2RI3A

Crystal structure of the 3-mbt repeats from human l3mbtl1 with n358q point mutation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
315
structure length
313
Chain Sequence
SWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMQPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 75
structure length 313
sequence length 315
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A03
2RI5A 3ME9A 4IUQA 4QQDA 3LH0A 2D9TA 2G3RA 3DB3A 5CIUA 2PQWA 2GFUA 2JTFA 4QVZA 3LYIA 3L42A 3Q1JA 3QIIA 3OQ5A 3PNWC 4PL6A 5D6XA 2JZ2A 5D6YA 4L59A 5FRMA 2RHUA 2R57A 2FHDA 2BIVA 3OY9A 3MP6A 4BE1A 3F70A 2EQJA 2X4XA 1OZ2A 2XDPA 3ASKA 3GOXA 2M16A 3OA6A 4BE0A 2E6NA 2QQRA 2K3XA 4CRIA 2B8AA 4HCZA 1OZ3A 2HQEA 2P0KA 3OMGA 3UT1A 5KCOA 3FC3A 3E9FA 2YRVA 3OYIA 5D6WA 2QQSA 5KE2A 4PLLA 4ZTJA 3LX7A 3ZEHA 5FRNA 2M0OA 2M1HA 4GY5A 5J39A 1WJQA 3OYAA 1H3ZA 3L2RA 3OS1A 2VYTA 2MWPA 4IURA 4B9XA 4BDYA 4E7IA 3S3MA 2RJCA 3MP1A 2DIQA 5M9OA 1OI1A 4Q5WA 3L2VA 1RI0A 2RHXA 2BKDN 3MO8A 3OS2A 4X34A 1WJRA 2R5MA 2DIGA 3MEVA 4IUPA 2F5KA 3S3NA 2CKKA 4QQ6A 3L2UA 3OYCA 3NTKA 4BE2A 3DLMA 3FDRA 1WGSA 3H8ZA 5C0MA 2RHYA 3KUFA 2RHZA 2EQKA 2IG0A 2MWOA 4RG2A 3OYFA 3OYJA 4C5GA 4BACA 4N4IA 4IUTA 3UWNA 3OYDA 3OYMA 5KE3A 1N27A 2O4XB 5KH6A 2LCCA 2L89A 4PLIA 4E7LA 2XK0A 3C4SA 3OYLA 4QQGA 4B9WA 3QKJA 4QW2A 4IKFA 2BUDA 5C6SA 3CEYA 3OYEA 4ZTFA 3L2QA 3SD4A 3O8VA 3QBYA 3LGFA 5FROA 3H6ZA 3S6WA 3PMIA 4E7KA 1G5VA 4N4GA 2X4WA 3OS0A 2L3RA 5IAYA 2E5QA 3LGLA 3NTIA 3OMCA 4IUUA 3META 4E7JA 2GFAA 2LVMA 2R58A 3OYKA 4UC4A 4OVAA 4FL6A 1KHCA 3OYBA 3OYHA 4NS5A 2WACA 4LD6A 4II1A 4Z02A 2RJFA 2LRQA 4A4GA 5KCHA 2EFIA 2X4YA 3FEOA 2EQUA 3E9GA 3L2WA 3S3OA 2K3YA 2L8DA 4EDUA 1MHNA 2LDMA 3FLGA 3PFSA 2HQXA 5IN1A 2X35A 2EKOA 2R5AA 4BD3A 3MEAA 2DAQA 2RO0A 3MEUA 3P8HA 1XNIA 3M9QA 3P8DA 4FU6A 4E7HA 2RJDA 4C5IA 2LTOA 4A4EA 3OYGA 2EQMA 2O4XA 4BDZA 2RHIA 2RI3A 2RJEA 1OYXA 3PMTA 1SSFA 4N4HA 4A4FA 3OB9A 3MP8A 3EAEA 3DB4A 3BDLA 3MEWA 3QJ6A 2NLUA 3NTHA 4IUVA 5J26A 4C5EA 2GF7A 2RI2A 4C5HA 3LLRA 3OYNA 1WJSA 4A4HA
chains in the Genus database with same CATH superfamily
5FWBA 3ME9A 2RK2A 2RD1A 4M7AB 4QVZA 1X6GA 5IHNA 4M75A 1HSQA 3CCMT 2KGTA 1WQ7A 1K73R 4RCBA 3HSBA 1D3BA 1GBQA 2X9HA 1YJWA 3CCST 2YT6A 1U1TA 4FM4B 2KNBB 1WA7A 5GANj 1OZ3A 1VQOA 3CCQQ 4R56A 5FRNA 2M0OA 4F7UF 3JCMd 4M7AD 2LX7A 4PJOC 2DIQA 5LJ5j 3M53A 1U06A 2J6OA 1S72T 2QK0A 4IUPA 4M77C 1VQ8Q 1WHKA 2YSQA 4X1VA 1MMNA 4C0FA 1M9SA 3G4ST 5C0MA 1R0BG 3PIOA 3CCQT 1LJOA 4AT1B 4N4IA 1JJ2P 1W2BS 4MDWA 1YI2T 3I5RA 4PLIA 2XK0A 1M90U 4XTUA 3FJ5A 2PVDB 2BUDA 2QDLA 3EFSA 1SSHA 4PJJA 1M30A 2E41A 4D8DA 1OX8A 1RAGB 1TG0A 3MKDA 2VC8A 3BDUA 2A7YA 5LJ3f 1NM7A 4KH1B 3OYHA 2WACA 1YHQA 1E6HA 1MV3A 3VJPA 5CO7A 3CBOA 1RL2A 3RNJA 1ZBJA 1KQSA 1PRLC 2VXEA 4M75C 2LTOA 3PE0A 1JQQA 2RJEA 3EH1A 3AT1B 3NTHA 5J26A 4C5EA 4XTYA 1QLYA 2CP0A 2OTLQ 3RESA 1VQNQ 5KYYB 4QQDA 1UTIA 5KYXA 3JB9J 2HCKA 5A0GA 1KHIA 2X3XD 2KRMA 2GFUA 3BY7A 1C0MA 2DTHA 4A54A 1JJ2S 2JZ2A 2D0QB 5FRMA 1ZSZC 1BYMA 1OZ2A 3QZ9B 2VUBA 3PGGA 4JJNK 2JTMA 1Q7YC 2OTJA 2EGAA 1UDLA 2J6FA 2RQUA 1DJ7B 4VUBA 1AD5A 4L6V5 2O9SA 2QEXQ 1UHFA 2A0FB 4M4ZA 2KRSA 4J6XA 2F5KA 3UA6A 1MMAA 4JRKA 2RQVA 1TOVA 5GANg 4BE2A 1TU0B 3CCET 3CCUA 5GAN6 1IHWA 3KUFA 2MWOA 4P5NA 3G6EQ 2JNGA 4IUTA 1WZOA 2JOYA 2E10A 2BE9B 5L8RE 1PWTA 4M7DA 2D0NA 2Y4YA 3M54A 1KQSP 5GAMe 3QHSA 3J81E 2DPPB 1NYFA 3H0HA 2MPXC 2BZXA 3G6ET 2ABLA 6AT1B 3G71A 3CCUQ 3ER0A 3OYKA 3EG2A 1X6BA 3CCQA 2ROTA 4C92E 3CMET 1K73C 2EPDA 3DLLA 2KR3A 4DOWA 2DD4A 4CC3A 4DQ2A 1KQ2A 1G3YA 3JB9I 1S72A 1YWOA 3VV0A 5FU6C 4F17A 2DTIA 2RA2A 5D7UA 1ABQA 1M1KC 4C5IA 1D1AA 2O4XA 4BE1A 1QVFS 2JT4A 1QWEA 1VUBA 4AFQC 5CKDA 2COYA 1UECA 3PTAA 2KI7A 2MK5A 3ZBDA 4CI0C 3JCMX 4C8QC 5IH2A 3Q1JA 4HT9A 1GRIA 3GPLA 2X4JA 5D6YA 3OW2A 1Y07A 2KYBA 2AT1B 5GANd 1MMDA 2PTKA 3SWNA 1O75A 1TXQA 2DFUA 1K9MC 2AZVA 4QT7A 4JS4A 4XTZA 4BUGA 2QGFB 2XMFA 1QVGS 3HHTB 1WJQA 4FW2A 3HP9A 3C0CA 1YHQT 1ABOA 2DL8A 3N5BB 4EMKC 2R5MA 1BI2A 3CCLQ 5I21A 1MV0B 4PJLA 1WXTA 3CCVT 1M5Q1 4M7AE 3JCMf 3OYFA 3ZL7C 2L3PA 4QVCA 3CCJT 4LDWA 1QP3A 2GTJA 2KQWA 4B9WA 1KC8U 2KEAA 2FYKA 2LNVA 3L2QA 3E19A 2E5KA 1YI2A 1G5VA 2O01E 3PVLA 2X4WA 2L3RA 2E5QA 5AYFA 1Q7YR 5GMKj 4PJMA 2I2LA 4UC4A 3G4SQ 4FL6A 3OSVA 1VQ8A 1IB8A 3C12A 2HBWA 2KRNA 4XU0A 3E9GA 3S3OA 2XHCA 5GAMf 2DKGA 1G3WA 2RO0A 1PHTA 5FLXE 4FU6A 1OEBA 2QG9B 4KULA 2EQIA 4ESRA 3OB9A 3JB9F 3CCUT 3QDFA 3OS5A 2RK1A 3MPUB 4RKUE 2JUFA 1YJNA 4MZMA 2D9TA 2HQHA 4ZGDB 2LT4A 2JXBA 2KBTA 3M0SA 3GIBA 1RI9A 2BIVA 1N9SA 2RQTA 3R6OA 1JBMA 4BE0A 1UGRB 4HCZA 2FZCB 1BK2A 4PK4A 2GQIA 5KE2A 2QA4Q 1Q81R 1R8OB 1AZEA 3HPWA 5CQYA 2E64A 4AFSC 2ZAEA 1WQWA 2MWPA 2QASA 4CC7A 4E7IA 2DEUA 1GXIE 5LJ5e 2LMJA 2O9VA 2BKDN 4X34A 1NPRA 2CKKA 3OYCA 1G3TA 1SEMA 4M7AF 2DJQA 4HVUA 4Y28E 3LWIA 3TCJA 1RABB 3DLMA 2O31A 