB 5GANj 3X25B 1QMCA 2IG0A 2EBPA 1X43A 2LX7A 1VQ9T 2LDMA 3VYHB 1T3SA 4M78A 4HCKA 5IXFA 1PSEA 2EW3A 1VYUA 4XTZA 3L2UA 1W2BA 4JS4A 2EJ9A 1UE9A 1YJWT 2DVEA 2O2OA 2KT1A 3QYHB 1M90C 3VS0A 4M75B 1R77A 5EG2A 4E6RA 2VKNA 3S6WA 2F5TX 1I5LA 3CCLA 4QVZA 3L2QA 1PNJA 3G4ST 3KFVA 4F17A 1JU5C 3JCMb 1Q86C 4IUQA 3LGFA 3TU4K 3EH2A 1BCOA 1VIEA 1AOJA 1QKXA 2RA2A 1QVFA 4BACA 1QW1A 1RI0A 2RHUA 4C8QE 4IUUA 1WXUA 2QGGA 1YITT 3CCET 1K8AC 1JJ2S 3OW2S 1LCKA 2QDLA 4GBQA 2KI7A 1TOVA 4LXCA 2H3EB 5KYWA 3HFOA 1K9MR 1GBRA 1KD1U 4II1A 1YP5A 1QWFA 3PTAA 1YCYA 1XTDA 5HKCA 3I5SA 1UDLA 2EFIA 4PJOA 2CT4A 4M77A 3EGDB 4N4IA 1VUBA 2AKKA 1IHVA 3EG2A 2CZ1B 2YSQA 1G2BA 2LRQA 3ZEHA 3LH0A 5GANg 2RNAA 1JRIA 1M90U 2FYKA 5KE3A 2DPPB 1TSFA 2XMFA 4C92C 4JJBA 4JRPA 1EFNA 2DZ9A 2FHDA 2I0NA 1NLPC 2D0QB 4GLMA 4FU6A 2K9GA 3UATA 4M77B 2EQUA 2RJFA 5CKDA 1FX7A 1WXTA 3NPFA 2H8HA 2E6NA 2CT3A 2HD0A 1PRLC 3CCJT 2KR3A 4N4HA 4FYXB 3C4SA 5IN1A 4R55A 5CKHA 2P4RA 4Y28E 1AWOA 2HMAA 2DJQA 2LCLA 2JJ9A 2X3XD 1YCSB 2G3RA 1PHTA 2NUTA 1YITA 1UGRB 3Q1JA 3GNFB 5KCOA 2X9HA 4QQ6A 2HDAA 4C8QD 4BDZA 2DMOA 2CH4A 1Q86U 1E6HA 4PNOA 2RF0A 2E10A 1VQPT 4KULA 1GFDA 3KBGA 1WNLA 1BKBA 4XTUA 3JRZA 4EMGA 4PJOE 2A28A 1NLOC 2FEIA 2FPFA 3VRZA 4HKEA 2QGFB 2XD0A 4RTWA 4YTLA 3H0IA 2EYXA 1OU9A 4XU1A 2D9TA 3ZL7C 2HKQB 3CPWP 3OS5A 3PE0A 4A4EA 2K7AA 2ESWA 4JJDA 3RR6A 3CC7Q 2VUBA 3V8KA 1VQ5Q 2AK5A 2F1LA 5KH6A 4M7DA 5GMKm 3JCMJ 5HK0A 1WLPB 3QG1A 4R0KA 5KE2A 3RERA 3A8GB 3LH5A 3O8VA 3OYIA 1QP2A 1YJNA 2XDDA 1ZSZB 3CD6A 4JJCA 2X4YA 4M7DG 3V8LA 2CZ6B 1AWXA 4M7AC 4IIOA 3JCMc 2L3RA 5GANd 5GAN8 2LNHB 4J7IA 1GBQA 2J05A 2MYSA 4XU2A 3F70A 2LQ8A 2JS2A 5CIUA 1ZBJA 4X9CA 2OI3A 2Y4YA 4M7AD 5HK3A 2EYYA 1VQ7Q 4HXJA 1K0XA 4XTYA 1QCNA 5FW9A 1R0CB 2M9UA 4O6JA 4OB1B 4PLIA 2YRCA 5DM7R 1NJIC 3M56A 3CC2Q 3O5ZA 3BDLA 1B34A 3GPLA 1VQ5A 1TG0A 2ED0A 2CP5A 2E5KA 2RO0A 3CCLQ 1QVGP 2DXBA 4F04B 3V7RA 6AT1B 2AKLA 1ZBXA 3GLXA 2QA4T 5KCHA 1JJ2A 3OYNA 3OW2A 1YIJT 1R0BG 3CC4A 1RI9A 2QYZA 1MMDA 1M1KC 1AWJA 2P0KA 2PVDB 1BIAA 2V8IA 2FPDA 3M58A 1QCFA 3JCMe 5CAIA 1MNDA 2DBKA 3G71Q 2V1RA 3I55T 2DXTA 3DB4A 1WPYA 3TQ7P 2EJFA 2QQBA 1SG5A 2OTJQ 5GMKj 3FJPA 2K5LA 1SSFA 3G4SA 4L6V5 1YI2T 2AHJB 2RQRA 1NYGA 2MCNA 3OYFA 1IGQA 3CCUQ 4EMKB 4ELZC 2FZGB 3RBBB 2EGEA 1AZGB 4LDWA 2JN0A 3RKYA 2JMCA 1XQHA 2DK3A 5CVIA 4ATOA 1YITQ 2LJ1A 1IO6A 4E7KA 3BDUA 3CCMA 3FIFA 1HYOA 3TVTA 3LLRA 3N5BB 1OU8A 2DF6A 3VU3C 3EFOB 4Y92A 4M7DF 2ZPBB 3OBWA 2D1XA 3CMAT 2KDSA 2V1QA 1SPKA 2LQKA 3M4GA 4ANJA 3VKIA 1W6XA 1EIFA 1RL2A 1S72Q 4A4HA 3EFRA 3OYJA 4QW2A 3CCMT 3M0PA 2E3IA 1VQ8Q 2R5AA 1RAEB 3JCMf 3L42A 5LJ5e 1VQ7A 1Y0MA 5LJ3j 3HTRA 4M7DB 2RB6A 2P0QA 1TUGB 4WF2A 1KQ2A 1N8RR 1VYVA 3PT9A 3DKMA 1T0HA 5GAOp 3A8HB 1OEBA 5GAN5 2L3SA 2AT1B 3CPFA 3EGXB 3CBMA 4JUVA 4AFSC 4LDYA 4LUEA 5LL6S 3QBYA 1NPRA 3QWYA 1YIJA 3INZA 2VXFA 3OYLA 1QCOA 5GANh 5CQXA 1M1GA 2E4HA 2A08A 3VS5A 1G5VA 1BU1A 3CXCS 1PC0A 5KYWB 1WI7A 1WJQA 2IVWA 2O31A 5FWBA 3CD6Q 2DEQA 2CH4W 2LCSA 4FYVB 3UA6A 1BCMA 1WHJA 1E6GA 1C0MA 5GANf 2LT1A 2SEMA 4F7UG 2LMJA 1M3AA 3OYCA 3UA7A 3RMSA 1B07A 3I55A 1YWOA 1T3LA 1UG1A 4C0DC 3MCAB 4Y91A 2JTMA 1RLQC 3OS0A 4C8QA 3J80E 3PNWC 2MOXA 4OMNA 2FB7A 4M78B 5CK9A 2KMTA 3HPWA 5HCKA 1VQ5T 3ZFJA 4AG2C 2M16A 5C0MA 2EQKA 1VOMA 4MMKA 1VQNA 3CBOA 3OS2A 2BIVA 1O75A 3I56T 3L2WA 3QSUA 2K3BA 3FJ5A 1ZX6A 1WHMA 4C0FA 4DEXA 4RTVA 5L8RE 2COZA 4JRIA 3PVQA 3M0UA 1IGUA 3AT1B 2W10A 1D1CA 3VS6A 2D8JA 4EMKC 3MP1A 3JCMP 2FZCB 2L2PA 4KH0B 2H3JA 2WSCE 4OP0A 3G71T 1PD1A 2MPXC 1GCQC 2RJEA 2L0AA 1U1SA 2FVUA 2KSSA 5GAOq 2DIGA 2XDBA 1ZLMA 1KQSA 2YLBA 1Y71A 3THKA 2VB6A 1VQKA 3G1JA 3RMQA 1JEGA 2DILA 2GBQA 4CC7A 3C95A 4PL6A 5LJ5j 1JXOA 3MJXA 4Z89A 3QO3A 1U5SA 1W2BS 3JCMW 4DOWA 3G6ET 3TSZA 1M1KU 3EGXA 2VGNA 4ZTJA 3DB3A 4OB0B 1U1TA 3EG9B 2DBMA 2OTJA 4FIBA 2EQIA 3X26B 1AVZC 4JRKA 2QASA 3MEUA 3JCMQ 4A4KA 2DZCA 1X6BA 2D8HA 4X9DA 1YI2Q 3CC7A 1HK9A 1QVFS 1OYXA 3LWIA 1YIJQ 5KYXA 3SFMA 2P84A 4C5GA 3PIOA 1NBEB 2OTJT 5KYNA 2QQAA 1MUZA 3X24B 1C6VX 3CCVT 1PM3A 4KT0E 4KUIA 2KYBA 3OMCA 4XQ3A 1IXDA 2VGMA 3LW5E 3QUIA 1X6GA 2EVRA 4M78D 1VQ6Q 2GFUA 1TTHB 4UC4A 4FW2A 5FLXE 1ZHIA 4C8QC 4OMPA 3OMGA 3UF4A 1S1NA 5GAOm 1N8RC 2AIRB 4M78F 2JS0A 4RTTA 5CKFA 1M5Q1 4A4FA 4XK8E 3I56A 1I07A 4RCCA 4X1VA 3BW1A 3C12A 4J83A 1PG5B 2FRYA 1RLPC 1WX6A 1VQOT 1K73C 5L23A 2GF7A 1ZUUA 3OYYA 4J9EA 5FU7B 2KYMA 1VQ9Q 2F2XA 3EFSA 5KYUA 3BFMA 3EG0A 1WHHA 3REAB 2A37A 3H41A 1KIKA 2GQIA 2KRSA 4B9WA 3A98A 1PSFA 4KGZB 4AG1C 4J8OA 2ZPHB 3NGPA 2WACA 3OA6A 2VYTA 3M5AA 2ZZDA 2X35A 2JVVA 3VUZA 4GY5A 4AFZC 2EIFA 4MZTA 2KRNA 4BE1A 2EKHA 3CBPA 3M55A 3WVEB 1U3OA 1ZSZC 4DEYA 4PJOB 3CD6T 2HL5C 3PGGA 5CR2A 3A5ZB 1VQKT 2X4XA 4Q5WA 2GCXA 3SWNC 4NS5A 3MP6A 4QQGA 3NTKA 1WHLA 1DJ7B 2RQUA 2L3PA 2NWMA 1BIBA 2RHIA 4OMQA 4KH1B 5GAN4 1K73R 2KAFA 4F7UB 4HCCA 1OI1A 3U23A 2YLCA 2XKOC 5FU7C 1NJIR 2CP7A 1S72A 1BI2A 1K4US 2LCCA 3CCRT 4RTUA 1MV3A 1VQ8A 2KK4A 1OOTA 1RAAB 2M1HA 1D1BA 2X51A 3NTIA 1BI1A 1VQPA 4E47A 1LPLA 4MZMA 1G3WA 2RQTA 4M75E 1KFZA 2DTHA 2ZPEB 3L2ZA 1D09B 3UWNA 2BZXA 2MAMA 3GOXA 2DL3A 3A8LB 2CSQA 2NUPA 1KD1R 3LX7A 1N5ZA 3VJPA 3CMAA 1PWTA 2FL7A 4O5VA 2YRVA 1KQSS 4BDYA 2KGTA 1LOJA 4C5EA 4HCBA 1LNXA 3SB2A 3OYMA 3CMET 4Z88A 3OBYA 2CUDA 5GMKe 2J6OA 5DY9A 2LQWA 2DX1A 3SWNA 1BBZA 3G4SQ 1D3BB 2EQMA 2X4JA 1TU0B 2YRDA 3V7CA 3P8BB 3X28B 2HCKA 4C0GA 2XIDA 2YUPA 3I9QA 2KY9A 4HVUA 4DBRA 3JB9J 2YUQA 2X3WD 1Y96B 2CZ7B 3OYDA 3SWNB 4J5YA 2XK0A 3CMAQ 3EH1A 2ZAEA 1WJRA 5DLQE 3G6EQ 3HRSA 1J3TA 3M53A 2E12A 1GRIA 4M7AA 1D0YA 2LJ0A 4M77E 2DL7A 2XU8A 1W70A 4LD9K 3P8HA 2B8AA 3UT1A 4KUDK 5A0DA 4E7SA 3OQ5A 3VV0A 2E64A 4JZ3A 1YJ9T 1SF9A 1Q7YC 2FRWA 2JUFA 3EHQA 2GGRA 4K11A 2O9VA 4M7DC 2QEXQ 1N8RU 2E65A 2JXBA 2W0ZA 3VS3A 4WCIA 1VQ6T 1SHFA 5IHKA 1RAHB 2OAWA 4D6WA 1FYNA 4XU0A 5J26A 4L59A 4M7DD 5M9OA 2RI5A 2KE9A 3CCVQ 1N27A 1GCPA 1H3ZA 2EGCA 2EKOA 3REBB 5IAYA 2ZPIB 2EJGA 4ZGJB 3OSVA 5FROA 4DA4A 1G3SA 2VVKA 3QWXX 1TS9A 2JMAA 1WZOA 