1X69A 3TSZA 1K8AR 3M4YA 3RKXA 1Q82R 4ZNXA 1WYXA 4C92C 2O4XB 2QTXA 2DETA 5KH6A 2EAYA 4QQGA 4PJOA 1IHVA 2M9UA 3D7SB 2LQKA 5C6SA 3HRSA 2J6KA 3QXEB 3CC2T 5HCKA 3PIPA 1KG1A 2COWA 1YITA 2CZ0B 2DZ9A 3EGDB 3OMCA 2V8KA 4E7JA 4XTWA 3ULRB 4HA8A 1B3QA 4GLKA 2KXDA 4J9EA 3TEEA 1NPPA 4JLIA 5KCHA 4KUDK 3QO3A 1VQ6Q 2AKKA 1YNZA 2LJ3A 3JCMV 3JV3A 4J9GA 1Z9QA 3P8DA 3REBB 4RTXA 2VB6A 2P84A 3BE3A 5DM7R 3PMTA 4M7DG 4RG8A 3EAEA 2BTTA 2QAZA 1MGQA 2FZKB 2H8HA 2CH4W 4C0ZA 3OYNA 4A4HA 2G6FX 4N0AC 2G3RA 4OGEA 2COZA 1EIFA 1PRMC 3SDZA 1YIJQ 3CCRQ 5I2SA 4L59A 5FU7C 1D0XA 3HKSA 2YLCA 1AWJA 1Q81U 4M78E 2B8AA 4OMLA 3V8KA 3CC4A 5D6WA 1RAHB 2VXFA 1KJWA 3L2RA 4M78B 2KYMA 5FWCA 4F7UB 5GANf 1W4SA 2NUTA 2LZ6B 5I22A 3L2VA 1SKUB 3OS2A 4M7DD 2OAUA 1Y96A 3NTKA 1K8AC 4OB3B 3CC2Q 1JU5C 4Z88A 2DL3A 3EG9A 3V7RA 4ME7A 1I0CA 1G83A 4N0AA 4BACA 2AZSA 3OYDA 1N27A 1MNDA 2MYSA 4L5GA 1HJDA 3EHQA 2Y90A 3VS6A 1KIKA 3EG0A 2CREA 7AT1B 2YRCA 1X27A 2MMPA 4ZTFA 2YLBA 3LGFA 4M7DE 1UHCA 1B34A 3META 3X24B 4J9CA 1BCMA 4DA4A 4ZGEB 1PM3A 4C8QD 1SHGA 2ENMA 3TVTA 1Z9ZA 4LNPA 3L2WA 2L0AA 2MCNA 1GFCA 4J9FA 3JRZA 3TREA 3SFMA 1C1AA 2LDMA 1NG2A 3QJYA 2A08A 3RERA 3GBQA 4OMNA 3JCMJ 3P8HA 2E3IA 1N8RR 1PC0A 3JB9H 3I55T 2DEQA 3LH0A 3RR6A 4FW1A 2D6FA 3L1AA 1VQ4A 2XKOC 3H9NA 1OU9A 2FRWA 1KK7A 3KFVA 1Y7XA 1TH7A 4E6RA 8AT1B 2DBMA 4PJOB 1G3SA 2E6NA 5KCOA 2P0KA 3UT1A 2DXBA 2LX9A 1VQ8T 4WCIA 2QI2A 3CCJQ 2HNIA 4C8QE 4EMHA 1IXDA 2VYTA 5KYWA 2DZCA 4YTLA 1WJRA 1M1GA 2DIGA 1BCOA 1VQ4T 3LH5A 2DYBA 3G71T 4M77D 1W2BP 3DKMA 1YJWT 2L3SA 5A2QE 2RHZA 1NE8A 1VYTA 2JM8A 1H8KA 2HAXA 1GL5A 3I5SA 2W0ZA 4XQ3A 3QWXX 3VS1A 3OYLA 5LL6S 1WI7A 4OB2B 1X01A 3UATA 3CEYA 3GP8A 2F2XA 2ZGWA 4HCCA 1EX4A 2AK5A 2FPDA 3OS0A 1XTDA 1YITQ 2A28A 2P4RA 1O9SA 2MF2A 4J7IA 3EFOB 4IUUA 4E47A 2GFAA 2YDLA 1PD1A 5GAN8 2IIMA 3L2ZA 3QG1A 2HZYA 3I35A 1PG5B 2DERA 4M78C 4LDVA 2K2VA 3SEMA 3WVEB 5IN1A 3MEAA 4PNOA 4EMKA 1QW1A 4M78A 1JXMA 3OBYA 4F7UA 1HK9A 2EGEA 3EHRA 2NLUA 1VQPA 3CC7Q 3R6NA 1VQ5T 3CC7A 2LJ1A 3A8LB 3DB3A 2EYQA 1W2BA 3JB9D 2PU9B 2KROA 1TUCA 1OPLA 1QKWA 1NLPC 2XDPA 3QSUA 2DYIA 1QVFA 1BI3A 4CRIA 1GCQC 4D8KA 4FSSA 1MUZA 3OMGA 2LCLA 3E9FA 1M3AA 4PFOA 2C0TA 4M7DF 5J39A 3QDRB 4MZPA 3KBGA 1TWBA 3V7SA 3S3NA 2V8JA 1ZLMA 1JB0E 3OW2S 3JCMh 1Y57A 2C06A 2HDAA 2XICA 4JLGA 4KGZB 3URGA 5DY9A 2EW3A 1M1KU 1N8RU 1HYOA 4RTUA 1ACMB 5GAMg 1M3BA 1UGPB 1D0ZA 2L89A 3C4SA 3PT9A 1IREB 4XU1A 1WPYA 2VWFA 3SD4A 1Q81C 4M77A 2FPEA 3CCSA 4LUDA 3H6ZA 3PMIA 4N4GA 1WNLA 5EC7A 2F2VA 4M7DC 5IAYA 3LGLA 3NTIA 3JCMb 2R58A 3CC4T 2DBKA 2P0QA 2EWNA 3CCEA 4Z02A 2VKNA 3SHWA 1YJ9Q 2NUZA 3MHXA 2HQXA 5I2MA 4NL3A 2YUOA 2CP2A 4LXCA 3CD6Q 1PCXA 1QVFP 4J6YA 1PSEA 2CP5A 4M78G 1U5SA 4PJOD 4C5HA 3INZA 1WFWA 2NWMA 4F14A 2FPFA 4FYYB 1X2QA 2F1LA 3PNWC 1YP5A 3M0RA 1CKAA 1ZSZA 1W70A 2F2WA 5FU7B 1Y0MA 3I9QA 2QEXA 5FW9A 3VKIA 3VUBA 4RUGA 1MNEA 3GOXA 3OA6A 4EPCA 2QQRA 4PFPA 4ZTJA 3VS3A 2GTOA 1AEYA 3CQTA 3LX7A 2MI6A 2HSPA 1VQ4Q 4X9DA 3CC7T 3MP1A 5EG2A 4Q5WA 2RHXA 2DLPA 4ZN3A 2PZ1A 2KDSA 3OBWA 1RUWA 2K2MA 1KFZA 2DX1A 2EJGA 4BI4A 3KXTA 4JPBW 3CPWS 3V7CA 1K0SA 4LN2A 2XI9A 2KE9A 3UWNA 4LDUA 4AG1C 1YI2Q 1D1BA 2NUPA 3OYYA 5ECAA 3QKJA 3A8MB 1CSKA 4C92A 2GNCA 4M78F 2FZGB 1CKBA 3CMAQ 5GAN5 4M7AA 2EJFA 5CKFA 3CXCS 5LJ5g 4M75B 2LVMA 3PVQA 1YIJA 1FWZA 1AZGB 4E2FB 1KHCA 2QXFA 2QTVA 2HL3A 4II1A 2LC4A 1UEBA 1M90C 2KY9A 3M5AA 1LVKA 4M75G 1VQKQ 5CVIA 1KD1R 4LD9K 1Q86R 2ROLA 1M8VA 2QA4T 2CP7A 2RI3A 3HFOA 2DO3A 3QJ6A 4XTVA 1FMKA 2GF7A 2RI2A 1NYGA 5KYUB 4J83A 4HVVA 3OSSC 4KBMB 3M0QA 3UA7A 1BIAA 2ATCB 4ANJA 3QIIA 1VIEA 4ORZA 1SHFA 2E65A 4KGVB 2PUKB 1RAAB 1GFDA 5GAMh 2P4TA 1EZZB 2YWWA 3F70A 3VU3C 4JUVA 2CT4A 2CZ7B 2PVGB 3G71Q 2HQEA 4Z89A 2QGGA 3QYHB 4M77B 2K7AA 3EGUA 3MCAB 4R55A 1OU8A 2DXTA 2DILA 2DRMA 2K4YA 2CGHA 2CSIA 1ZSGA 2XU8A 4ZGJB 1VQ9A 3EH2A 4LUEA 2E70A 1VQ6A 5LJ3h 2JJ9A 5CCAA 1D3BB 2CP3A 4MMKA 4M77F 1SRLA 4RTTA 1U1SA 3M4GA 1FXXA 2QQ9A 3JCMQ 5KYXB 1QMCA 2DK3A 1KSWA 2GCXA 1R77A 1GBRA 2DMOA 2X51A 2OTJQ 4RTWA 1S1NA 3G4SA 4ELZC 4M7AG 2P0PA 2JM9A 3P8BB 2PUOB 2RJFA 2K6DA 3CCLT 2FL7A 2W10A 2VVKA 2L2PA 4C92D 3V8LA 1BB9A 1WHHA 4BY6C 3MEUA 2RN8A 5KYNA 1UJ0A 3CXCA 4N4HA 1SSFA 1RACB 1YJ9T 5DLOA 2DXUA 3HRTA 3G6EA 1I1JA 1P92A 3CBMA 2X3WD 3G1JA 2Y4XA 1K73U 1UE9A 4PL6A 2RM4A 2CT3A 2OI3A 2ZPBB 1M2VA 3CCLA 3IQLA 2F5TX 1I4K1 1QKXA 2DTOA 1N9RA 2SRCA 2AHJB 3EG1A 4M7DB 1WHMA 4C92B 1YIJT 1NZ9A 3M0PA 2V1RA 4FT4A 4PLLA 4BB7A 1VQ7A 2EIFA 2PNIA 3M0TA 4J9DA 4PFZA 5CAIA 4EIKA 1A0NB 2FO0A 2QQBA 1J3TA 4FYXB 1B7TA 4AG2C 1M4ZA 5FU6B 3JCMP 2YXYA 1SG5A 1VQPQ 4RTZA 1TUGB 3CMEQ 3TU4K 4NOYA 3JCMe 3H0IA 4V2SA 2OTLA 3OYMA 2HEQA 2OTJT 3FIFA 2K3BA 2CZ1B 3I56A 5J3BA 1BKBA 2CSQA 3I56Q 5CKHA 4FYWB 1G2BA 1OX9A 1ZBXA 1ZUUA 5KYUA 3RIRA 3QUIA 1Q7YU 2LQ8A 4OMMA 4RCCA 4KUIA 1T3LA 4MDXA 5A0LA 3RDVA 3I55A 3AHUA 1BI1A 2KT1A 1XJWB 4ZN1A 4DEXA 5CR2A 2LQNA 4FSXA 4LD6A 1UG1A 2BZ8A 1X6OA 5CK9A 1VQMT 2K57A 1YWPA 5CKBA 2QEXT 5DLQE 2EKHA 8ATCB 1PKTA 3M9QA 3JSCA 2D8HA 3OYGA 4A4EA 1UUEA 2XIDA 1K9AA 5CQXA 3CC4Q 2MAMA 2X4YA 4ELYC 1G8XA 2K79A 3THKA 4M7AC 1ZA2B 3C95A 2JTFA 2O88A 1V76A 5GAOm 2K5IA 4OMPA 1T0JA 2RHUA 3GLXA 2FHDA 1B07A 1XQHA 2V26A 5LJ5d 5LJ3g 3OY9A 2KAFA 1E6GA 2X4XA 3CPWP 2DF6A 3RBBB 2WSFE 1IRXA 4PJNA 1UJYA 2HKQB 2DVJA 2YRDA 4GY5A 3CCVQ 1WLPB 4CC2A 1WDXA 3OW2P 2KK4A 2DVEA 1TTHB 4QKUA 2YHTA 3VS2A 2LT1A 3MEVA 1YITT 5GMKi 2LP5A 2ZCFB 1YJ9A 1Q82U 1WGSA 2LJ0A 1M2OA 2DL4A 2EQKA 4RG2A 3VUZA 2VGNA 1Q95G 1N8RC 4PKCC 3SWNB 5IHIA 3CMAA 3QZ5B 1AWOA 4JRIA 5L23A 2JS0A 2C0OA 2JW4A 2SEMA 1WHGA 1OPKA 2JMAA 1M2VB 2XDBA 4J7FA 3JCMg 3A8OB 1TSFA 4A4GA 2EFIA 2EQUA 3TQ7P 3FLGA 3X25B 1VQMQ 4KT0E 4LE9A 1JO8A 2DAQA 2QDYB 1C6VX 4XAXB 3VYHB 3UPUA 2RJDA 1LNXA 5LJ3d 4O6JA 4BDZA 1VA7A 2RHIA 1OYXA 1HXDA 3MP8A 4IUVA 2KXCA 4XU3A 3T9NA 1IO6A 1V1CA 1VQNA 2YUPA 1D0YA 5CIUA 3CCMQ 5D6XA 1KQSS 1YFNA 2DXCA 3FJPA 2KMTA 2DE0X 4K11A 4E7ZA 5CKEA 2KT8A 2NYSA 2OAWA 3ASKA 2RPNA 3JCMc 4KH0B 2PVOB 3NMZC 2QA4A 2E3HA 4C92G 4JRQA 1IZ6A 2FG0A 2V8IA 1ZX6A 2D1XA 4IURA 2KVQG 3EGDA 5M9OA 3E2UA 2A36A 5GANe 3A5ZB 2ZPFB 2V1QA 3WVDB 3FRNA 2YUQA 3FDRA 3OYJA 5GAOl 5HKCA 1VQKA 5LJ3e 1T3SA 4FT2A 4ATOA 2F69A 2LNHB 1VQLA 4E7LA 1LPLA 1X75C 1RADB 4JJCA 2ZPGB 1M1KR 4IKFA 4AMCA 1TS9A 2C0IA 3O8VA 1WX6A 4JJDA 5FROA 4C8QF 4OMQA 2ED1A 1QCNA 3A8HB 3EGXA 1FX7A 1WHLA 3CXCP 4OVAA 4C0DB 3OYBA 3RKYA 1LCKA 4O5VA 1H92A 3NHNA 1FMWA 5GANh 3M59A 1VOMA 2DA9A 4IIOA 5GMKe 2EYWA 1NJIR 2RMOA 1XNIA 3CC2A 3CPFA 2NUTB 1UGSB 1JEGA 2E1HA 3CCRT 3MEWA 5IT9E 3J7AF 3OS1A 1QQJA 4FIBA 1SF9A 1WJSA 1Y96B 5HY6A 2K5LA 3I56T 4HVWA 4CC4B 1QCOA 1UGQB 5AT1B 1VQ9T 2J7IA 3NFCA 4OP0A 1JJ2A 1QWFA 3A1PA 3RKWA 3G7ZA 4C8QA 2M16A 1VQ6T 1WXBA 1OV3A 2HBPA 1ZA1B 1OULA 4M77G 4B6MA 4R0KA 3CD6T 1YBYA 1PKSA 2M1HA 2EBPA 4PJOG 2M51A 4J9BA 1NBEB 1R0CB 5GAOn 1VQNT 1B34B 1QP2A 4Z8AA 4MZTA 4C8QG 3MO8A 3WXMB 1K9MU 5IHKA 2DNUA 4DBRA 1Q82C 4Y92A 1AVZC 2JMCA 1QVGP 2D8JA 2WSCE 2CS7A 3RMSA 4J9IA 3LW5E 5HK3A 1YJNT 2EYYA 3CCSQ 1AWWA 3FB9A 5GMKl 4XTXA 2LCCA 4A63B 1KD1U 1UFFA 1VQ9Q 4AFUC 3QWYA 5GAOq 2E4HA 4XK8E 1WIEA 4KGXB 4M75D 2ZPHB 4C92F 3MJXA 2QQAA 3X28B 4DBFA 4GBQA 1OOTA 2K5FA 1YJWQ 3UDCA 1VQKT 2GGRA 1YN8A 3M57A 4NL2A 4EDUA 3EG9B 3REAB 4AFZC 3X26B 2RQRA 2X35A 4OGCA 3VRZA 3NPFA 2A37A 5KYWB 5GJWB 4A4FA 4JS5A 1Y71A 2ED0A 1S72Q 4OF1A 1I5OB 4LDXA 3JAME 2Z0WA 4WTOB 4A53A 1HD3A 2CUDA 4IUQA 5GAMd 1ZUYA 2I0NA 3CBPA 2PQWA 3HFNA 4HT8A 3GNGA 3NGPA 4DOVA 4PJOF 4M75E 2R57A 4IIMA 2EJ9A 1N5ZA 3JCMW 3RUXA 1VYUA 5I11A 4E7SA 1ARKA 4J5YA 5IXFA 2ZPIB 4JJBA 4TVRA 2QQSA 5GAN7 3ZEHA 1V29B 1I07A 2JN0A 4M77E 3EGXB 1SRMA 4B9XA 5HK0A 1K9MR 1PD0A 3EFOA 2M02A 3HL8A 4PJOE 1MMGA 2XD0A 3BW1A 4FCYA 3A8GB 2YUNA 1WXUA 3H41A 1PNJA 4DEYA 1FYNA 4KRTA 2XDDA 2B86A 2FVUA 1KC8R 4EMKB 2EGCA 3CD6A 5GAMj 2DL7A 2ESWA 1EFNA 2EYZA 1IGUA 1M8MA 4DBHA 4QW2A 1JRIA 4RMOA 3QPHA 3QBYA 3JB9G 2OJ2A 5GMKm 3CMAT 3S6WA 1GCPA 2QYZA 2L5QA 1AHJB 2ZPEB 2RH2A 2CDTA 1M90R 4WF2A 1YCYA 1U8RA 2AIRB 1AT1B 1UGVA 1RAFB 4C8QB 1VQLQ 3FEOA 4XU2A 5GAN3 4MMLA 4M75F 2BE7D 1NEGA 1MHNA 2VV5A 3PFSA 1I81A 5LJ3j 1VQ7Q 4FYVB 2EQMA 3GNFB 3BDLA 2HD0A 1KD1C 2CH4A 2DRKA 3LLRA 2FRYA 2RI5A 2GQVA 5GAN2 2H3JA 2MIOA 3CMEA 2DJZA 1QVPA 3SB2A 3SWNC 1W1FA 3L42A 2H3EB 2VGMA 4JRPA 3C94A 4J9HA 4JZ4A 3MP6A 3V8JA 2JVVA 4OB1B 1K1ZA 3VS5A 4OMOA 1ZUKA 2K3XA 3LWHA 3FC3A 1QVGA 2YRVA 4GLMA 1VIFA 1X43A 5GMKh 1JXOA 5A0DA 2ECZA 4BDYA 1OI1A 1UB4A 1VQOT 1RI0A 1VQ5A 2BZYA 2IVWA 4C0DC 1U3OA 2RF0A 2CYZB 1KC8C 2OX7A 3E1SA 3QYGB 2LCSA 1YHQQ 3H8ZA 1AWXA 1RLQC 2VASA 2HKNA 2IG0A 3TSWA 3CCRA 1VQMA 4M78D 3EG3A 3O5ZA 1YCSB 4J6WA 1BU1A 1NJIU 4HKEA 2JTEA 3J80E 2AKLA 2O2OA 2M0YA 1BBZA 2HL5C 1YJNQ 1I5LA 1RAIB 4E7KA 2E12A 1VQPT 2RB6A 2DM1A 3VS7A 4F16A 1M1FA 1M27C 2EVRA 3CPWA 2IPOB 1ZSZB 4QVDA 2LRQA 1TUDA 2OTLT 1VQ7T 3M56A 1LOJA 2L3QA 2XG8D 4JDSA 2L8DA 4A4KA 5GAOp 1WHJA 3VS4A 4BD3A 1VQLT 4E7HA 4RTYA 3A98A 3VS0A 2DL5A 1GCQA 1H641 1Q86U 3EFRA 1KQ1A 3DB4A 1QCFA 2JS2A 1VQOQ 2MOXA 3M55A 3U23A 2FEIA 1T0HA 1BIBA 1NEBA 1W6XA 3LYIA 1K4US 5GAN4 3OQ5A 3GF5A 2EYXA 1NLOC 2K9GA 2EQJA 2E6ZA 3H0FA 4BI3A 3M58A 1BI0A 2WSEE 4LDYA 9ATCB 1FMVA 1PSFA 3OYIA 3CCEQ 4HXJA 2LQWA 3HRUA 4D6WA 3OYAA 4F7UE 1H3ZA 4BI8B 4J8OA 1AOJA 3X20B 3S3MA 2RJCA 1RLPC 2ZZDA 4EMGA 4JZ3A 2CP6A 4QQ6A 3L2UA 4RTVA 3CCJA 1K0XA 5KYYA 3BFMA 1ZQ1A 1K76A 3CCMA 4Y91A 1ZHIA 2J05A 2RNAA 2RHYA 1RAEB 1X2KA 3RMQA 4C5GA 3M0UA 4C0GA 1F1BB 4F04B 2KSSA 5KE3A 2DD5A 5LJ5h 3HTRA 2J06A 1OQKA 1D09B 5GJVB 4F7UG 1VQ5Q 4DBQA 1Q86C 1M3CA 3OYEA 4HCKA 4OMFB 2HSEB 3VYGA 3I55Q 1SPKA 1XOVA 4NS5A 2CZ6B 2HMAA 4BY6B 3UF4A 1E7OA 4X9CA 4HCBA 2K3YA 3ZFJA 4OB0B 2EKOA 2A3LA 2R5AA 2FB7A 3CCVA 3VRYA 1IGQA 2CUBA 2NUPB 5LJ5f 1H3HA 1VYVA 1N6AA 2RQWA 1K8AU 5IXBA 2GBQA 1D1CA 1I8FA 5GAOr 1NJIC