1Q82R 2K6DA 1QWEA 3NHNA 2DE0X 1MGQA 3A1PA 2HL3A 2D6FA 4ZNXA 1NPPA 3IQLA 1WJSA 4M78E 3CEYA 3UDCA 4M77G 1I5OB 1AWWA 4QVCA 3C94A 5EC7A 1PKSA 1JBMA 3M54A 3G7ZA 1BI3A 4ZN1A 5GMKi 2L3QA 1VQPQ 3PIPA 1I0CA 1VQ4T 1UGPB 3M0TA 2AZVA 1CSKA 1Y57A 3KXTA 3PVLA 1UHFA 1W1FA 2ZCFB 2JOYA 4Z02A 2ZGWA 2K2MA 4VUBA 3E1SA 3QZ9B 1MMNA 1SEMA 3S3MA 4LDUA 5J3BA 4AFQC 1FMKA 4RTZA 1K9AA 4IUPA 3RIRA 1S72T 2E1HA 1Q86R 4PLLA 3MPUB 2HQHA 1AEYA 2PTKA 4C92A 3OYGA 4RTXA 5C6SA 1N6AA 1VQ6A 1GCQA 4C92D 5FRMA 1QP3A 3SD4A 2ED1A 3SHWA 4CC4B 4D8KA 2V8KA 1M27C 1KG1A 1HSQA 3EHRA 5GAMg 1D3BA 2QTVA 4PJOG 2QA4A 1YJ9A 1M8MA 1JJ2P 2FO0A 3CC4T 2ROTA 2KBTA 3WVDB 4A63B 2PUOB 1NZ9A 3VYGA 2RHZA 2DL4A 3VUBA 3M0QA 1PCXA 1YBYA 3CXCA 2DM1A 4C92E 3JB9F 2XI9A 2WSFE 4OB2B 4QQDA 1Y7XA 4LN2A 3CC7T 4Z8AA 5KYXB 4HT8A 1I81A 1WHGA 1XJWB 2F2WA 2RN8A 4JS5A 1D0ZA 2R57A 1YWPA 1YJWA 4BB7A 4OMFB 1VQOA 4PJNA 4LD6A 3ZBDA 2COYA 5J39A 1WHKA 3GNGA 4J6XA 4M78C 2Y90A 2JM8A 1SRLA 3CCJQ 3OW2P 3OS1A 1FMVA 3CMEQ 1G83A 2RJCA 3QHSA 3PFSA 1X2QA 1M2VB 2A0FB 3CC2A 5GMKh 1AZEA 8AT1B 3C0CA 2WSEE 3LWHA 1K76A 2JW4A 2QG9B 4E7IA 1Q7YR 4XU3A 2QDYB 1FXXA 2LZ6B 2EYZA 1OZ2A 4IIMA 1OV3A 1LVKA 4J9FA 2MWOA 3QDRB 1YJNT 1VIFA 1VQOQ 2DD5A 2GTOA 2F2VA 9ATCB 5CO7A 1M4ZA 1EX4A 2LQNA 3KUFA 3GIBA 4A53A 1KHCA 2PNIA 4BUGA 3H9NA 1RUWA 4M7DE 4RUGA 3A8MB 2D0NA 4QVDA 1KC8C 3ULRB 1IRXA 2CP6A 2C0OA 3CCVA 5KYUB 1HXDA 2A3LA 4ZGDB 4J9IA 2L8DA 4JRQA 2J6FA 3VS2A 2OX7A 3CPWS 1YJWQ 3JB9H 2ZPGB 3JB9D 1GXIE 4ORZA 4B6MA 2OTLT 4NL2A 3FEOA 1OX8A 2HAXA 2J06A 2YXYA 1N9SA 3OYAA 2FZKB 4V2SA 2K5FA 4CC3A 4DBHA 1VQLA 2RJDA 1I4K1 1K0SA 1ZQ1A 4HT9A 1TUDA 1PKTA 3J7AF 2B86A 1ACMB 1KHIA 2ENMA 4RG8A 1M90R 3CCRA 2GNCA 3TCJA 2RH2A 4M75G 1K73U 1NE8A 4PFZA 4FT2A 1M2VA 3H0FA 4FSSA 1A0NB 4HVWA 2HZYA 2KXCA 1WQ7A 1UGSB 4C92F 2O4XA 1BI0A 1QKWA 1NJIU 3PMTA 2JT4A 3NFCA 4KGVB 4PK4A 2CGHA 4QKUA 3QJ6A 2KVQG 4BI4A 2Y4XA 4D8DA 4DOVA 5IHNA 3MEWA 2CZ0B 1SKUB 2QQ9A 1OPKA 5GJVB 2NYSA 2JNGA 5GAOl 3RKWA 2LNVA 3HRTA 3LGLA 4C5IA 2BUDA 1JB0E 3E9FA 1PD0A 3X20B 4XTWA 4RG2A 3JV3A 2VASA 5GAMd 2X4WA 3DLLA 4PJJA 4OB3B 2BE9B 4J9DA 3CCQA 2PZ1A 4E7JA 3I55Q 5LJ3f 3CCSA 2EGAA 4WTOB 2GFAA 2DL5A 3RDVA 2QTXA 2K3YA 2C0TA 4JJNK 1B7TA 3H8ZA 1IHWA 1G3YA 3VRYA 2OJ2A 2QK0A 1RAFB 2KT8A 4F7UF 2EWNA 5IXBA 1Q81U 3S3OA 3BE3A 4J7FA 2RHXA 3MKDA 1M3BA 1KK7A 1XNIA 3NMZC 2DYBA 4BY6B 5GAOn 2CSIA 3PMIA 2HQXA 4LNPA 4EMKA 3URGA 1Q81C 2EYWA 4PFPA 2RK1A 5GAN3 5CCAA 3UPUA 1BK2A 4JZ4A 1RAIB 3ME9A 3JCMd 1NYFA 4JLGA 1MMGA 1XOVA 4MZPA 1RACB 5GAMh 3P8DA 2RQWA 3G6EA 1NEGA 4C5HA 1F1BB 4RKUE 4AMCA 2E41A 2O01E 3CMEA 2AZSA 1W2BP 1YJNQ 4L5GA 2O88A 3QYGB 2K3XA 2K2VA 1V76A 1VQ8T 1HD3A 1W4SA 3META 3AHUA 3JAME 4M7AG 3QJYA 2NUPB 4C8QB 2LJ3A 2MMPA 3I35A 1YN8A 2QEXA 4EIKA 3LYIA 2M0OA
chains in the Genus database with same CATH topology
4PJOD 3CBMA 4JUVA 4LDVA 5GAN7 4LDYA 5LL6S 3QKJA 1M9SA 4D6WA 1M8VA 3QBYA 1NPRA 3CCQT 1YIJA 4XU0A 5J26A 4L59A 4M7DD 5M9OA 3FRNA 3OYHA 3INZA 4BY6C 2QXFA 2QQRA 4KBMB 5FU6B 1X75C 2VXFA 3OYLA 4A54A 2JTFA 5CQXA 5GANh 2RI5A 1M1GA 2PQWA 5CKBA 2K57A 5LJ3e 1UGQB 2RM4A 4CRIA 1IREB 1N27A 4M75D 3QZ5B 1R8OB 1H3ZA 4M7AB 3V8JA 1G5VA 2EKOA 3CXCS 5GANe 2EQJA 5IAYA 1X6OA 2P0PA 1Q82C 4P5NA 4XTVA 5A0GA 1WJQA 2IVWA 2R5MA 2ZPIB 5CQYA 3GP8A 4C92G 1LJOA 2DEQA 2E5QA 5D6WA 5I2MA 2EJGA 4ZGJB 3OSVA 5FROA 4DA4A 2RI2A 1G3SA 2E70A 1K9MU 1N9RA 1UEBA 1Y96A 4PJOF 3OYKA 1YI2A 5D6YA 4BE0A 4M78G 3L1AA 2LT1A 5GANf 1MGQA 4F7UG 2D6FA 1Y07A 2A7YA 2NLUA 1NPPA 4XAXB 1WJSA 3EAEA 3OYCA 5FU6C 3RUXA 4M78E 3CEYA 3OB9A 3JB9I 3RMSA 3UDCA 1H641 5GAN6 3I55A 2OTLA 1VQ7T 4FT4A 4M77G 2MI6A 3CCLT 4QVCA 2VC8A 3MCAB 4C0DC 4Y91A 2JTMA 3C94A 3G71A 4EDUA 3WXMB 2HBPA 4IUVA 3OS0A 1JBMA 2XDPA 3M54A 5LJ3h 3G7ZA 4BI8B 3HKSA 1BI3A 3RKXA 4C8QA 1UB4A 4ZN1A 5GMKi 3J80E 3PIPA 4CI0C 3J81E 3PNWC 3E19A 1VQ4T 1UGPB 2FB7A 4C8QG 3RESA 4C0ZA 4M75A 4M78B 4MMLA 5CK9A 3A8OB 2KMTA 3HPWA 2E6ZA 3KXTA 2HQEA 2ZCFB 2L89A 2RD1A 1VQ5T 3ZFJA 5GAN2 2M16A 1VQMT 5GANj 5C0MA 3X25B 2EQKA 2VV5A 2IG0A 2JOYA 4J6WA 4MMKA 4Z02A 1VQ9T 1VQNA 2LDMA 3CCJA 2OAUA 3VYHB 3CBOA 5GAMf 2ZGWA 3OS2A 2BIVA 4VUBA 3E1SA 3QZ9B 4M78A 1OZ3A 1O75A 3I56T 3S3MA 1PSEA 4LDUA 4XTZA 5J3BA 3L2UA 3L2WA 1W2BA 4JS4A 3QSUA 2EJ9A 3HHTB 4IUPA 1KC8U 2DXCA 2C06A 1QVPA 4FL6A 3RIRA 2E1HA 2DVEA 4C0FA 1YJWT 4BD3A 3QYHB 1S72T 1M90C 2JZ2A 4OGCA 4M75B 5L8RE 4PLLA 4JRIA 5EG2A 4C92A 3OYGA 3S6WA 4JDSA 4ZTFA 2F5TX 5C6SA 1N6AA 1I5LA 1VQ6A 3CCLA 4C92D 4QVZA 5FRMA 1QP3A 3OYEA 3HRUA 3SD4A 3L2QA 3G4ST 3CCUT 1B34B 5IT9E 1M1FA 3JCMb 1Q86C 4IURA 4EMKC 4IUQA 3LGFA 3TU4K 3MP1A 3JCMP 5I21A 2V8KA 1VIEA 1KG1A 2H3JA 2WSCE 4OP0A 3G71T 3M4YA 2RA2A 1QVFA 5GAMg 1D3BA 4BACA 1QW1A 4PJOG 3JCMg 2QA4A 1RI0A 1YJ9A 2RJEA 4M75F 2RHUA 4ME7A 4IUUA 4C8QE 1YITT 1U1SA 2FVUA 1K8AC 1JJ2S 3CCET 3OW2S 3CC4T 2KSSA 5GAOq 2DIGA 2XDBA 1VQLT 1KQSA 2YLBA 1Y71A 3WVDB 1YHQT 1QVGS 2PUOB 1NZ9A 3VYGA 3HFOA 3RMQA 1VQKA 2F5KA 1KD1U 2RHZA 4N4GA 4II1A 4XTXA 3OYBA 2P4TA 3C95A 3PTAA 1YCYA 2HNIA 4PL6A 3VUBA 5LJ5j 1YBYA 3CXCA 4BI3A 1XTDA 3QO3A 4C92E 5HKCA 1W2BS 3JB9F 3JCMW 2EFIA 4F7UE 2XI9A 4PJOA 2WSFE 4OB2B 4QQDA 1BYMA 4DOWA 3G6ET 1I8FA 1Y7XA 4M77A 3CC7T 1M1KU 4N4IA 3HSBA 3TEEA 1VUBA 2VGNA 1YHQA 4ZTJA 1VQ4A 5GMKl 3DB3A 4OB0B 1U1TA 2DTOA 4HT8A 3S3NA 2CZ1B 1I81A 2OTJA 2LRQA 4FIBA 3ZEHA 4JS5A 3LH0A 3X26B 5AYFA 1JRIA 2R57A 5GANg 2FYKA 4OMFB 4BB7A 1VQOA 5KE3A 1YJWA 2DPPB 4JRKA 1M90U 4C92B 2I2LA 4C92C 4M7AF 3MEUA 3JCMQ 4A4KA 4JRPA 2DZCA 1K9MC 4LD6A 2CKKA 1IZ6A 2DZ9A 3ZBDA 4X9DA 3M59A 1X01A 2FHDA 5J39A 1HK9A 3CC7A 4MDXA 2D0QB 1QVFS 1OYXA 3GNGA 3LWIA 4FU6A 3SFMA 4J6XA 4C5GA 2RK2A 4M78C 3PIOA 2DXUA 2EQUA 2RJFA 2Y90A 2V8JA 4M77B 5CKDA 2OTJT 5GAOr 1FX7A 3DLMA 2QQAA 2BKDN 2DTIA 3OSSC 3OS1A 1QVGA 2E6NA 3X24B 3FC3A 4BE2A 2RJCA 2HD0A 3CCVT 3QHSA 4KT0E 3PFSA 4F7UA 2MWPA 4KUIA 3CCJT 3OMCA 2DJZA 3CC2A 3JB9G 5GMKh 2LTOA 4N4HA 4XQ3A 3ASKA 3MO8A 2VGMA 3LW5E 3C4SA 5IN1A 3QUIA 4R55A 2WSEE 4M78D 3LWHA 3SDZA 