chains in the Genus database with same CATH topology
1Y96B 3OSSC 3ME9A 4KBMB 5HY6A 4N0AC 2G3RA 2K5LA 4OGEA 3I56T 2RK2A 1EIFA 2RD1A 1BIAA 4M7AB 4QVZA 3SDZA 3QIIA 1VIEA 4M75A 3CCMT 5I2SA 4L59A 1UGQB 5FU7C 1WQ7A 1VQ9T 2E65A 4RCBA 2PUKB 3HSBA 1D3BA 3NFCA 2P4TA 4OP0A 3F70A 5GAMh 1JJ2A 3HKSA 3VU3C 3CCST 1YJWA 3RKWA 3G7ZA 4JUVA 4FM4B 1U1TA 4C8QA 2YLCA 2CZ7B 2M16A 1Q81U 5GANj 1VQ6T 2PVGB 2HBPA 4M78E 2B8AA 1OZ3A 2HQEA 3V8KA 4M77G 3CC4A 5D6WA 1VQOA 3QYHB 3CD6T 1YBYA 4R56A 4M77B 5FRNA 2VXFA 2M0OA 4F7UF 2M1HA 3MCAB 3JCMd 4M7AD 4PJOG 3L2RA 3OS1A 4M78B 5GAOn 1VQNT 4R55A 4F7UB 4PJOC 5GANf 1B34B 1QP2A 2DIQA 1W4SA 5LJ5j 4MZTA 2DXTA 3M53A 4C8QG 3L2VA 3MO8A 3OS2A 2K4YA 3WXMB 1S72T 1K9MU 4IUPA 4M77C 4M7DD 1Q82C 2OAUA 1Y96A 3NTKA 1K8AC 4OB3B 2WSCE 4C0FA 1M9SA 2CGHA 3G4ST 2XU8A 4ZGJB 5C0MA 2CS7A 3RMSA 3PIOA 3CCQT 3V7RA 1VQ9A 4ME7A 1LJOA 4N0AA 2E70A 1VQ6A 3LW5E 5LJ3h 4N4IA 4BACA 5HK3A 1YJNT 3OYDA 5CCAA 1D3BB 4MMKA 1W2BS 1N27A 3FB9A 4MDWA 5GMKl 1YI2T 4L5GA 4XTXA 4M77F 2LCCA 2Y90A 4PLIA 2XK0A 1KD1U 1M90U 1U1SA 4XTUA 2PVDB 2MMPA 3M4GA 2BUDA 3EFSA 4ZTFA 2E41A 1FXXA 2QQ9A 5GAOq 3JCMQ 2YLBA 2DK3A 3LGFA 4XK8E 2GCXA 4M7DE 4M75D 2ZPHB 2VC8A 1B34A 4C92F 3BDUA 3META 3X24B 2A7YA 3G4SA 4DA4A 2QQAA 5LJ3f 4ELZC 3OYHA 2P0PA 4M7AG 2WACA 3X28B 4ZGEB 3P8BB 2K5FA 2PUOB 2RJFA 4C8QD 3UDCA 2FL7A 3CCLT 1YHQA 3VJPA 1VQKT 3L2WA 5CO7A 3JRZA 3M57A 4NL2A 3SFMA 3TREA 2LDMA 3CBOA 4C92D 4EDUA 3QJYA 1RL2A 3V8LA 1KQSA 3X26B 4BY6C 2X35A 4OGCA 3RERA 3JCMJ 3MEUA 3P8HA 2VXEA 4M75C 2LTOA 2RJEA 4N4HA 3CXCA 4A4FA 1SSFA 4JS5A 1Y71A 1YJ9T 1NJIC 4OF1A 3NTHA 5J26A 4C5EA 5DLOA 4XTYA 2DXUA 4LDXA 3JAME 3HRTA 3RESA 3G6EA 3JB9H 3I55T 2DEQA 4A53A 5GAMd 4IUQA 4QQDA 3JB9J 3LH0A 3CBPA 1P92A 3CBMA 5A0GA 1KHIA 2D6FA 3L1AA 1VQ4A 2PQWA 3HFNA 2GFUA 2Y4XA 2XKOC 3BY7A 3GNGA 1K73U 4HT8A 2DTHA 4C0ZA 4A54A 4PL6A 2RM4A 1JJ2S 2JZ2A 1Y7XA 2D0QB 4PJOF 2ZPBB 4M75E 4DOVA 3CCLA 5FRMA 2R57A 1BYMA 1TH7A 2EJ9A 1OZ2A 3QZ9B 3RUXA 2VUBA 2F5TX 3JCMW 3PGGA 1I4K1 4JJNK 2DTOA 1N9RA 2JTMA 1G3SA 2AHJB 2E6NA 1Q7YC 4M7DB 4PJOB 2OTJA 4J5YA 2P0KA 2ZPIB 3UT1A 5KCOA 4C92B 4TVRA 2DXBA 1NZ9A 2LX9A 2QQSA 5GAN7 1YIJT 1VQ8T 1DJ7B 4FT4A 4PLLA 4VUBA 3ZEHA 1V29B 4BB7A 4L6V5 2QI2A 2HNIA 2JN0A 4C8QE 4EMHA 1VQ7A 2EIFA 4M77E 2VYTA 4B9XA 5CAIA 5HK0A 2QQBA 3HL8A 4PJOE 2XD0A 2DZCA 4J6XA 3BW1A 4YTLA 1WJRA 1M1GA 1M4ZA 2DIGA 2F5KA 5FU6B 3JCMP 3A8GB 1VQ4T 3G71T 4JRKA 5GANg 4M77D 3DKMA 4BE2A 2XDDA 1YJWT 3CCET 5A2QE 5GAN6 3CCUA 3TU4K 2FVUA 3KUFA 2RHZA 2MWOA 1NE8A 4P5NA 4NOYA 3JCMe 4V2SA 2OTLA 2JNGA 4IUTA 2HAXA 4EMKB 3OYMA 2OTJT 3CD6A 4XQ3A 5GAMj 2JOYA 2E10A 3FIFA 5L8RE 2CZ1B 3I56A 5J3BA 1BKBA 5CKHA 5LL6S 4OB2B 3OYLA 1X01A 4M7DA 1ZBXA 4QW2A 3RIRA 1JRIA 2Y4YA 3CEYA 3M54A 3QUIA 5GAMe 4RMOA 3QHSA 2LQ8A 3QPHA 4RCCA 3J81E 3QBYA 4KUIA 3JB9G 1Q7YU 2DPPB 2ZGWA 5A0LA 5GMKm 3CMAT 4HCCA 4MDXA 3S6WA 3G6ET 2L5QA 1AHJB 2ZPEB 1XTDA 2RH2A 3OS0A 3I55A 1O9SA 3AHUA 3G71A 1BI1A 2MF2A 4J7IA 4IUUA 3ER0A 4E47A 4ZN1A 2GFAA 3OYKA 5CR2A 3GP8A 4WF2A 5GAN8 3CMET 1YCYA 4C92E 3CCQA 1U8RA 1K73C 3L2ZA 4FSXA 4LD6A 4DOWA 3DLLA 2DD4A 3QG1A 4DQ2A 1KQ2A 4C8QB 3FEOA 4XU2A 5GAN3 4MMLA 1G3YA 1X6OA 5CK9A 4M75F 1VQMT 3JB9I 2K57A 4LDVA 4M78C 2K2VA 1MHNA 2VV5A 1S72A 5CKBA 3PFSA 3WVEB 5IN1A 2QEXT 3VV0A 1I81A 5DLQE 3MEAA 4PNOA 5FU6C 5LJ3j 4EMKA 2DTIA 1QW1A 2RA2A 3JSCA 3M9QA 4M78A 4C5IA 4A4EA 3OYGA 1M1KC 2EQMA 2O4XA 3OBYA 4F7UA 4BE1A 1QVFS 1HK9A 1VUBA 3GNFB 2XIDA 3BDLA 2NLUA 5CKDA 5CQXA 2HD0A 1KD1C 3LLRA 2MAMA 2X4YA 1VQPA 2RI5A 2GQVA 3PTAA 5GAN2 4ELYC 3CC7A 1VQ5T 2H3JA 3A8LB 3CMEA 2DJZA 3DB3A 4M7AC 1QVPA 2EYQA 3ZBDA 3C95A 1W2BA 2JTFA 3SB2A 3SWNC 4C8QC 4CI0C 3JCMX 5GAOm 3JB9D 3L42A 2K5IA 3Q1JA 2VGMA 3GPLA 4HT9A 4JRPA 2X4JA 5D6YA 3C94A 3OW2A 1Y07A 2RHUA 3GLXA 2FHDA 5LJ5d 1XQHA 5GANd 5LJ3g 2PU9B 3MP6A 3V8JA 3OY9A 2KAFA 2X4XA 2JVVA 1O75A 4OB1B 3SWNA 2WSFE 2XDPA 3QSUA 1QVFA 1K9MC 1BI3A 4CRIA 2K3XA 4JS4A 3OMGA 3LWHA 3FC3A 2LCLA 3E9FA 2YRVA 4XTZA 1QVGA 4BUGA 1VIFA 4M7DF 4GY5A 3HHTB 5J39A 3QDRB 1WJQA 1QVGS 4MZPA 3HP9A 5GMKh 1YHQT 5A0DA 3KBGA 4BDYA 2KK4A 2DVEA 1OI1A 1UB4A 3N5BB 1VQOT 1RI0A 1VQ5A 2YHTA 3V7SA 2LT1A 4EMKC 2R5MA 1BI2A 3MEVA 2V8JA 2IVWA 5I21A 1JB0E 3S3NA 3OW2S 3JCMh 1YITT 5GMKi 4C0DC 2CYZB 1KC8C 3CCVT 2C06A 3E1SA 1M5Q1 2XICA 3QYGB 4JLGA 4M7AE 5GAOr 2ZCFB 1YJ9A 1Q82U 1WGSA 3H8ZA 5DY9A 3URGA 1M1KU 3JCMf 2EQKA 2IG0A 4RG2A 3OYFA 3CCRA 3VUZA 2VGNA 1N8RU 1VQMA 4QVCA 3CCJT 4M78D 1N8RC 4LDWA 1QP3A 4J6WA 5GAMg 4PKCC 3SWNB 3CMAA 1UGPB 3QZ5B 1NJIU 2L89A 4HKEA 4JRIA 3C4SA 2KQWA 4B9WA 3PT9A 3J80E 1IREB 4XU1A 1KC8U 2FYKA 1WPYA 2LNVA 3L2QA 3SD4A 1Q81C 3E19A 4M77A 1YI2A 3CCSA 1G5VA 3H6ZA 2O01E 3PMIA 4E7KA 2E12A 4N4GA 1I5LA 1WNLA 2X4WA 2L3RA 4M7DC 5IAYA 2E5QA 2RB6A 3LGLA 5AYFA 1VQPT 5GMKj 3NTIA 1M1FA 3JCMb 2I2LA 2R58A 3CC4T 3CPWA 4UC4A 4FL6A 2P0QA 2XDBA 2EWNA 3OSVA 3CCEA 1VQ8A 4QVDA 3C12A 4Z02A 4J7FA 2LRQA 3JCMg 3A8OB 2OTLT 1VQ7T 4A4GA 3M56A 1LOJA 4XU0A 2EFIA 2EQUA 2XG8D 3E9GA 3S3OA 4JDSA 2XHCA 2L8DA 5GAMf 3MHXA 3FLGA 3X25B 2HQXA 5I2MA 4A4KA 4NL3A 2DKGA 5GAOp 1G3WA 4KT0E 4BD3A 1VQLT 2DAQA 2RO0A 2QDYB 5FLXE 4XAXB 3VYHB 4FU6A 3UPUA 4E7HA 2RJDA 1LNXA 4KULA 4O6JA 5LJ3d 4BDZA 2RHIA 1OYXA 1H641 3OB9A 1HXDA 4J6YA 1PSEA 3MP8A 3EFRA 1KQ1A 1Q86U 3DB4A 4M78G 3JB9F 4IUVA 3CCUT 3OS5A 4PJOD 2RK1A 4C5HA 3INZA 4XU3A 3T9NA 3M55A 4RKUE 1VQNA 2JUFA 1YJNA 4MZMA 2D9TA 4ZGDB 1BIBA 5CIUA 3LYIA 2LT4A 5GAN4 3OQ5A 3PNWC 5D6XA 1KQSS 3GF5A 2DXCA 3FJPA 2KMTA 3GIBA 2BIVA 5FU7B 5CKEA 1N9SA 2E6ZA 2EQJA 4BI3A 3M58A 2QEXA 3R6OA 3VKIA 3VUBA 1BI0A 1JBMA 3ASKA 3GOXA 2WSEE 3OA6A 4BE0A 4EPCA 4LDYA 3JCMc 1UGRB 2QQRA 4HCZA 4ZTJA 1PSFA 3OYIA 2PVOB 2QA4A 5KE2A 1R8OB 4C92G 3LX7A 3HPWA 3HRUA 2MI6A 4D6WA 1IZ6A 3OYAA 4F7UE 4JRQA 2V8IA 5CQYA 4BI8B 2E64A 1H3ZA 1GXIE 1WQWA 2MWPA 4IURA 4J8OA 2KVQG 4X9DA 3X20B 4E7IA 2RJCA 3MP1A 3S3MA 5EG2A 3CC7T 5M9OA 4Q5WA 2ZZDA 5LJ5e 5GANe 2RHXA 2BKDN 4EMGA 4X34A 1NPRA 4ZN3A 2KDSA 3OBWA 3A5ZB 2CKKA 4QQ6A 3L2UA 3OYCA 2ZPFB 3CCJA 1G3TA 4M7AF 3BFMA 3WVDB 3FRNA 1ZQ1A 3CCMA 4Y28E 2EJGA 4Y91A 4BI4A 3KXTA 3TCJA 3LWIA 1ZHIA 3DLMA 3FDRA 3CPWS 2RHYA 3V7CA 3OYJA 3RMQA 4C5GA 5GAOl 3M4YA 4C0GA 2XI9A 3RKXA 5HKCA 3UWNA 4LDUA 2KSSA 5KE3A 1VQKA 5LJ3e 2DD5A 4C92C 2O4XB 4FT2A 5LJ5h 4ATOA 2QTXA 2F69A 5KH6A 1VQLA 4E7LA 3OYYA 1X75C 2EAYA 4QQGA 3QKJA 3A8MB 4PJOA 4F7UG 2ZPGB 2M9UA 4IKFA 2LQKA 1Q86C 3OYEA 5C6SA 3HRSA 4C92A 4OMFB 3O8VA 3QXEB 4M78F 3CC2T 3PIPA 5FROA 4C8QF 1KG1A 3VYGA 2CZ0B 1YITA 5GAN5 3A8HB 2EJFA 1FX7A 5CKFA 4M7AA 1XOVA 3CXCS 2DZ9A 3OMCA 5LJ5g 4M75B 2V8KA 4E7JA 2LVMA 4XTWA 1YIJA 1FWZA 4OVAA 4C0DB 1KHCA 4HA8A 3OYBA 4NS5A 3RKYA 2QXFA 4GLKA 2CZ6B 4O5VA 4BY6B 4II1A 2LC4A 5GANh 1UEBA 4X9CA 3TEEA 1NPPA 4JLIA 5KCHA 1M90C 3M59A 4HCBA 4KUDK 2KY9A 2K3YA 3ZFJA 3M5AA 4OB0B 5GMKe 3QO3A 4M75G 2EKOA 2A3LA 2R5AA 5CVIA 3JCMV 2FB7A 3CCVA 4LD9K 1XNIA 3P8DA 1M8VA 2QA4T 5DM7R 3CC2A 4M7DG 2RI3A 3PMTA 3HFOA 5LJ5f 3CPFA 1UGSB 2DO3A 2E1HA 4RG8A 3EAEA 3CCRT 1N6AA 3MEWA 3QJ6A 5IT9E 4XTVA 1K8AU 1I8FA 1MGQA 3J7AF 2GF7A 2RI2A 4J83A 4FIBA 3OYNA 1WJSA 4A4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI5 A;  3ME9 A;  4IUQ A;  4QQD A;  3LH0 A;  2D9T A;  2G3R A;  3DB3 A;  5CIU A;  2PQW A;  2GFU A;  2JTF A;  4QVZ A;  3LYI A;  3L42 A;  3Q1J A;  3QII A;  3OQ5 A;  3PNW C;  4PL6 A;  5D6X A;  2JZ2 A;  5D6Y A;  4L59 A;  5FRM A;  2RHU A;  2R57 A;  2FHD A;  2BIV A;  3OY9 A;  3MP6 A;  4BE1 A;  3F70 A;  2EQJ A;  2X4X A;  1OZ2 A;  2XDP A;  3ASK A;  3GOX A;  2M16 A;  3OA6 A;  4BE0 A;  2E6N A;  2QQR A;  2K3X A;  4CRI A;  2B8A A;  4HCZ A;  1OZ3 A;  2HQE A;  2P0K A;  3OMG A;  3UT1 A;  5KCO A;  3FC3 A;  3E9F A;  2YRV A;  3OYI A;  5D6W A;  2QQS A;  5KE2 A;  4PLL A;  4ZTJ A;  3LX7 A;  3ZEH A;  5FRN A;  2M0O A;  2M1H A;  4GY5 A;  5J39 A;  1WJQ A;  3OYA A;  1H3Z A;  3L2R A;  3OS1 A;  2VYT A;  2MWP A;  4IUR A;  4B9X A;  4BDY A;  4E7I A;  3S3M A;  2RJC A;  3MP1 A;  2DIQ A;  5M9O A;  1OI1 A;  4Q5W A;  3L2V A;  1RI0 A;  2RHX A;  2BKD N;  3MO8 A;  3OS2 A;  4X34 A;  1WJR A;  2R5M A;  2DIG A;  3MEV A;  4IUP A;  2F5K A;  3S3N A;  2CKK A;  4QQ6 A;  3L2U A;  3OYC A;  3NTK A;  4BE2 A;  3DLM A;  3FDR A;  1WGS A;  3H8Z A;  5C0M A;  2RHY A;  3KUF A;  2RHZ A;  2EQK A;  2IG0 A;  2MWO A;  4RG2 A;  3OYF A;  3OYJ A;  4C5G A;  4BAC A;  4N4I A;  4IUT A;  3UWN A;  3OYD A;  3OYM A;  5KE3 A;  1N27 A;  2O4X B;  5KH6 A;  2LCC A;  2L89 A;  4PLI A;  4E7L A;  2XK0 A;  3C4S A;  3OYL A;  4QQG A;  4B9W A;  3QKJ A;  4QW2 A;  4IKF A;  2BUD A;  5C6S A;  3CEY A;  3OYE A;  4ZTF A;  3L2Q A;  3SD4 A;  3O8V A;  3QBY A;  3LGF A;  5FRO A;  3H6Z A;  3S6W A;  3PMI A;  4E7K A;  1G5V A;  4N4G A;  2X4W A;  3OS0 A;  2L3R A;  5IAY A;  2E5Q A;  3LGL A;  3NTI A;  3OMC A;  4IUU A;  3MET A;  4E7J A;  2GFA A;  2LVM A;  2R58 A;  3OYK A;  4UC4 A;  4OVA A;  4FL6 A;  1KHC A;  3OYB A;  3OYH A;  4NS5 A;  2WAC A;  4LD6 A;  4II1 A;  4Z02 A;  2RJF A;  2LRQ A;  4A4G A;  5KCH A;  2EFI A;  2X4Y A;  3FEO A;  2EQU A;  3E9G A;  3L2W A;  3S3O A;  2K3Y A;  2L8D A;  4EDU A;  1MHN A;  2LDM A;  3FLG A;  3PFS A;  2HQX A;  5IN1 A;  2X35 A;  2EKO A;  2R5A A;  4BD3 A;  3MEA A;  2DAQ A;  2RO0 A;  3MEU A;  3P8H A;  1XNI A;  3M9Q A;  3P8D A;  4FU6 A;  4E7H A;  2RJD A;  4C5I A;  2LTO A;  4A4E A;  3OYG A;  2EQM A;  2O4X A;  4BDZ A;  2RHI A;  2RI3 A;  2RJE A;  1OYX A;  3PMT A;  1SSF A;  4N4H A;  4A4F A;  3OB9 A;  3MP8 A;  3EAE A;  3DB4 A;  3BDL A;  3MEW A;  3QJ6 A;  2NLU A;  3NTH A;  4IUV A;  5J26 A;  4C5E A;  2GF7 A;  2RI2 A;  4C5H A;  3LLR A;  3OYN A;  1WJS A;  4A4H A; 
#chains in the Genus database with same CATH topology