5CKHA 2GFUA 4EMHA 4UC4A 5FLXE 1ZHIA 4Y28E 4C8QC 3OMGA 4M77F 1TH7A 4R56A 2LCLA 2DO3A 4E7IA 4XU3A 5GAOm 2LC4A 2QDYB 1FXXA 3NTHA 1OZ2A 1N8RC 2XICA 4OGEA 2G3RA 3T9NA 4M78F 3MEVA 3CC2T 1YITA 5LJ5g 1UGRB 2MWOA 1M5Q1 3MEAA 3Q1JA 3GNFB 5CKFA 4A4FA 3QDRB 4ZGEB 4XK8E 5KCOA 3I56A 3CCST 2K4YA 4QQ6A 1YJNT 4RCCA 1VIFA 3BW1A 2QQSA 2DD5A 4C0DB 4C8QD 4BDZA 3C12A 3TREA 4J83A 1Q86U 5CO7A 1M4ZA 4FM4B 3KUFA 1VQOT 1K73C 4A53A 3GIBA 1KHCA 4PNOA 2GF7A 4BUGA 2E10A 2PVGB 3OYYA 4KULA 1VQPT 4NL3A 5FU7B 3KBGA 3MP8A 4M7DE 1WNLA 2CYZB 1BKBA 3A8MB 4QVDA 1Q7YU 4XTUA 3EFSA 3JRZA 3QPHA 2DKGA 4J6YA 4EMGA 3BFMA 1KC8C 4PJOE 4MDWA 5LJ3g 3CCVA 4PKCC 4HKEA 4B9WA 1PSFA 2XD0A 4J8OA 2ZPHB 2WACA 4YTLA 3OA6A 1HXDA 2VYTA 2A3LA 3M5AA 2ZZDA 4ZGDB 2X35A 3JCMX 2JVVA 2QEXT 4XU1A 2L8DA 2F69A 3VUZA 4JRQA 2D9TA 4GY5A 1U8RA 3CPWS 2EIFA 3H6ZA 3HP9A 3OS5A 3JB9H 3M9QA 2ZPGB 4A4EA 3JB9D 1GXIE 4MZTA 3FDRA 3MHXA 4BE1A 4GLKA 2VUBA 2OTLT 1VQ9A 3V8KA 2GQVA 3CBPA 3M55A 4NL2A 3WVEB 3FEOA 3JCMh 5KH6A 3L2VA 4LDXA 4M7DA 2HAXA 5GMKm 3JCMJ 5HK0A 2CS7A 3QG1A 1N9SA 5KE2A 3OYAA 3RERA 3A8GB 4V2SA 5HY6A 2LT4A 2K5FA 4PJOB 3O8VA 3OYIA 3CD6T 1QP2A 1YJNA 2XDDA 2O4XB 3PGGA 5GAMe 5CR2A 2RJDA 3A5ZB 2LVMA 1I4K1 1VQKT 5LJ5f 2PU9B 1ZQ1A 2X4XA 4C8QF 4HT9A 4Q5WA 4TVRA 2GCXA 3SWNC 4NS5A 3CD6A 3MP6A 2X4YA 3J7AF 5I2SA 4M7DG 4QQGA 5LJ3d 3NTKA 3V8LA 1DJ7B 1KHIA 2CZ6B 4RG8A 1V29B 3FLGA 4M7AC 2L3RA 3JCMc 1KQ1A 3CCRA 2RI3A 2MF2A 1BIBA 4ZN3A 5GANd 2RHIA 5GAN8 3TCJA 2RH2A 4M75G 5GAN4 1K73U 1NE8A 2LX9A 4N0AA 2KAFA 4FT2A 4E7LA 4J7IA 4F7UB 4HA8A 4EPCA 3R6OA 4HCCA 2RHYA 4XU2A 2YHTA 1WQ7A 1OI1A 2DAQA 2LQ8A 3F70A 2PVOB 1UGSB 2YLCA 5CIUA 2O4XA 4C92F 1BI0A 2XKOC 5FU7C 1NJIU 3PMTA 5LJ5h 1S72A 1BI2A 3NFCA 2Y4YA 4X9CA 3FB9A 4M7AD 2CGHA 2LCCA 3CCRT 5HK3A 4OF1A 2ZPFB 3QJ6A 2KVQG 1VQ8A 2KK4A 3HL8A 4HCZA 2Y4XA 4XTYA 4BI4A 2M1HA 4DOVA 4RCBA 1MHNA 3MEWA 2CZ0B 3NTIA 4NOYA 1BI1A 2M9UA 2QQ9A 4O6JA 4E47A 1VQPA 4MZMA 4OB1B 4PLIA 1G3WA 2JNGA 2XG8D 4M75E 5DM7R 1NJIC 2DTHA 3M56A 3BY7A 5GAOl 2VXEA 2ZPEB 3L2ZA 3BDLA 2LNVA 1B34A 3HRTA 3RKWA 3UWNA 3LGLA 3GPLA 2MAMA 2DIQA 4C5IA 2BUDA 1JB0E 3GOXA 3A8LB 2RO0A 3E9FA 3OY9A 2DXBA 3LX7A 3ER0A 4FSXA 3X20B 5GAMj 4XTWA 3V7RA 3VJPA 3GLXA 1ZBXA 4RG2A 3CMAA 4IUTA 2XHCA 5GAMd 2QA4T 5KCHA 2FL7A 2X4WA 3DLLA 1Q82U 4O5VA 1JJ2A 2YRVA 4OB3B 3OYNA 3OW2A 3CCQA 1YIJT 1P92A 1KQSS 3CC4A 4E7JA 4BDYA 1M1KC 2P0KA 2PVDB 4ELYC 1BIAA 1LOJA 2V8IA 3M58A 5LJ3f 4C5EA 3JCMe 3CCSA 4HCBA 1LNXA 3SB2A 3E9GA 5CAIA 4M77C 3M57A 2GFAA 3OYMA 3I55T 2DXTA 3DB4A 3CMET 1WPYA 2K5IA 2EJFA 3OBYA 4N0AC 2QQBA 1VQLA 1VQMA 1VQ5A 3QIIA 2PUKB 4OVAA 5GMKj 5GMKe 3FJPA 2QTXA 2K5LA 1SSFA 3G4SA 3CCUA 1O9SA 2K3YA 4L6V5 5DY9A 1YI2T 2AHJB 5A0LA 3OYFA 5FRNA 4JJNK 4M7AE 3H8ZA 3SWNA 1G3YA 4EMKB 2EAYA 1D3BB 2EQMA 2X4JA 4M77D 4ELZC 3V7CA 3P8BB 4JLIA 2EWNA 4LDWA 3X28B 2JN0A 4C0GA 4F7UF 3S3OA 4J7FA 2RHXA 3V7SA 1Q81U 2XIDA 4A4GA 3RKYA 2KY9A 1XNIA 3JB9J 3CPWA 4BY6B 1XQHA 1AHJB 2DK3A 5CVIA 5GAOn 4ATOA 3PMIA 5A2QE 2HQXA 1Y96B 4E7KA 2CZ7B 5CKEA 3BDUA 4EMKA 1KD1C 3OYDA 3SWNB 3URGA 3CCMA 3FIFA 1Q81C 3JSCA 3LLRA 4J5YA 2R58A 3N5BB 2XK0A 2EYQA 2RK1A 3VU3C 5GAN3 5CCAA 2KQWA 3UPUA 4B9XA 1WGSA 2L5QA 1WJRA 5DLQE 4M7DF 3HRSA 2ZPBB 3M53A 3ME9A 3OBWA 3L2RA 3JCMd 1K8AU 2E12A 4JLGA 3CMAT 2KDSA 5LJ5d 1XOVA 4RMOA 4M7AA 2LQKA 3GF5A 4MZPA 4M77E 3M4GA 3P8DA 5GAMh 3G6EA 3VKIA 2DD4A 4C5HA 2XU8A 1VQNT 4LD9K 3P8HA 2B8AA 3UT1A 1EIFA 1RL2A 4KUDK 4RKUE 5D6XA 1G3TA 4A4HA 2E41A 3EFRA 2O01E 5A0DA 3OQ5A 3OYJA 4QW2A 3CCMT 4E7HA 3VV0A 3CMEA 2E64A 1YJ9T 2R5AA 4L5GA 3JCMf 3L42A 5LJ5e 1VQ7A 4PJOC 1Q7YC 3QXEB 2JUFA 3QYGB 2K3XA 5LJ3j 2K2VA 4M7DB 1VQ8T 2RB6A 2P0QA 1W4SA 3META 3HFNA 4M7DC 3AHUA 4WF2A 4DQ2A 3JAME 1N8RU 1KQ2A 4M7AG 3QJYA 2E65A 3DKMA 3PT9A 4C8QB 3CCEA 2MMPA 5GAOp 2QI2A 5DLOA 3A8HB 1WQWA 4M75C 5GAN5 3JCMV 2QEXA 3LYIA 4X34A 2M0OA 1VQ6T 1FWZA 4IKFA 3CPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP1 A;  4QQ6 A;  3BDL A;  3UWN A;  2QQS A;  3LGL A;  4C5I A;  2DIQ A;  3GOX A;  2BUD A;  4BDZ A;  2RO0 A;  3E9F A;  3QKJ A;  3QBY A;  3LX7 A;  3OY9 A;  5J26 A;  4L59 A;  4BAC A;  4RG2 A;  5M9O A;  3KUF A;  4IUT A;  1RI0 A;  3OYH A;  5KCH A;  1KHC A;  2RJE A;  2QQR A;  2RHU A;  2X4W A;  2GF7 A;  4IUU A;  3OYL A;  2JTF A;  2RI5 A;  2YRV A;  3OYN A;  2PQW A;  2DIG A;  3MP8 A;  4CRI A;  1N27 A;  4E7J A;  4BDY A;  1H3Z A;  1G5V A;  2P0K A;  2EKO A;  2EQJ A;  4C5E A;  5IAY A;  3E9G A;  1WJQ A;  2R5M A;  2F5K A;  2GFA A;  3OYM A;  2RHZ A;  4N4G A;  4II1 A;  3DB4 A;  2E5Q A;  5D6W A;  3OYB A;  4B9W A;  5FRO A;  4PL6 A;  2WAC A;  2RI2 A;  3OA6 A;  2VYT A;  3QII A;  4OVA A;  2EFI A;  2X35 A;  1SSF A;  3OYK A;  2K3Y A;  4QQD A;  2L8D A;  5D6Y A;  2D9T A;  3OYF A;  4GY5 A;  4BE0 A;  5FRN A;  4N4I A;  3H8Z A;  2NLU A;  4ZTJ A;  3H6Z A;  2EQM A;  3DB3 A;  1WJS A;  3S3N A;  3EAE A;  3OYC A;  3M9Q A;  3CEY A;  3OB9 A;  4A4E A;  2LRQ A;  3FDR A;  4BE1 A;  3S3O A;  3ZEH A;  2RHX A;  3LH0 A;  2R57 A;  4A4G A;  5KE3 A;  3FEO A;  5KH6 A;  1XNI A;  3L2V A;  3MEU A;  4EDU A;  4LD6 A;  2CKK A;  4IUV A;  3OS0 A;  5KE2 A;  2XDP A;  3OYA A;  2FHD A;  5J39 A;  3PMI A;  3O8V A;  3OYI A;  1OYX A;  2HQX A;  3PNW C;  2O4X B;  4FU6 A;  4E7K A;  2RJD A;  2LVM A;  3OYD A;  4C5G A;  2X4X A;  3LLR A;  4Q5W A;  2EQU A;  2R58 A;  2RJF A;  2XK0 A;  2HQE A;  4NS5 A;  3MP6 A;  2L89 A;  2X4Y A;  4QQG A;  3DLM A;  1WGS A;  4B9X A;  3NTK A;  1WJR A;  2M16 A;  2BKD N;  3FLG A;  3ME9 A;  3OS1 A;  3L2R A;  5C0M A;  2L3R A;  2E6N A;  3FC3 A;  2EQK A;  2RI3 A;  4BE2 A;  2RJC A;  2RHI A;  2IG0 A;  3PFS A;  2MWP A;  4Z02 A;  2LDM A;  3OMC A;  3P8D A;  4C5H A;  2LTO A;  4N4H A;  3P8H A;  2B8A A;  4E7L A;  3ASK A;  3UT1 A;  3OS2 A;  2BIV A;  3MO8 A;  2RHY A;  5D6X A;  1OZ3 A;  4A4H A;  3C4S A;  5IN1 A;  4E7H A;  3OYJ A;  3OQ5 A;  3F70 A;  1OI1 A;  2DAQ A;  4QW2 A;  3S3M A;  4IKF A;  5CIU A;  2O4X A;  3L2U A;  3L2W A;  2GFU A;  4UC4 A;  4IUP A;  2R5A A;  3L42 A;  3PMT A;  4FL6 A;  3OMG A;  4BD3 A;  2JZ2 A;  2LCC A;  4E7I A;  2K3X A;  4PLL A;  3MET A;  3QJ6 A;  3OYG A;  4HCZ A;  3NTH A;  1OZ2 A;  3S6W A;  4ZTF A;  2M1H A;  5C6S A;  2G3R A;  1MHN A;  3MEW A;  3MEV A;  3NTI A;  4QVZ A;  3SD4 A;  3OYE A;  3L2Q A;  5FRM A;  4PLI A;  2MWO A;  3MEA A;  3Q1J A;  3LYI A;  4X34 A;  4A4F A;  2M0O A;  5KCO A;  4IUR A;  4IUQ A;  3LGF A; 