 5FWB A;  3ME9 A;  2RK2 A;  2RD1 A;  4M7A B;  4QVZ A;  1X6G A;  5IHN A;  4M75 A;  1HSQ A;  3CCM T;  2KGT A;  1WQ7 A;  1K73 R;  4RCB A;  3HSB A;  1D3B A;  1GBQ A;  2X9H A;  1YJW A;  3CCS T;  2YT6 A;  1U1T A;  4FM4 B;  2KNB B;  1WA7 A;  5GAN j;  1OZ3 A;  1VQO A;  3CCQ Q;  4R56 A;  5FRN A;  2M0O A;  4F7U F;  3JCM d;  4M7A D;  2LX7 A;  4PJO C;  2DIQ A;  5LJ5 j;  3M53 A;  1U06 A;  2J6O A;  1S72 T;  2QK0 A;  4IUP A;  4M77 C;  1VQ8 Q;  1WHK A;  2YSQ A;  4X1V A;  1MMN A;  4C0F A;  1M9S A;  3G4S T;  5C0M A;  1R0B G;  3PIO A;  3CCQ T;  1LJO A;  4AT1 B;  4N4I A;  1JJ2 P;  1W2B S;  4MDW A;  1YI2 T;  3I5R A;  4PLI A;  2XK0 A;  1M90 U;  4XTU A;  3FJ5 A;  2PVD B;  2BUD A;  2QDL A;  3EFS A;  1SSH A;  4PJJ A;  1M30 A;  2E41 A;  4D8D A;  1OX8 A;  1RAG B;  1TG0 A;  3MKD A;  2VC8 A;  3BDU A;  2A7Y A;  5LJ3 f;  1NM7 A;  4KH1 B;  3OYH A;  2WAC A;  1YHQ A;  1E6H A;  1MV3 A;  3VJP A;  5CO7 A;  3CBO A;  1RL2 A;  3RNJ A;  1ZBJ A;  1KQS A;  1PRL C;  2VXE A;  4M75 C;  2LTO A;  3PE0 A;  1JQQ A;  2RJE A;  3EH1 A;  3AT1 B;  3NTH A;  5J26 A;  4C5E A;  4XTY A;  1QLY A;  2CP0 A;  2OTL Q;  3RES A;  1VQN Q;  5KYY B;  4QQD A;  1UTI A;  5KYX A;  3JB9 J;  2HCK A;  5A0G A;  1KHI A;  2X3X D;  2KRM A;  2GFU A;  3BY7 A;  1C0M A;  2DTH A;  4A54 A;  1JJ2 S;  2JZ2 A;  2D0Q B;  5FRM A;  1ZSZ C;  1BYM A;  1OZ2 A;  3QZ9 B;  2VUB A;  3PGG A;  4JJN K;  2JTM A;  1Q7Y C;  2OTJ A;  2EGA A;  1UDL A;  2J6F A;  2RQU A;  1DJ7 B;  4VUB A;  1AD5 A;  4L6V 5;  2O9S A;  2QEX Q;  1UHF A;  2A0F B;  4M4Z A;  2KRS A;  4J6X A;  2F5K A;  3UA6 A;  1MMA A;  4JRK A;  2RQV A;  1TOV A;  5GAN g;  4BE2 A;  1TU0 B;  3CCE T;  3CCU A;  5GAN 6;  1IHW A;  3KUF A;  2MWO A;  4P5N A;  3G6E Q;  2JNG A;  4IUT A;  1WZO A;  2JOY A;  2E10 A;  2BE9 B;  5L8R E;  1PWT A;  4M7D A;  2D0N A;  2Y4Y A;  3M54 A;  1KQS P;  5GAM e;  3QHS A;  3J81 E;  2DPP B;  1NYF A;  3H0H A;  2MPX C;  2BZX A;  3G6E T;  2ABL A;  6AT1 B;  3G71 A;  3CCU Q;  3ER0 A;  3OYK A;  3EG2 A;  1X6B A;  3CCQ A;  2ROT A;  4C92 E;  3CME T;  1K73 C;  2EPD A;  3DLL A;  2KR3 A;  4DOW A;  2DD4 A;  4CC3 A;  4DQ2 A;  1KQ2 A;  1G3Y A;  3JB9 I;  1S72 A;  1YWO A;  3VV0 A;  5FU6 C;  4F17 A;  2DTI A;  2RA2 A;  5D7U A;  1ABQ A;  1M1K C;  4C5I A;  1D1A A;  2O4X A;  4BE1 A;  1QVF S;  2JT4 A;  1QWE A;  1VUB A;  4AFQ C;  5CKD A;  2COY A;  1UEC A;  3PTA A;  2KI7 A;  2MK5 A;  3ZBD A;  4CI0 C;  3JCM X;  4C8Q C;  5IH2 A;  3Q1J A;  4HT9 A;  1GRI A;  3GPL A;  2X4J A;  5D6Y A;  3OW2 A;  1Y07 A;  2KYB A;  2AT1 B;  5GAN d;  1MMD A;  2PTK A;  3SWN A;  1O75 A;  1TXQ A;  2DFU A;  1K9M C;  2AZV A;  4QT7 A;  4JS4 A;  4XTZ A;  4BUG A;  2QGF B;  2XMF A;  1QVG S;  3HHT B;  1WJQ A;  4FW2 A;  3HP9 A;  3C0C A;  1YHQ T;  1ABO A;  2DL8 A;  3N5B B;  4EMK C;  2R5M A;  1BI2 A;  3CCL Q;  5I21 A;  1MV0 B;  4PJL A;  1WXT A;  3CCV T;  1M5Q 1;  4M7A E;  3JCM f;  3OYF A;  3ZL7 C;  2L3P A;  4QVC A;  3CCJ T;  4LDW A;  1QP3 A;  2GTJ A;  2KQW A;  4B9W A;  1KC8 U;  2KEA A;  2FYK A;  2LNV A;  3L2Q A;  3E19 A;  2E5K A;  1YI2 A;  1G5V A;  2O01 E;  3PVL A;  2X4W A;  2L3R A;  2E5Q A;  5AYF A;  1Q7Y R;  5GMK j;  4PJM A;  2I2L A;  4UC4 A;  3G4S Q;  4FL6 A;  3OSV A;  1VQ8 A;  1IB8 A;  3C12 A;  2HBW A;  2KRN A;  4XU0 A;  3E9G A;  3S3O A;  2XHC A;  5GAM f;  2DKG A;  1G3W A;  2RO0 A;  1PHT A;  5FLX E;  4FU6 A;  1OEB A;  2QG9 B;  4KUL A;  2EQI A;  4ESR A;  3OB9 A;  3JB9 F;  3CCU T;  3QDF A;  3OS5 A;  2RK1 A;  3MPU B;  4RKU E;  2JUF A;  1YJN A;  4MZM A;  2D9T A;  2HQH A;  4ZGD B;  2LT4 A;  2JXB A;  2KBT A;  3M0S A;  3GIB A;  1RI9 A;  2BIV A;  1N9S A;  2RQT A;  3R6O A;  1JBM A;  4BE0 A;  1UGR B;  4HCZ A;  2FZC B;  1BK2 A;  4PK4 A;  2GQI A;  5KE2 A;  2QA4 Q;  1Q81 R;  1R8O B;  1AZE A;  3HPW A;  5CQY A;  2E64 A;  4AFS C;  2ZAE A;  1WQW A;  2MWP A;  2QAS A;  4CC7 A;  4E7I A;  2DEU A;  1GXI E;  5LJ5 e;  2LMJ A;  2O9V A;  2BKD N;  4X34 A;  1NPR A;  2CKK A;  3OYC A;  1G3T A;  1SEM A;  4M7A F;  2DJQ A;  4HVU A;  4Y28 E;  3LWI A;  3TCJ A;  1RAB B;  3DLM A;  2O31 A;  1X69 A;  3TSZ A;  1K8A R;  3M4Y A;  3RKX A;  1Q82 R;  4ZNX A;  1WYX A;  4C92 C;  2O4X B;  2QTX A;  2DET A;  5KH6 A;  2EAY A;  4QQG A;  4PJO A;  1IHV A;  2M9U A;  3D7S B;  2LQK A;  5C6S A;  3HRS A;  2J6K A;  3QXE B;  3CC2 T;  5HCK A;  3PIP A;  1KG1 A;  2COW A;  1YIT A;  2CZ0 B;  2DZ9 A;  3EGD B;  3OMC A;  2V8K A;  4E7J A;  4XTW A;  3ULR B;  4HA8 A;  1B3Q A;  4GLK A;  2KXD A;  4J9E A;  3TEE A;  1NPP A;  4JLI A;  5KCH A;  4KUD K;  3QO3 A;  1VQ6 Q;  2AKK A;  1YNZ A;  2LJ3 A;  3JCM V;  3JV3 A;  4J9G A;  1Z9Q A;  3P8D A;  3REB B;  4RTX A;  2VB6 A;  2P84 A;  3BE3 A;  5DM7 R;  3PMT A;  4M7D G;  4RG8 A;  3EAE A;  2BTT A;  2QAZ A;  1MGQ A;  2FZK B;  2H8H A;  2CH4 W;  4C0Z A;  3OYN A;  4A4H A;  2G6F X;  4N0A C;  2G3R A;  4OGE A;  2COZ A;  1EIF A;  1PRM C;  3SDZ A;  1YIJ Q;  3CCR Q;  5I2S A;  4L59 A;  5FU7 C;  1D0X A;  3HKS A;  2YLC A;  1AWJ A;  1Q81 U;  4M78 E;  2B8A A;  4OML A;  3V8K A;  3CC4 A;  5D6W A;  1RAH B;  2VXF A;  1KJW A;  3L2R A;  4M78 B;  2KYM A;  5FWC A;  4F7U B;  5GAN f;  1W4S A;  2NUT A;  2LZ6 B;  5I22 A;  3L2V A;  1SKU B;  3OS2 A;  4M7D D;  2OAU A;  1Y96 A;  3NTK A;  1K8A C;  4OB3 B;  3CC2 Q;  1JU5 C;  4Z88 A;  2DL3 A;  3EG9 A;  3V7R A;  4ME7 A;  1I0C A;  1G83 A;  4N0A A;  4BAC A;  2AZS A;  3OYD A;  1N27 A;  1MND A;  2MYS A;  4L5G A;  1HJD A;  3EHQ A;  2Y90 A;  3VS6 A;  1KIK A;  3EG0 A;  2CRE A;  7AT1 B;  2YRC A;  1X27 A;  2MMP A;  4ZTF A;  2YLB A;  3LGF A;  4M7D E;  1UHC A;  1B34 A;  3MET A;  3X24 B;  4J9C A;  1BCM A;  4DA4 A;  4ZGE B;  1PM3 A;  4C8Q D;  1SHG A;  2ENM A;  3TVT A;  1Z9Z A;  4LNP A;  3L2W A;  2L0A A;  2MCN A;  1GFC A;  4J9F A;  3JRZ A;  3TRE A;  3SFM A;  1C1A A;  2LDM A;  1NG2 A;  3QJY A;  2A08 A;  3RER A;  3GBQ A;  4OMN A;  3JCM J;  3P8H A;  2E3I A;  1N8R R;  1PC0 A;  3JB9 H;  3I55 T;  2DEQ A;  3LH0 A;  3RR6 A;  4FW1 A;  2D6F A;  3L1A A;  1VQ4 A;  2XKO C;  3H9N A;  1OU9 A;  2FRW A;  1KK7 A;  3KFV A;  1Y7X A;  1TH7 A;  4E6R A;  8AT1 B;  2DBM A;  4PJO B;  1G3S A;  2E6N A;  5KCO A;  2P0K A;  3UT1 A;  2DXB A;  2LX9 A;  1VQ8 T;  4WCI A;  2QI2 A;  3CCJ Q;  2HNI A;  4C8Q E;  4EMH A;  1IXD A;  2VYT A;  5KYW A;  2DZC A;  4YTL A;  1WJR A;  1M1G A;  2DIG A;  1BCO A;  1VQ4 T;  3LH5 A;  2DYB A;  3G71 T;  4M77 D;  1W2B P;  3DKM A;  1YJW T;  2L3S A;  5A2Q E;  2RHZ A;  1NE8 A;  1VYT A;  2JM8 A;  1H8K A;  2HAX A;  1GL5 A;  3I5S A;  2W0Z A;  4XQ3 A;  3QWX X;  3VS1 A;  3OYL A;  5LL6 S;  1WI7 A;  4OB2 B;  1X01 A;  3UAT A;  3CEY A;  3GP8 A;  2F2X A;  2ZGW A;  4HCC A;  1EX4 A;  2AK5 A;  2FPD A;  3OS0 A;  1XTD A;  1YIT Q;  2A28 A;  2P4R A;  1O9S A;  2MF2 A;  4J7I A;  3EFO B;  4IUU A;  4E47 A;  2GFA A;  2YDL A;  1PD1 A;  5GAN 8;  2IIM A;  3L2Z A;  3QG1 A;  2HZY A;  3I35 A;  1PG5 B;  2DER A;  4M78 C;  4LDV A;  2K2V A;  3SEM A;  3WVE B;  5IN1 A;  3MEA A;  4PNO A;  4EMK A;  1QW1 A;  4M78 A;  1JXM A;  3OBY A;  4F7U A;  1HK9 A;  2EGE A;  3EHR A;  2NLU A;  1VQP A;  3CC7 Q;  3R6N A;  1VQ5 T;  3CC7 A;  2LJ1 A;  3A8L B;  3DB3 A;  2EYQ A;  1W2B A;  3JB9 D;  2PU9 B;  2KRO A;  1TUC A;  1OPL A;  1QKW A;  1NLP C;  2XDP A;  3QSU A;  2DYI A;  1QVF A;  1BI3 A;  4CRI A;  1GCQ C;  4D8K A;  4FSS A;  1MUZ A;  3OMG A;  2LCL A;  3E9F A;  1M3A A;  4PFO A;  2C0T A;  4M7D F;  5J39 A;  3QDR B;  4MZP A;  3KBG A;  1TWB A;  3V7S A;  3S3N A;  2V8J A;  1ZLM A;  1JB0 E;  3OW2 S;  3JCM h;  1Y57 A;  2C06 A;  2HDA A;  2XIC A;  4JLG A;  4KGZ B;  3URG A;  5DY9 A;  2EW3 A;  1M1K U;  1N8R U;  1HYO A;  4RTU A;  1ACM B;  5GAM g;  1M3B A;  1UGP B;  1D0Z A;  2L89 A;  3C4S A;  3PT9 A;  1IRE B;  4XU1 A;  1WPY A;  2VWF A;  3SD4 A;  1Q81 C;  4M77 A;  2FPE A;  3CCS A;  4LUD A;  3H6Z A;  3PMI A;  4N4G A;  1WNL A;  5EC7 A;  2F2V A;  4M7D C;  5IAY A;  3LGL A;  3NTI A;  3JCM b;  2R58 A;  3CC4 T;  2DBK A;  2P0Q A;  2EWN A;  3CCE A;  4Z02 A;  2VKN A;  3SHW A;  1YJ9 Q;  2NUZ A;  3MHX A;  2HQX A;  5I2M A;  4NL3 A;  2YUO A;  2CP2 A;  4LXC A;  3CD6 Q;  1PCX A;  1QVF P;  4J6Y A;  1PSE A;  2CP5 A;  4M78 G;  1U5S A;  4PJO D;  4C5H A;  3INZ A;  1WFW A;  2NWM A;  4F14 A;  2FPF A;  4FYY B;  1X2Q A;  2F1L A;  3PNW C;  1YP5 A;  3M0R A;  1CKA A;  1ZSZ A;  1W70 A;  2F2W A;  5FU7 B;  1Y0M A;  3I9Q A;  2QEX A;  5FW9 A;  3VKI A;  3VUB A;  4RUG A;  1MNE A;  3GOX A;  3OA6 A;  4EPC A;  2QQR A;  4PFP A;  4ZTJ A;  3VS3 A;  2GTO A;  1AEY A;  3CQT A;  3LX7 A;  2MI6 A;  2HSP A;  1VQ4 Q;  4X9D A;  3CC7 T;  3MP1 A;  5EG2 A;  4Q5W A;  2RHX A;  2DLP A;  4ZN3 A;  2PZ1 A;  2KDS A;  3OBW A;  1RUW A;  2K2M A;  1KFZ A;  2DX1 A;  2EJG A;  4BI4 A;  3KXT A;  4JPB W;  3CPW S;  3V7C A;  1K0S A;  4LN2 A;  2XI9 A;  2KE9 A;  3UWN A;  4LDU A;  4AG1 C;  1YI2 Q;  1D1B A;  2NUP A;  3OYY A;  5ECA A;  3QKJ A;  3A8M B;  1CSK A;  4C92 A;  2GNC A;  4M78 F;  2FZG B;  1CKB A;  3CMA Q;  5GAN 5;  4M7A A;  2EJF A;  5CKF A;  3CXC S;  5LJ5 g;  4M75 B;  2LVM A;  3PVQ A;  1YIJ A;  1FWZ A;  1AZG B;  4E2F B;  1KHC A;  2QXF A;  2QTV A;  2HL3 A;  4II1 A;  2LC4 A;  1UEB A;  1M90 C;  2KY9 A;  3M5A A;  1LVK A;  4M75 G;  1VQK Q;  5CVI A;  1KD1 R;  4LD9 K;  1Q86 R;  2ROL A;  1M8V A;  2QA4 T;  2CP7 A;  2RI3 A;  3HFO A;  2DO3 A;  3QJ6 A;  4XTV A;  1FMK A;  2GF7 A;  2RI2 A;  1NYG A;  5KYU B;  4J83 A;  4HVV A;  3OSS C;  4KBM B;  3M0Q A;  3UA7 A;  1BIA A;  2ATC B;  4ANJ A;  3QII A;  1VIE A;  4ORZ A;  1SHF A;  2E65 A;  4KGV B;  2PUK B;  1RAA B;  1GFD A;  5GAM h;  2P4T A;  1EZZ B;  2YWW A;  3F70 A;  3VU3 C;  4JUV A;  2CT4 A;  2CZ7 B;  2PVG B;  3G71 Q;  2HQE A;  4Z89 A;  2QGG A;  3QYH B;  4M77 B;  