#chains in the Genus database with same CATH topology
 3M0R A;  2ROL A;  1JQQ A;  4OML A;  3CCQ T;  4FCY A;  4CC2 A;  2QQR A;  2JTF A;  2PQW A;  4PJM A;  5LJ3 e;  4CRI A;  1NEB A;  1I1J A;  1KQS P;  1JXM A;  2BZ8 A;  3GP8 A;  1ZUK A;  4C92 G;  1LJO A;  2E5Q A;  4RTY A;  2O9S A;  1K9M U;  1UEB A;  1Y96 A;  1OPL A;  1YI2 A;  4BE0 A;  3L1A A;  3M0S A;  1Y07 A;  2A7Y A;  2CP3 A;  2NLU A;  4XAX B;  5FU6 C;  3RUX A;  1QQJ A;  3OB9 A;  3JB9 I;  4LUD A;  2OTL A;  2MI6 A;  3CCL T;  5GJW B;  2VC8 A;  4DBQ A;  3G71 A;  4EDU A;  2E3H A;  3WXM B;  1IB8 A;  2HBP A;  3RNJ A;  4QT7 A;  3RKX A;  1UHC A;  3J81 E;  3E19 A;  1UTI A;  2KXD A;  4C8Q G;  2CDT A;  4C0Z A;  2J6K A;  4MML A;  3A8O B;  4KRT A;  2HQE A;  2DLP A;  2DEU A;  1D1A A;  5GAN 2;  7AT1 B;  2VV5 A;  3VS1 A;  4J6W A;  3I56 Q;  3CCJ A;  2OAU A;  3CCQ Q;  5GAM f;  1WA7 A;  1OZ3 A;  3HHT B;  4AFU C;  1KC8 U;  2DL8 A;  2DXC A;  1SSH A;  1QVP A;  4FL6 A;  2C06 A;  2Z0W A;  4BD3 A;  2JZ2 A;  4OGC A;  1GFC A;  1Z9Q A;  1EZZ B;  4JDS A;  4ZTF A;  2HSP A;  3OYE A;  3HRU A;  5IHI A;  1CKB A;  3CCU T;  1B34 B;  5IT9 E;  1M1F A;  2BZY A;  4IUR A;  5I21 A;  1UJ0 A;  1VA7 A;  1X27 A;  2NUT B;  3E2U A;  3M4Y A;  1D0X A;  3JCM g;  2EPD A;  4M75 F;  4ME7 A;  1VQL T;  5I11 A;  1YHQ T;  1QVG S;  2KEA A;  2YWW A;  2A36 A;  2F5K A;  4N4G A;  4XTX A;  1X69 A;  3OYB A;  2P4T A;  2HNI A;  2BTT A;  4BI3 A;  4F7U E;  2DRM A;  1BYM A;  1TXQ A;  1I8F A;  1QLY A;  3HSB A;  3TEE A;  1YHQ A;  1VQ4 A;  5GMK l;  1UUE A;  1ARK A;  2DTO A;  3S3N A;  1BB9 A;  2DYI A;  5KYY A;  5AYF A;  4C92 B;  2I2L A;  4M7A F;  1K9M C;  2CKK A;  1IZ6 A;  1SHG A;  4J9B A;  4J9H A;  3M59 A;  5AT1 B;  1X01 A;  1ZUY A;  3EG9 A;  2BE7 D;  1KSW A;  2G6F X;  2YUO A;  2RK2 A;  2DNU A;  2CUB A;  1HJD A;  2VWF A;  2DXU A;  2V8J A;  2DA9 A;  5GAO r;  3DLM A;  2QA4 Q;  4PJL A;  2BKD N;  2DTI A;  3OSS C;  1QVG A;  3FC3 A;  2CP2 A;  4BE2 A;  4FW1 A;  4F7U A;  2MWP A;  1M30 A;  2DJZ A;  2YT6 A;  2M51 A;  3JB9 G;  1U06 A;  2LTO A;  3ASK A;  1Q95 G;  3MO8 A;  1RAB B;  3CCR Q;  3CCE Q;  3SDZ A;  4EMH A;  1ZSG A;  3EFO A;  4JPB W;  4E7Z A;  4M77 F;  1TH7 A;  4R56 A;  4F16 A;  2DO3 A;  2LC4 A;  3NTH A;  2XIC A;  1H92 A;  1VQN Q;  4OGE A;  3T9N A;  3MEV A;  3CC2 T;  5LJ5 g;  4ZGE B;  3MEA A;  3CCS T;  2K4Y A;  1YHQ Q;  2QQS A;  4C0D B;  2J7I A;  2HBW A;  3TRE A;  4FM4 B;  2FPE A;  1OUL A;  2PVG B;  4NL3 A;  2KRO A;  3MP8 A;  1CKA A;  2JTE A;  2CYZ B;  1Q7Y U;  4J6Y A;  3QPH A;  2DKG A;  4MDW A;  1Q81 R;  4KGX B;  5LJ3 g;  4PKC C;  1ZSZ A;  5IH2 A;  2HSE B;  2CP0 A;  2LP5 A;  1WFW A;  1KC8 R;  3JCM X;  4HVV A;  2QEX T;  2F69 A;  4AT1 B;  1VQM Q;  3CCM Q;  1U8R A;  2JM9 A;  2DRK A;  3H6Z A;  3HP9 A;  3I5R A;  3M9Q A;  3FDR A;  3MHX A;  4GLK A;  1VQ9 A;  1FMW A;  2GQV A;  2ATC B;  3JCM h;  4LDX A;  3L2V A;  2CS7 A;  1QVF P;  5HY6 A;  2LT4 A;  2COW A;  1Z9Z A;  3CC4 Q;  2O4X B;  5GAM e;  2LVM A;  5LJ5 f;  2PU9 B;  4C8Q F;  4TVR A;  1B3Q A;  3H0H A;  5I2S A;  5LJ3 d;  2IIM A;  1ABO A;  2YDL A;  1V29 B;  3FLG A;  1KQ1 A;  2RI3 A;  1UEC A;  2MF2 A;  2QAZ A;  4ZN3 A;  2LX9 A;  4N0A A;  4E7L A;  2K79 A;  4HA8 A;  4EPC A;  3R6O A;  2RHY A;  2YHT A;  2YUN A;  2DAQ A;  2PVO B;  4M4Z A;  5LJ5 h;  3D7S B;  1ZA2 B;  3FB9 A;  4F14 A;  4OF1 A;  8ATC B;  2ZPF B;  4MDX A;  3HL8 A;  4HCZ A;  1H8K A;  4RCB A;  5D7U A;  1VYT A;  1MHN A;  3GBQ A;  4NOY A;  2XG8 D;  1ZA1 B;  3BY7 A;  1VQ4 Q;  2VXE A;  2DIQ A;  2KNB B;  1GL5 A;  3OY9 A;  1MMA A;  3ER0 A;  4FSX A;  4DBF A;  5GAM j;  5I22 A;  3EGU A;  2XHC A;  1UFF A;  4IUT A;  1M2O A;  1JO8 A;  1Q82 U;  3EGD A;  2IPO B;  1P92 A;  1VQL Q;  3EG3 A;  2DFU A;  1V1C A;  4ELY C;  3E9G A;  4M77 C;  1RAD B;  3M57 A;  2DVJ A;  1WIE A;  2K5I A;  5ECA A;  4PFO A;  4N0A C;  3CXC P;  2V26 A;  1VQM A;  3QII A;  2PUK B;  4OMM A;  4OVA A;  3CCU A;  1O9S A;  2RMO A;  1NG2 A;  5A0L A;  5FRN A;  4M7A E;  5FWC A;  1MV0 B;  2EAY A;  3VS4 A;  1H3H A;  4M77 D;  4JLI A;  3V7S A;  4A4G A;  3TSW A;  1WXB A;  3CPW A;  1AHJ B;  2OTL Q;  1SRM A;  2DET A;  2MK5 A;  4J9C A;  5A2Q E;  1ABQ A;  5CKE A;  1KD1 C;  1X2K A;  4LE9 A;  3JSC A;  2R58 A;  2EYQ A;  2KQW A;  2SRC A;  4B9X A;  1WGS A;  1OQK A;  1C1A A;  2L5Q A;  1VQK Q;  2HEQ A;  3L2R A;  1K8A U;  1E7O A;  5LJ5 d;  4RMO A;  3GF5 A;  1VQN T;  2DD4 A;  1G8X A;  2HKN A;  3VS7 A;  5D6X A;  1G3T A;  4E7H A;  1TWB A;  4PJO C;  1M3C A;  2M02 A;  3QXE B;  1PRM C;  3SEM A;  1NM7 A;  1UJY A;  2RPN A;  1YJ9 Q;  3HFN A;  4FYW B;  1TUC A;  4DQ2 A;  1MNE A;  3CCE A;  1T0J A;  2QI2 A;  5DLO A;  1WQW A;  1WYX A;  4M75 C;  3JCM V;  4X34 A;  1FWZ A;  4IKF A;  4PJO D;  2MIO A;  1YNZ A;  4LDV A;  5GAN 7;  5KYY B;  3QKJ A;  1M9S A;  1M8V A;  3OYH A;  3FRN A;  4BY6 C;  2QXF A;  4KBM B;  2ECZ A;  5FU6 B;  1X75 C;  4A54 A;  3R6N A;  5CKB A;  2K57 A;  1UGQ B;  2RM4 A;  1IRE B;  4M75 D;  3QZ5 B;  1R8O B;  4M7A B;  3V8J A;  5GAN e;  2EQJ A;  2KRM A;  1X6O A;  1K1Z A;  2P0P A;  1Q82 C;  1AT1 B;  4J9G A;  2M0Y A;  4P5N A;  4XTV A;  5A0G A;  2R5M A;  5CQY A;  5D6W A;  5I2M A;  2GTJ A;  4ESR A;  2ABL A;  2RI2 A;  2E70 A;  1AD5 A;  1N9R A;  4PJO F;  3OYK A;  2C0I A;  5D6Y A;  1YFN A;  4M78 G;  2RQV A;  3EAE A;  3QDF A;  3CCS Q;  1WDX A;  1H64 1;  2CRE A;  5GAN 6;  1VQ7 T;  1M1K R;  4FT4 A;  4OMO A;  2DER A;  2NUZ A;  1KJW A;  4FYY B;  4IUV A;  2XDP A;  5LJ3 h;  4BI8 B;  3HKS A;  1UB4 A;  4CI0 C;  3RES A;  2FG0 A;  1OX9 A;  1K8A R;  4M75 A;  1UGV A;  2E6Z A;  2L89 A;  2RD1 A;  3EG1 A;  3CQT A;  1VQM T;  1RAG B;  4E2F B;  5GAN j;  3X25 B;  1QMC A;  2IG0 A;  2EBP A;  1X43 A;  2LX7 A;  1VQ9 T;  2LDM A;  3VYH B;  1T3S A;  4M78 A;  4HCK A;  5IXF A;  1PSE A;  2EW3 A;  1VYU A;  4XTZ A;  3L2U A;  1W2B A;  4JS4 A;  2EJ9 A;  1UE9 A;  1YJW T;  2DVE A;  2O2O A;  2KT1 A;  3QYH B;  1M90 C;  3VS0 A;  4M75 B;  1R77 A;  5EG2 A;  4E6R A;  2VKN A;  3S6W A;  2F5T X;  1I5L A;  3CCL A;  4QVZ A;  3L2Q A;  1PNJ A;  3G4S T;  3KFV A;  4F17 A;  1JU5 C;  3JCM b;  1Q86 C;  4IUQ A;  3LGF A;  3TU4 K;  3EH2 A;  1BCO A;  1VIE A;  1AOJ A;  1QKX A;  2RA2 A;  1QVF A;  4BAC A;  1QW1 A;  1RI0 A;  2RHU A;  4C8Q E;  4IUU A;  1WXU A;  2QGG A;  1YIT T;  3CCE T;  1K8A C;  1JJ2 S;  3OW2 S;  1LCK A;  2QDL A;  4GBQ A;  2KI7 A;  1TOV A;  4LXC A;  2H3E B;  5KYW A;  3HFO A;  1K9M R;  1GBR A;  1KD1 U;  4II1 A;  1YP5 A;  1QWF A;  3PTA A;  1YCY A;  1XTD A;  5HKC A;  3I5S A;  1UDL A;  2EFI A;  4PJO A;  2CT4 A;  4M77 A;  3EGD B;  4N4I A;  1VUB A;  2AKK A;  1IHV A;  3EG2 A;  2CZ1 B;  2YSQ A;  1G2B A;  2LRQ A;  3ZEH A;  3LH0 A;  5GAN g;  2RNA A;  1JRI A;  1M90 U;  2FYK A;  5KE3 A;  2DPP B;  1TSF A;  2XMF A;  4C92 C;  4JJB A;  4JRP A;  1EFN A;  2DZ9 A;  2FHD A;  2I0N A;  1NLP C;  2D0Q B;  4GLM A;  4FU6 A;  2K9G A;  3UAT A;  4M77 B;  2EQU A;  2RJF A;  5CKD A;  1FX7 A;  1WXT A;  3NPF A;  2H8H A;  2E6N A;  2CT3 A;  2HD0 A;  1PRL C;  3CCJ T;  2KR3 A;  4N4H A;  4FYX B;  3C4S A;  5IN1 A;  4R55 A;  5CKH A;  2P4R A;  4Y28 E;  1AWO A;  2HMA A;  2DJQ A;  2LCL A;  2JJ9 A;  2X3X D;  1YCS B;  2G3R A;  1PHT A;  2NUT A;  1YIT A;  1UGR B;  3Q1J A;  3GNF B;  5KCO A;  2X9H A;  4QQ6 A;  2HDA A;  4C8Q D;  4BDZ A;  2DMO A;  2CH4 A;  1Q86 U;  1E6H A;  4PNO A;  2RF0 A;  2E10 A;  1VQP T;  4KUL A;  1GFD A;  3KBG A;  1WNL A;  1BKB A;  4XTU A;  3JRZ A;  4EMG A;  4PJO E;  2A28 A;  1NLO C;  2FEI A;  2FPF A;  3VRZ A;  4HKE A;  2QGF B;  2XD0 A;  4RTW A;  4YTL A;  3H0I A;  2EYX A;  1OU9 A;  4XU1 A;  2D9T A;  3ZL7 C;  2HKQ B;  3CPW P;  3OS5 A;  3PE0 A;  4A4E A;  2K7A A;  2ESW A;  4JJD A;  3RR6 A;  3CC7 Q;  2VUB A;  3V8K A;  1VQ5 Q;  2AK5 A;  2F1L A;  5KH6 A;  4M7D A;  5GMK m;  3JCM J;  5HK0 A;  1WLP B;  3QG1 A;  4R0K A;  5KE2 A;  3RER A;  3A8G B;  3LH5 A;  3O8V A;  3OYI A;  1QP2 A;  1YJN A;  2XDD A;  1ZSZ B;  3CD6 A;  4JJC A;  2X4Y A;  4M7D G;  3V8L A;  2CZ6 B;  1AWX A;  4M7A C;  4IIO A;  3JCM c;  2L3R A;  5GAN d;  5GAN 8;  2LNH B;  4J7I A;  1GBQ A;  2J05 A;  2MYS A;  4XU2 A;  3F70 A;  2LQ8 A;  2JS2 A;  5CIU A;  1ZBJ A;  4X9C A;  2OI3 A;  2Y4Y A;  4M7A D;  5HK3 A;  2EYY A;  1VQ7 Q;  4HXJ A;  1K0X A;  4XTY A;  1QCN A;  5FW9 A;  1R0C B;  2M9U A;  4O6J A;  4OB1 B;  4PLI A;  2YRC A;  5DM7 R;  1NJI C;  3M56 A;  3CC2 Q;  3O5Z A;  3BDL A;  1B34 A;  3GPL A;  1VQ5 A;  1TG0 A;  2ED0 A;  2CP5 A;  2E5K A;  2RO0 A;  3CCL Q;  1QVG P;  2DXB A;  4F04 B;  3V7R A;  6AT1 B;  2AKL A;  1ZBX A;  3GLX A;  2QA4 T;  5KCH A;  1JJ2 A;  3OYN A;  3OW2 A;  1YIJ T;  1R0B G;  3CC4 A;  1RI9 A;  2QYZ A;  1MMD A;  1M1K C;  1AWJ A;  2P0K A;  2PVD B;  1BIA A;  2V8I A;  2FPD A;  3M58 A;  1QCF A;  3JCM e;  5CAI A;  1MND A;  2DBK A;  3G71 Q;  2V1R A;  3I55 T;  2DXT A;  3DB4 A;  1WPY A;  3TQ7 P;  2EJF A;  2QQB A;  1SG5 A;  2OTJ Q;  5GMK j;  3FJP A;  2K5L A;  1SSF A;  3G4S A;  4L6V 5;  1YI2 T;  2AHJ B;  2RQR A;  1NYG A;  2MCN A;  3OYF A;  1IGQ A;  3CCU Q;  4EMK B;  4ELZ C;  2FZG B;  3RBB B;  2EGE A;  1AZG B;  4LDW A;  2JN0 A;  3RKY A;  2JMC A;  1XQH A;  2DK3 A;  5CVI A;  4ATO A;  1YIT Q;  2LJ1 A;  1IO6 A;  4E7K A;  3BDU A;  3CCM A;  3FIF A;  1HYO A;  3TVT A;  3LLR A;  3N5B B;  1OU8 A;  2DF6 A;  3VU3 C;  3EFO B;  4Y92 A;  4M7D F;  2ZPB B;  3OBW A;  2D1X A;  3CMA T;  2KDS A;  2V1Q A;  1SPK A;  2LQK A;  3M4G A;  4ANJ A;  3VKI A;  1W6X A;  1EIF A;  1RL2 A;  1S72 Q;  4A4H A;  3EFR A;  3OYJ A;  4QW2 A;  3CCM T;  3M0P A;  2E3I A;  1VQ8 Q;  2R5A A;  1RAE B;  3JCM f;  3L42 A;  5LJ5 e;  1VQ7 A;  1Y0M A;  5LJ3 j;  3HTR A;  4M7D B;  2RB6 A;  2P0Q A;  1TUG B;  4WF2 A;  1KQ2 A;  1N8R R;  1VYV A;  3PT9 A;  3DKM A;  1T0H A;  5GAO p;  3A8H B;  1OEB A;  5GAN 5;  2L3S A;  2AT1 B;  3CPF A;  3EGX B;  3CBM A;  4JUV A;  4AFS C;  4LDY A;  4LUE A;  5LL6 S;  3QBY A;  1NPR A;  3QWY A;  1YIJ A;  3INZ A;  2VXF A;  3OYL A;  1QCO A;  5GAN h;  5CQX A;  1M1G A;  2E4H A;  2A08 A;  3VS5 A;  1G5V A;  1BU1 A;  3CXC S;  1PC0 A;  5KYW B;  1WI7 A;  1WJQ A;  2IVW A;  2O31 A;  5FWB A;  3CD6 Q;  2DEQ A;  2CH4 W;  2LCS A;  4FYV B;  3UA6 A;  1BCM A;  1WHJ A;  1E6G A;  1C0M A;  5GAN f;  2LT1 A;  2SEM A;  4F7U G;  2LMJ A;  1M3A A;  3OYC A;  3UA7 A;  3RMS A;  1B07 A;  3I55 A;  1YWO A;  1T3L A;  1UG1 A;  4C0D C;  3MCA B;  4Y91 A;  2JTM A;  1RLQ C;  3OS0 A;  4C8Q A;  3J80 E;  3PNW C;  2MOX A;  4OMN A;  2FB7 A;  4M78 B;  5CK9 A;  2KMT A;  3HPW A;  5HCK A;  1VQ5 T;  3ZFJ A;  4AG2 C;  2M16 A;  5C0M A;  2EQK A;  1VOM A;  4MMK A;  1VQN A;  3CBO A;  3OS2 A;  2BIV A;  1O75 A;  3I56 T;  3L2W A;  3QSU A;  2K3B A;  3FJ5 A;  1ZX6 A;  1WHM A;  4C0F A;  4DEX A;  4RTV A;  5L8R E;  2COZ A;  4JRI A;  3PVQ A;  3M0U A;  1IGU A;  3AT1 B;  2W10 A;  1D1C A;  3VS6 A;  2D8J A;  4EMK C;  3MP1 A;  3JCM P;  2FZC B;  2L2P A;  4KH0 B;  2H3J A;  2WSC E;  4OP0 A;  3G71 T;  1PD1 A;  2MPX C;  1GCQ C;  2RJE A;  2L0A A;  1U1S A;  2FVU A;  2KSS A;  5GAO q;  2DIG A;  2XDB A;  1ZLM A;  1KQS A;  2YLB A;  1Y71 A;  3THK A;  2VB6 A;  1VQK A;  3G1J A;  3RMQ A;  1JEG A;  2DIL A;  2GBQ A;  4CC7 A;  3C95 A;  4PL6 A;  5LJ5 j;  1JXO A;  3MJX A;  4Z89 A;  3QO3 A;  1U5S A;  1W2B S;  3JCM W;  4DOW A;  3G6E T;  3TSZ A;  1M1K U;  3EGX A;  2VGN A;  4ZTJ A;  3DB3 A;  4OB0 B;  1U1T A;  3EG9 B;  2DBM A;  2OTJ A;  4FIB A;  2EQI A;  3X26 B;  1AVZ C;  4JRK A;  2QAS A;  3MEU A;  3JCM Q;  4A4K A;  2DZC A;  1X6B A;  2D8H A;  4X9D A;  1YI2 Q;  3CC7 A;  1HK9 A;  1QVF S;  1OYX A;  3LWI A;  1YIJ Q;  5KYX A;  3SFM A;  2P84 A;  4C5G A;  3PIO A;  1NBE B;  2OTJ T;  5KYN A;  2QQA A;  1MUZ A;  3X24 B;  1C6V X;  3CCV T;  1PM3 A;  4KT0 E;  4KUI A;  2KYB A;  3OMC A;  4XQ3 A;  1IXD A;  2VGM A;  3LW5 E;  3QUI A;  1X6G A;  2EVR A;  4M78 D;  1VQ6 Q;  2GFU A;  1TTH B;  4UC4 A;  4FW2 A;  5FLX E;  1ZHI A;  4C8Q C;  4OMP A;  3OMG A;  3UF4 A;  1S1N A;  5GAO m;  1N8R C;  2AIR B;  4M78 F;  2JS0 A;  4RTT A;  5CKF A;  1M5Q 1;  4A4F A;  4XK8 E;  3I56 A;  1I07 A;  4RCC A;  4X1V A;  3BW1 A;  3C12 A;  4J83 A;  1PG5 B;  2FRY A;  1RLP C;  1WX6 A;  1VQO T;  1K73 C;  5L23 A;  2GF7 A;  1ZUU A;  3OYY A;  4J9E A;  5FU7 B;  2KYM A;  1VQ9 Q;  2F2X A;  3EFS A;  5KYU A;  3BFM A;  3EG0 A;  1WHH A;  3REA B;  2A37 A;  3H41 A;  1KIK A;  2GQI A;  2KRS A;  4B9W A;  3A98 A;  1PSF A;  4KGZ B;  4AG1 C;  4J8O A;  2ZPH B;  3NGP A;  2WAC A;  3OA6 A;  2VYT A;  3M5A A;  2ZZD A;  2X35 A;  2JVV A;  3VUZ A;  4GY5 A;  4AFZ C;  2EIF A;  4MZT A;  2KRN A;  4BE1 A;  2EKH A;  3CBP A;  3M55 A;  3WVE B;  1U3O A;  1ZSZ C;  4DEY A;  4PJO B;  3CD6 T;  2HL5 C;  3PGG A;  5CR2 A;  3A5Z B;  1VQK T;  2X4X A;  4Q5W A;  2GCX A;  3SWN C;  4NS5 A;  3MP6 A;  4QQG A;  3NTK A;  1WHL A;  1DJ7 B;  2RQU A;  2L3P A;  2NWM A;  1BIB A;  2RHI A;  4OMQ A;  4KH1 B;  5GAN 4;  1K73 R;  2KAF A;  4F7U B;  4HCC A;  1OI1 A;  3U23 A;  2YLC A;  2XKO C;  5FU7 C;  1NJI R;  2CP7 A;  1S72 A;  1BI2 A;  1K4U S;  2LCC A;  3CCR T;  4RTU A;  1MV3 A;  1VQ8 A;  2KK4 A;  1OOT A;  1RAA B;  2M1H A;  1D1B A;  2X51 A;  3NTI A;  1BI1 A;  1VQP A;  4E47 A;  1LPL A;  4MZM A;  1G3W A;  2RQT A;  4M75 E;  1KFZ A;  2DTH A;  2ZPE B;  3L2Z A;  1D09 B;  3UWN A;  2BZX A;  2MAM A;  3GOX A;  2DL3 A;  3A8L B;  2CSQ A;  2NUP A;  1KD1 R;  3LX7 A;  1N5Z A;  3VJP A;  3CMA A;  1PWT A;  2FL7 A;  4O5V A;  2YRV A;  1KQS S;  4BDY A;  2KGT A;  1LOJ A;  4C5E A;  4HCB A;  1LNX A;  3SB2 A;  3OYM A;  3CME T;  4Z88 A;  3OBY A;  2CUD A;  5GMK e;  2J6O A;  5DY9 A;  2LQW A;  2DX1 A;  3SWN A;  1BBZ A;  3G4S Q;  1D3B B;  2EQM A;  2X4J A;  1TU0 B;  2YRD A;  3V7C A;  3P8B B;  3X28 B;  2HCK A;  4C0G A;  2XID A;  2YUP A;  3I9Q A;  2KY9 A;  4HVU A;  4DBR A;  3JB9 J;  2YUQ A;  2X3W D;  1Y96 B;  2CZ7 B;  3OYD A;  3SWN B;  4J5Y A;  2XK0 A;  3CMA Q;  3EH1 A;  2ZAE A;  1WJR A;  5DLQ E;  3G6E Q;  3HRS A;  1J3T A;  3M53 A;  2E12 A;  1GRI A;  4M7A A;  1D0Y A;  2LJ0 A;  4M77 E;  2DL7 A;  2XU8 A;  1W70 A;  4LD9 K;  3P8H A;  2B8A A;  3UT1 A;  4KUD K;  5A0D A;  4E7S A;  3OQ5 A;  3VV0 A;  2E64 A;  4JZ3 A;  1YJ9 T;  1SF9 A;  1Q7Y C;  2FRW A;  2JUF A;  3EHQ A;  2GGR A;  4K11 A;  2O9V A;  4M7D C;  2QEX Q;  1N8R U;  2E65 A;  2JXB A;  2W0Z A;  3VS3 A;  4WCI A;  1VQ6 T;  1SHF A;  5IHK A;  1RAH B;  2OAW A;  4D6W A;  1FYN A;  4XU0 A;  5J26 A;  4L59 A;  4M7D D;  5M9O A;  2RI5 A;  2KE9 A;  3CCV Q;  1N27 A;  1GCP A;  1H3Z A;  2EGC A;  2EKO A;  3REB B;  5IAY A;  2ZPI B;  2EJG A;  4ZGJ B;  3OSV A;  5FRO A;  4DA4 A;  1G3S A;  2VVK A;  3QWX X;  1TS9 A;  2JMA A;  1WZO A;  1Q82 R;  2K6D A;  1QWE A;  3NHN A;  2DE0 X;  1MGQ A;  3A1P A;  2HL3 A;  2D6F A;  4ZNX A;  1NPP A;  3IQL A;  1WJS A;  4M78 E;  3CEY A;  3UDC A;  4M77 G;  1I5O B;  1AWW A;  4QVC A;  3C94 A;  5EC7 A;  1PKS A;  1JBM A;  3M54 A;  3G7Z A;  1BI3 A;  4ZN1 A;  5GMK i;  2L3Q A;  1VQP Q;  3PIP A;  1I0C A;  1VQ4 T;  1UGP B;  3M0T A;  2AZV A;  1CSK A;  1Y57 A;  3KXT A;  3PVL A;  1UHF A;  1W1F A;  2ZCF B;  2JOY A;  4Z02 A;  2ZGW A;  2K2M A;  4VUB A;  3E1S A;  3QZ9 B;  1MMN A;  1SEM A;  3S3M A;  4LDU A;  5J3B A;  4AFQ C;  1FMK A;  4RTZ A;  1K9A A;  4IUP A;  3RIR A;  1S72 T;  2E1H A;  1Q86 R;  4PLL A;  3MPU B;  2HQH A;  1AEY A;  2PTK A;  4C92 A;  3OYG A;  4RTX A;  5C6S A;  1N6A A;  1VQ6 A;  1GCQ A;  4C92 D;  5FRM A;  1QP3 A;  3SD4 A;  2ED1 A;  3SHW A;  4CC4 B;  4D8K A;  2V8K A;  1M27 C;  1KG1 A;  1HSQ A;  3EHR A;  5GAM g;  1D3B A;  2QTV A;  4PJO G;  2QA4 A;  1YJ9 A;  1M8M A;  1JJ2 P;  2FO0 A;  3CC4 T;  2ROT A;  2KBT A;  3WVD B;  4A63 B;  2PUO B;  1NZ9 A;  3VYG A;  2RHZ A;  2DL4 A;  3VUB A;  3M0Q A;  1PCX A;  1YBY A;  3CXC A;  2DM1 A;  4C92 E;  3JB9 F;  2XI9 A;  2WSF E;  4OB2 B;  4QQD A;  1Y7X A;  4LN2 A;  3CC7 T;  4Z8A A;  5KYX B;  4HT8 A;  1I81 A;  1WHG A;  1XJW B;  2F2W A;  2RN8 A;  4JS5 A;  1D0Z A;  2R57 A;  1YWP A;  1YJW A;  4BB7 A;  4OMF B;  1VQO A;  4PJN A;  4LD6 A;  3ZBD A;  2COY A;  5J39 A;  1WHK A;  3GNG A;  4J6X A;  4M78 C;  2Y90 A;  2JM8 A;  1SRL A;  3CCJ Q;  3OW2 P;  3OS1 A;  1FMV A;  3CME Q;  1G83 A;  2RJC A;  3QHS A;  3PFS A;  1X2Q A;  1M2V B;  2A0F B;  3CC2 A;  5GMK h;  1AZE A;  8AT1 B;  3C0C A;  2WSE E;  3LWH A;  1K76 A;  2JW4 A;  2QG9 B;  4E7I A;  1Q7Y R;  4XU3 A;  2QDY B;  1FXX A;  2LZ6 B;  2EYZ A;  1OZ2 A;  4IIM A;  1OV3 A;  1LVK A;  4J9F A;  2MWO A;  3QDR B;  1YJN T;  1VIF A;  1VQO Q;  2DD5 A;  2GTO A;  2F2V A;  9ATC B;  5CO7 A;  1M4Z A;  1EX4 A;  2LQN A;  3KUF A;  3GIB A;  4A53 A;  1KHC A;  2PNI A;  4BUG A;  3H9N A;  1RUW A;  4M7D E;  4RUG A;  3A8M B;  2D0N A;  4QVD A;  1KC8 C;  3ULR B;  1IRX A;  2CP6 A;  2C0O A;  3CCV A;  5KYU B;  1HXD A;  2A3L A;  4ZGD B;  4J9I A;  2L8D A;  4JRQ A;  2J6F A;  3VS2 A;  2OX7 A;  3CPW S;  1YJW Q;  3JB9 H;  2ZPG B;  3JB9 D;  1GXI E;  4ORZ A;  4B6M A;  2OTL T;  4NL2 A;  3FEO A;  1OX8 A;  2HAX A;  2J06 A;  2YXY A;  1N9S A;  3OYA A;  2FZK B;  4V2S A;  2K5F A;  4CC3 A;  4DBH A;  1VQL A;  2RJD A;  1I4K 1;  1K0S A;  1ZQ1 A;  4HT9 A;  1TUD A;  1PKT A;  3J7A F;  2B86 A;  1ACM B;  1KHI A;  2ENM A;  4RG8 A;  1M90 R;  3CCR A;  2GNC A;  3TCJ A;  2RH2 A;  4M75 G;  1K73 U;  1NE8 A;  4PFZ A;  4FT2 A;  1M2V A;  3H0F A;  4FSS A;  1A0N B;  4HVW A;  2HZY A;  2KXC A;  1WQ7 A;  1UGS B;  4C92 F;  2O4X A;  1BI0 A;  1QKW A;  1NJI U;  3PMT A;  2JT4 A;  3NFC A;  4KGV B;  4PK4 A;  2CGH A;  4QKU A;  3QJ6 A;  2KVQ G;  4BI4 A;  2Y4X A;  4D8D A;  4DOV A;  5IHN A;  3MEW A;  2CZ0 B;  1SKU B;  2QQ9 A;  1OPK A;  5GJV B;  2NYS A;  2JNG A;  5GAO l;  3RKW A;  2LNV A;  3HRT A;  3LGL A;  4C5I A;  2BUD A;  1JB0 E;  3E9F A;  1PD0 A;  3X20 B;  4XTW A;  4RG2 A;  3JV3 A;  2VAS A;  5GAM d;  2X4W A;  3DLL A;  4PJJ A;  4OB3 B;  2BE9 B;  4J9D A;  3CCQ A;  2PZ1 A;  4E7J A;  3I55 Q;  5LJ3 f;  3CCS A;  2EGA A;  4WTO B;  2GFA A;  2DL5 A;  3RDV A;  2QTX A;  2K3Y A;  2C0T A;  4JJN K;  1B7T A;  3H8Z A;  1IHW A;  1G3Y A;  3VRY A;  2OJ2 A;  2QK0 A;  1RAF B;  2KT8 A;  4F7U F;  2EWN A;  5IXB A;  1Q81 U;  3S3O A;  3BE3 A;  4J7F A;  2RHX A;  3MKD A;  1M3B A;  1KK7 A;  1XNI A;  3NMZ C;  2DYB A;  4BY6 B;  5GAO n;  2CSI A;  3PMI A;  2HQX A;  4LNP A;  4EMK A;  3URG A;  1Q81 C;  2EYW A;  4PFP A;  2RK1 A;  5GAN 3;  5CCA A;  3UPU A;  1BK2 A;  4JZ4 A;  1RAI B;  3ME9 A;  3JCM d;  1NYF A;  4JLG A;  1MMG A;  1XOV A;  4MZP A;  1RAC B;  5GAM h;  3P8D A;  2RQW A;  3G6E A;  1NEG A;  4C5H A;  1F1B B;  4RKU E;  4AMC A;  2E41 A;  2O01 E;  3CME A;  2AZS A;  1W2B P;  1YJN Q;  4L5G A;  2O88 A;  3QYG B;  2K3X A;  2K2V A;  1V76 A;  1VQ8 T;  1HD3 A;  1W4S A;  3MET A;  3AHU A;  3JAM E;  4M7A G;  3QJY A;  2NUP B;  4C8Q B;  2LJ3 A;  2MMP A;  3I35 A;  1YN8 A;  2QEX A;  4EIK A;  3LYI A;  2M0O A; 
#chains in the Genus database with same CATH homology
 4PJO D;  3CBM A;  4JUV A;  4LDV A;  5GAN 7;  4LDY A;  5LL6 S;  3QKJ A;  1M9S A;  4D6W A;  1M8V A;  3QBY A;  1NPR A;  3CCQ T;  1YIJ A;  4XU0 A;  5J26 A;  4L59 A;  4M7D D;  5M9O A;  3FRN A;  3OYH A;  3INZ A;  4BY6 C;  2QXF A;  2QQR A;  4KBM B;  5FU6 B;  1X75 C;  2VXF A;  3OYL A;  4A54 A;  2JTF A;  5CQX A;  5GAN h;  2RI5 A;  1M1G A;  2PQW A;  5CKB A;  2K57 A;  5LJ3 e;  1UGQ B;  2RM4 A;  4CRI A;  1IRE B;  1N27 A;  4M75 D;  3QZ5 B;  1R8O B;  1H3Z A;  4M7A B;  3V8J A;  1G5V A;  2EKO A;  3CXC S;  5GAN e;  2EQJ A;  5IAY A;  1X6O A;  2P0P A;  1Q82 C;  4P5N A;  4XTV A;  5A0G A;  1WJQ A;  2IVW A;  2R5M A;  2ZPI B;  5CQY A;  3GP8 A;  4C92 G;  1LJO A;  2DEQ A;  2E5Q A;  5D6W A;  5I2M A;  2EJG A;  4ZGJ B;  3OSV A;  5FRO A;  4DA4 A;  2RI2 A;  1G3S A;  2E70 A;  1K9M U;  1N9R A;  1UEB A;  1Y96 A;  4PJO F;  3OYK A;  1YI2 A;  5D6Y A;  4BE0 A;  4M78 G;  3L1A A;  2LT1 A;  5GAN f;  1MGQ A;  4F7U G;  2D6F A;  1Y07 A;  2A7Y A;  2NLU A;  1NPP A;  4XAX B;  1WJS A;  3EAE A;  3OYC A;  5FU6 C;  3RUX A;  4M78 E;  3CEY A;  3OB9 A;  3JB9 I;  3RMS A;  3UDC A;  1H64 1;  5GAN 6;  3I55 A;  2OTL A;  1VQ7 T;  4FT4 A;  4M77 G;  2MI6 A;  3CCL T;  4QVC A;  2VC8 A;  3MCA B;  4C0D C;  4Y91 A;  2JTM A;  3C94 A;  3G71 A;  4EDU A;  3WXM B;  2HBP A;  4IUV A;  3OS0 A;  1JBM A;  2XDP A;  3M54 A;  5LJ3 h;  3G7Z A;  4BI8 B;  3HKS A;  1BI3 A;  3RKX A;  4C8Q A;  1UB4 A;  4ZN1 A;  5GMK i;  3J80 E;  3PIP A;  4CI0 C;  3J81 E;  3PNW C;  3E19 A;  1VQ4 T;  1UGP B;  2FB7 A;  4C8Q G;  3RES A;  4C0Z A;  4M75 A;  4M78 B;  4MML A;  5CK9 A;  3A8O B;  2KMT A;  3HPW A;  2E6Z A;  3KXT A;  2HQE A;  2ZCF B;  2L89 A;  2RD1 A;  1VQ5 T;  3ZFJ A;  5GAN 2;  2M16 A;  1VQM T;  5GAN j;  5C0M A;  3X25 B;  2EQK A;  2VV5 A;  2IG0 A;  2JOY A;  4J6W A;  4MMK A;  4Z02 A;  1VQ9 T;  1VQN A;  2LDM A;  3CCJ A;  2OAU A;  3VYH B;  3CBO A;  5GAM f;  2ZGW A;  3OS2 A;  2BIV A;  4VUB A;  3E1S A;  3QZ9 B;  4M78 A;  1OZ3 A;  1O75 A;  3I56 T;  3S3M A;  1PSE A;  4LDU A;  4XTZ A;  5J3B A;  3L2U A;  3L2W A;  1W2B A;  4JS4 A;  3QSU A;  2EJ9 A;  3HHT B;  4IUP A;  1KC8 U;  2DXC A;  2C06 A;  1QVP A;  4FL6 A;  3RIR A;  2E1H A;  2DVE A;  4C0F A;  1YJW T;  4BD3 A;  3QYH B;  1S72 T;  1M90 C;  2JZ2 A;  4OGC A;  4M75 B;  5L8R E;  4PLL A;  4JRI A;  5EG2 A;  4C92 A;  3OYG A;  3S6W A;  4JDS A;  4ZTF A;  2F5T X;  5C6S A;  1N6A A;  1I5L A;  1VQ6 A;  3CCL A;  4C92 D;  4QVZ A;  5FRM A;  1QP3 A;  3OYE A;  3HRU A;  3SD4 A;  3L2Q A;  3G4S T;  3CCU T;  1B34 B;  5IT9 E;  1M1F A;  3JCM b;  1Q86 C;  4IUR A;  4EMK C;  4IUQ A;  3LGF A;  3TU4 K;  3MP1 A;  3JCM P;  5I21 A;  2V8K A;  1VIE A;  1KG1 A;  2H3J A;  2WSC E;  4OP0 A;  3G71 T;  3M4Y A;  2RA2 A;  1QVF A;  5GAM g;  1D3B A;  4BAC A;  1QW1 A;  4PJO G;  3JCM g;  2QA4 A;  1RI0 A;  1YJ9 A;  2RJE A;  4M75 F;  2RHU A;  4ME7 A;  4IUU A;  4C8Q E;  1YIT T;  1U1S A;  2FVU A;  1K8A C;  1JJ2 S;  3CCE T;  3OW2 S;  3CC4 T;  2KSS A;  5GAO q;  2DIG A;  2XDB A;  1VQL T;  1KQS A;  2YLB A;  1Y71 A;  3WVD B;  1YHQ T;  1QVG S;  2PUO B;  1NZ9 A;  3VYG A;  3HFO A;  3RMQ A;  1VQK A;  2F5K A;  1KD1 U;  2RHZ A;  4N4G A;  4II1 A;  4XTX A;  3OYB A;  2P4T A;  3C95 A;  3PTA A;  1YCY A;  2HNI A;  4PL6 A;  3VUB A;  5LJ5 j;  1YBY A;  3CXC A;  4BI3 A;  1XTD A;  3QO3 A;  4C92 E;  5HKC A;  1W2B S;  3JB9 F;  3JCM W;  2EFI A;  4F7U E;  2XI9 A;  4PJO A;  2WSF E;  4OB2 B;  4QQD A;  1BYM A;  4DOW A;  3G6E T;  1I8F A;  1Y7X A;  4M77 A;  3CC7 T;  1M1K U;  4N4I A;  3HSB A;  3TEE A;  1VUB A;  2VGN A;  1YHQ A;  4ZTJ A;  1VQ4 A;  5GMK l;  3DB3 A;  4OB0 B;  1U1T A;  2DTO A;  4HT8 A;  3S3N A;  2CZ1 B;  1I81 A;  2OTJ A;  2LRQ A;  4FIB A;  3ZEH A;  4JS5 A;  3LH0 A;  3X26 B;  5AYF A;  1JRI A;  2R57 A;  5GAN g;  2FYK A;  4OMF B;  4BB7 A;  1VQO A;  5KE3 A;  1YJW A;  2DPP B;  4JRK A;  1M90 U;  4C92 B;  2I2L A;  4C92 C;  4M7A F;  3MEU A;  3JCM Q;  4A4K A;  4JRP A;  2DZC A;  1K9M C;  4LD6 A;  2CKK A;  1IZ6 A;  2DZ9 A;  3ZBD A;  4X9D A;  3M59 A;  1X01 A;  2FHD A;  5J39 A;  1HK9 A;  3CC7 A;  4MDX A;  2D0Q B;  1QVF S;  1OYX A;  3GNG A;  3LWI A;  4FU6 A;  3SFM A;  4J6X A;  4C5G A;  2RK2 A;  4M78 C;  3PIO A;  2DXU A;  2EQU A;  2RJF A;  2Y90 A;  2V8J A;  4M77 B;  5CKD A;  2OTJ T;  5GAO r;  1FX7 A;  3DLM A;  2QQA A;  2BKD N;  2DTI A;  3OSS C;  3OS1 A;  1QVG A;  2E6N A;  3X24 B;  3FC3 A;  4BE2 A;  2RJC A;  2HD0 A;  3CCV T;  3QHS A;  4KT0 E;  3PFS A;  4F7U A;  2MWP A;  4KUI A;  3CCJ T;  3OMC A;  2DJZ A;  3CC2 A;  3JB9 G;  5GMK h;  2LTO A;  4N4H A;  4XQ3 A;  3ASK A;  3MO8 A;  2VGM A;  3LW5 E;  3C4S A;  5IN1 A;  3QUI A;  4R55 A;  2WSE E;  4M78 D;  3LWH A;  3SDZ A;  5CKH A;  2GFU A;  4EMH A;  4UC4 A;  5FLX E;  1ZHI A;  4Y28 E;  4C8Q C;  3OMG A;  4M77 F;  1TH7 A;  4R56 A;  2LCL A;  2DO3 A;  4E7I A;  4XU3 A;  5GAO m;  2LC4 A;  2QDY B;  1FXX A;  3NTH A;  1OZ2 A;  1N8R C;  2XIC A;  4OGE A;  2G3R A;  3T9N A;  4M78 F;  3MEV A;  3CC2 T;  1YIT A;  5LJ5 g;  1UGR B;  2MWO A;  1M5Q 1;  3MEA A;  3Q1J A;  3GNF B;  5CKF A;  4A4F A;  3QDR B;  4ZGE B;  4XK8 E;  5KCO A;  3I56 A;  3CCS T;  2K4Y A;  4QQ6 A;  1YJN T;  4RCC A;  1VIF A;  3BW1 A;  2QQS A;  2DD5 A;  4C0D B;  4C8Q D;  4BDZ A;  3C12 A;  3TRE A;  4J83 A;  1Q86 U;  5CO7 A;  1M4Z A;  4FM4 B;  3KUF A;  1VQO T;  1K73 C;  4A53 A;  3GIB A;  1KHC A;  4PNO A;  2GF7 A;  4BUG A;  2E10 A;  2PVG B;  3OYY A;  4KUL A;  1VQP T;  4NL3 A;  5FU7 B;  3KBG A;  3MP8 A;  4M7D E;  1WNL A;  2CYZ B;  1BKB A;  3A8M B;  4QVD A;  1Q7Y U;  4XTU A;  3EFS A;  3JRZ A;  3QPH A;  2DKG A;  4J6Y A;  4EMG A;  3BFM A;  1KC8 C;  4PJO E;  4MDW A;  5LJ3 g;  3CCV A;  4PKC C;  4HKE A;  4B9W A;  1PSF A;  2XD0 A;  4J8O A;  2ZPH B;  2WAC A;  4YTL A;  3OA6 A;  1HXD A;  2VYT A;  2A3L A;  3M5A A;  2ZZD A;  4ZGD B;  2X35 A;  3JCM X;  2JVV A;  2QEX T;  4XU1 A;  2L8D A;  2F69 A;  3VUZ A;  4JRQ A;  2D9T A;  4GY5 A;  1U8R A;  3CPW S;  2EIF A;  3H6Z A;  3HP9 A;  3OS5 A;  3JB9 H;  3M9Q A;  2ZPG B;  4A4E A;  3JB9 D;  1GXI E;  4MZT A;  3FDR A;  3MHX A;  4BE1 A;  4GLK A;  2VUB A;  2OTL T;  1VQ9 A;  3V8K A;  2GQV A;  3CBP A;  3M55 A;  4NL2 A;  3WVE B;  3FEO A;  3JCM h;  5KH6 A;  3L2V A;  4LDX A;  4M7D A;  2HAX A;  5GMK m;  3JCM J;  5HK0 A;  2CS7 A;  3QG1 A;  1N9S A;  5KE2 A;  3OYA A;  3RER A;  3A8G B;  4V2S A;  5HY6 A;  2LT4 A;  2K5F A;  4PJO B;  3O8V A;  3OYI A;  3CD6 T;  1QP2 A;  1YJN A;  2XDD A;  2O4X B;  3PGG A;  5GAM e;  5CR2 A;  2RJD A;  3A5Z B;  2LVM A;  1I4K 1;  1VQK T;  5LJ5 f;  2PU9 B;  1ZQ1 A;  2X4X A;  4C8Q F;  4HT9 A;  4Q5W A;  4TVR A;  2GCX A;  3SWN C;  4NS5 A;  3CD6 A;  3MP6 A;  2X4Y A;  3J7A F;  5I2S A;  4M7D G;  4QQG A;  5LJ3 d;  3NTK A;  3V8L A;  1DJ7 B;  1KHI A;  2CZ6 B;  4RG8 A;  1V29 B;  3FLG A;  4M7A C;  2L3R A;  3JCM c;  1KQ1 A;  3CCR A;  2RI3 A;  2MF2 A;  1BIB A;  4ZN3 A;  5GAN d;  2RHI A;  5GAN 8;  3TCJ A;  2RH2 A;  4M75 G;  5GAN 4;  1K73 U;  1NE8 A;  2LX9 A;  4N0A A;  2KAF A;  4FT2 A;  4E7L A;  4J7I A;  4F7U B;  4HA8 A;  4EPC A;  3R6O A;  4HCC A;  2RHY A;  4XU2 A;  2YHT A;  1WQ7 A;  1OI1 A;  2DAQ A;  2LQ8 A;  3F70 A;  2PVO B;  1UGS B;  2YLC A;  5CIU A;  2O4X A;  4C92 F;  1BI0 A;  2XKO C;  5FU7 C;  1NJI U;  3PMT A;  5LJ5 h;  1S72 A;  1BI2 A;  3NFC A;  2Y4Y A;  4X9C A;  3FB9 A;  4M7A D;  2CGH A;  2LCC A;  3CCR T;  5HK3 A;  4OF1 A;  2ZPF B;  3QJ6 A;  2KVQ G;  1VQ8 A;  2KK4 A;  3HL8 A;  4HCZ A;  2Y4X A;  4XTY A;  4BI4 A;  2M1H A;  4DOV A;  4RCB A;  1MHN A;  3MEW A;  2CZ0 B;  3NTI A;  4NOY A;  1BI1 A;  2M9U A;  2QQ9 A;  4O6J A;  4E47 A;  1VQP A;  4MZM A;  4OB1 B;  4PLI A;  1G3W A;  2JNG A;  2XG8 D;  4M75 E;  5DM7 R;  1NJI C;  2DTH A;  3M56 A;  3BY7 A;  5GAO l;  2VXE A;  2ZPE B;  3L2Z A;  3BDL A;  2LNV A;  1B34 A;  3HRT A;  3RKW A;  3UWN A;  3LGL A;  3GPL A;  2MAM A;  2DIQ A;  4C5I A;  2BUD A;  1JB0 E;  3GOX A;  3A8L B;  2RO0 A;  3E9F A;  3OY9 A;  2DXB A;  3LX7 A;  3ER0 A;  4FSX A;  3X20 B;  5GAM j;  4XTW A;  3V7R A;  3VJP A;  3GLX A;  1ZBX A;  4RG2 A;  3CMA A;  4IUT A;  2XHC A;  5GAM d;  2QA4 T;  5KCH A;  2FL7 A;  2X4W A;  3DLL A;  1Q82 U;  4O5V A;  1JJ2 A;  2YRV A;  4OB3 B;  3OYN A;  3OW2 A;  3CCQ A;  1YIJ T;  1P92 A;  1KQS S;  3CC4 A;  4E7J A;  4BDY A;  1M1K C;  2P0K A;  2PVD B;  4ELY C;  1BIA A;  1LOJ A;  2V8I A;  3M58 A;  5LJ3 f;  4C5E A;  3JCM e;  3CCS A;  4HCB A;  1LNX A;  3SB2 A;  3E9G A;  5CAI A;  4M77 C;  3M57 A;  2GFA A;  3OYM A;  3I55 T;  2DXT A;  3DB4 A;  3CME T;  1WPY A;  2K5I A;  2EJF A;  3OBY A;  4N0A C;  2QQB A;  1VQL A;  1VQM A;  1VQ5 A;  3QII A;  2PUK B;  4OVA A;  5GMK j;  5GMK e;  3FJP A;  2QTX A;  2K5L A;  1SSF A;  3G4S A;  3CCU A;  1O9S A;  2K3Y A;  4L6V 5;  5DY9 A;  1YI2 T;  2AHJ B;  5A0L A;  3OYF A;  5FRN A;  4JJN K;  4M7A E;  3H8Z A;  3SWN A;  1G3Y A;  4EMK B;  2EAY A;  1D3B B;  2EQM A;  2X4J A;  4M77 D;  4ELZ C;  3V7C A;  3P8B B;  4JLI A;  2EWN A;  4LDW A;  3X28 B;  2JN0 A;  4C0G A;  4F7U F;  3S3O A;  4J7F A;  2RHX A;  3V7S A;  1Q81 U;  2XID A;  4A4G A;  3RKY A;  2KY9 A;  1XNI A;  3JB9 J;  3CPW A;  4BY6 B;  1XQH A;  1AHJ B;  2DK3 A;  5CVI A;  5GAO n;  4ATO A;  3PMI A;  5A2Q E;  2HQX A;  1Y96 B;  4E7K A;  2CZ7 B;  5CKE A;  3BDU A;  4EMK A;  1KD1 C;  3OYD A;  3SWN B;  3URG A;  3CCM A;  3FIF A;  1Q81 C;  3JSC A;  3LLR A;  4J5Y A;  2R58 A;  3N5B B;  2XK0 A;  2EYQ A;  2RK1 A;  3VU3 C;  5GAN 3;  5CCA A;  2KQW A;  3UPU A;  4B9X A;  1WGS A;  2L5Q A;  1WJR A;  5DLQ E;  4M7D F;  3HRS A;  2ZPB B;  3M53 A;  3ME9 A;  3OBW A;  3L2R A;  3JCM d;  1K8A U;  2E12 A;  4JLG A;  3CMA T;  2KDS A;  5LJ5 d;  1XOV A;  4RMO A;  4M7A A;  2LQK A;  3GF5 A;  4MZP A;  4M77 E;  3M4G A;  3P8D A;  5GAM h;  3G6E A;  3VKI A;  2DD4 A;  4C5H A;  2XU8 A;  1VQN T;  4LD9 K;  3P8H A;  2B8A A;  3UT1 A;  1EIF A;  1RL2 A;  4KUD K;  4RKU E;  5D6X A;  1G3T A;  4A4H A;  2E41 A;  3EFR A;  2O01 E;  5A0D A;  3OQ5 A;  3OYJ A;  4QW2 A;  3CCM T;  4E7H A;  3VV0 A;  3CME A;  2E64 A;  1YJ9 T;  2R5A A;  4L5G A;  3JCM f;  3L42 A;  5LJ5 e;  1VQ7 A;  4PJO C;  1Q7Y C;  3QXE B;  2JUF A;  3QYG B;  2K3X A;  5LJ3 j;  2K2V A;  4M7D B;  1VQ8 T;  2RB6 A;  2P0Q A;  1W4S A;  3MET A;  3HFN A;  4M7D C;  3AHU A;  4WF2 A;  4DQ2 A;  3JAM E;  1N8R U;  1KQ2 A;  4M7A G;  3QJY A;  2E65 A;  3DKM A;  3PT9 A;  4C8Q B;  3CCE A;  2MMP A;  5GAO p;  2QI2 A;  5DLO A;  3A8H B;  1WQW A;  4M75 C;  5GAN 5;  3JCM V;  2QEX A;  3LYI A;  4X34 A;  2M0O A;  1VQ6 T;  1FWZ A;  4IKF A;  3CPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...