2K7A A;  3EGU A;  3MCA B;  4R55 A;  1OU8 A;  2DXT A;  2DIL A;  2DRM A;  2K4Y A;  2CGH A;  2CSI A;  1ZSG A;  2XU8 A;  4ZGJ B;  1VQ9 A;  3EH2 A;  4LUE A;  2E70 A;  1VQ6 A;  5LJ3 h;  2JJ9 A;  5CCA A;  1D3B B;  2CP3 A;  4MMK A;  4M77 F;  1SRL A;  4RTT A;  1U1S A;  3M4G A;  1FXX A;  2QQ9 A;  3JCM Q;  5KYX B;  1QMC A;  2DK3 A;  1KSW A;  2GCX A;  1R77 A;  1GBR A;  2DMO A;  2X51 A;  2OTJ Q;  4RTW A;  1S1N A;  3G4S A;  4ELZ C;  4M7A G;  2P0P A;  2JM9 A;  3P8B B;  2PUO B;  2RJF A;  2K6D A;  3CCL T;  2FL7 A;  2W10 A;  2VVK A;  2L2P A;  4C92 D;  3V8L A;  1BB9 A;  1WHH A;  4BY6 C;  3MEU A;  2RN8 A;  5KYN A;  1UJ0 A;  3CXC A;  4N4H A;  1SSF A;  1RAC B;  1YJ9 T;  5DLO A;  2DXU A;  3HRT A;  3G6E A;  1I1J A;  1P92 A;  3CBM A;  2X3W D;  3G1J A;  2Y4X A;  1K73 U;  1UE9 A;  4PL6 A;  2RM4 A;  2CT3 A;  2OI3 A;  2ZPB B;  1M2V A;  3CCL A;  3IQL A;  2F5T X;  1I4K 1;  1QKX A;  2DTO A;  1N9R A;  2SRC A;  2AHJ B;  3EG1 A;  4M7D B;  1WHM A;  4C92 B;  1YIJ T;  1NZ9 A;  3M0P A;  2V1R A;  4FT4 A;  4PLL A;  4BB7 A;  1VQ7 A;  2EIF A;  2PNI A;  3M0T A;  4J9D A;  4PFZ A;  5CAI A;  4EIK A;  1A0N B;  2FO0 A;  2QQB A;  1J3T A;  4FYX B;  1B7T A;  4AG2 C;  1M4Z A;  5FU6 B;  3JCM P;  2YXY A;  1SG5 A;  1VQP Q;  4RTZ A;  1TUG B;  3CME Q;  3TU4 K;  4NOY A;  3JCM e;  3H0I A;  4V2S A;  2OTL A;  3OYM A;  2HEQ A;  2OTJ T;  3FIF A;  2K3B A;  2CZ1 B;  3I56 A;  5J3B A;  1BKB A;  2CSQ A;  3I56 Q;  5CKH A;  4FYW B;  1G2B A;  1OX9 A;  1ZBX A;  1ZUU A;  5KYU A;  3RIR A;  3QUI A;  1Q7Y U;  2LQ8 A;  4OMM A;  4RCC A;  4KUI A;  1T3L A;  4MDX A;  5A0L A;  3RDV A;  3I55 A;  3AHU A;  1BI1 A;  2KT1 A;  1XJW B;  4ZN1 A;  4DEX A;  5CR2 A;  2LQN A;  4FSX A;  4LD6 A;  1UG1 A;  2BZ8 A;  1X6O A;  5CK9 A;  1VQM T;  2K57 A;  1YWP A;  5CKB A;  2QEX T;  5DLQ E;  2EKH A;  8ATC B;  1PKT A;  3M9Q A;  3JSC A;  2D8H A;  3OYG A;  4A4E A;  1UUE A;  2XID A;  1K9A A;  5CQX A;  3CC4 Q;  2MAM A;  2X4Y A;  4ELY C;  1G8X A;  2K79 A;  3THK A;  4M7A C;  1ZA2 B;  3C95 A;  2JTF A;  2O88 A;  1V76 A;  5GAO m;  2K5I A;  4OMP A;  1T0J A;  2RHU A;  3GLX A;  2FHD A;  1B07 A;  1XQH A;  2V26 A;  5LJ5 d;  5LJ3 g;  3OY9 A;  2KAF A;  1E6G A;  2X4X A;  3CPW P;  2DF6 A;  3RBB B;  2WSF E;  1IRX A;  4PJN A;  1UJY A;  2HKQ B;  2DVJ A;  2YRD A;  4GY5 A;  3CCV Q;  1WLP B;  4CC2 A;  1WDX A;  3OW2 P;  2KK4 A;  2DVE A;  1TTH B;  4QKU A;  2YHT A;  3VS2 A;  2LT1 A;  3MEV A;  1YIT T;  5GMK i;  2LP5 A;  2ZCF B;  1YJ9 A;  1Q82 U;  1WGS A;  2LJ0 A;  1M2O A;  2DL4 A;  2EQK A;  4RG2 A;  3VUZ A;  2VGN A;  1Q95 G;  1N8R C;  4PKC C;  3SWN B;  5IHI A;  3CMA A;  3QZ5 B;  1AWO A;  4JRI A;  5L23 A;  2JS0 A;  2C0O A;  2JW4 A;  2SEM A;  1WHG A;  1OPK A;  2JMA A;  1M2V B;  2XDB A;  4J7F A;  3JCM g;  3A8O B;  1TSF A;  4A4G A;  2EFI A;  2EQU A;  3TQ7 P;  3FLG A;  3X25 B;  1VQM Q;  4KT0 E;  4LE9 A;  1JO8 A;  2DAQ A;  2QDY B;  1C6V X;  4XAX B;  3VYH B;  3UPU A;  2RJD A;  1LNX A;  5LJ3 d;  4O6J A;  4BDZ A;  1VA7 A;  2RHI A;  1OYX A;  1HXD A;  3MP8 A;  4IUV A;  2KXC A;  4XU3 A;  3T9N A;  1IO6 A;  1V1C A;  1VQN A;  2YUP A;  1D0Y A;  5CIU A;  3CCM Q;  5D6X A;  1KQS S;  1YFN A;  2DXC A;  3FJP A;  2KMT A;  2DE0 X;  4K11 A;  4E7Z A;  5CKE A;  2KT8 A;  2NYS A;  2OAW A;  3ASK A;  2RPN A;  3JCM c;  4KH0 B;  2PVO B;  3NMZ C;  2QA4 A;  2E3H A;  4C92 G;  4JRQ A;  1IZ6 A;  2FG0 A;  2V8I A;  1ZX6 A;  2D1X A;  4IUR A;  2KVQ G;  3EGD A;  5M9O A;  3E2U A;  2A36 A;  5GAN e;  3A5Z B;  2ZPF B;  2V1Q A;  3WVD B;  3FRN A;  2YUQ A;  3FDR A;  3OYJ A;  5GAO l;  5HKC A;  1VQK A;  5LJ3 e;  1T3S A;  4FT2 A;  4ATO A;  2F69 A;  2LNH B;  1VQL A;  4E7L A;  1LPL A;  1X75 C;  1RAD B;  4JJC A;  2ZPG B;  1M1K R;  4IKF A;  4AMC A;  1TS9 A;  2C0I A;  3O8V A;  1WX6 A;  4JJD A;  5FRO A;  4C8Q F;  4OMQ A;  2ED1 A;  1QCN A;  3A8H B;  3EGX A;  1FX7 A;  1WHL A;  3CXC P;  4OVA A;  4C0D B;  3OYB A;  3RKY A;  1LCK A;  4O5V A;  1H92 A;  3NHN A;  1FMW A;  5GAN h;  3M59 A;  1VOM A;  2DA9 A;  4IIO A;  5GMK e;  2EYW A;  1NJI R;  2RMO A;  1XNI A;  3CC2 A;  3CPF A;  2NUT B;  1UGS B;  1JEG A;  2E1H A;  3CCR T;  3MEW A;  5IT9 E;  3J7A F;  3OS1 A;  1QQJ A;  4FIB A;  1SF9 A;  1WJS A;  1Y96 B;  5HY6 A;  2K5L A;  3I56 T;  4HVW A;  4CC4 B;  1QCO A;  1UGQ B;  5AT1 B;  1VQ9 T;  2J7I A;  3NFC A;  4OP0 A;  1JJ2 A;  1QWF A;  3A1P A;  3RKW A;  3G7Z A;  4C8Q A;  2M16 A;  1VQ6 T;  1WXB A;  1OV3 A;  2HBP A;  1ZA1 B;  1OUL A;  4M77 G;  4B6M A;  4R0K A;  3CD6 T;  1YBY A;  1PKS A;  2M1H A;  2EBP A;  4PJO G;  2M51 A;  4J9B A;  1NBE B;  1R0C B;  5GAO n;  1VQN T;  1B34 B;  1QP2 A;  4Z8A A;  4MZT A;  4C8Q G;  3MO8 A;  3WXM B;  1K9M U;  5IHK A;  2DNU A;  4DBR A;  1Q82 C;  4Y92 A;  1AVZ C;  2JMC A;  1QVG P;  2D8J A;  2WSC E;  2CS7 A;  3RMS A;  4J9I A;  3LW5 E;  5HK3 A;  1YJN T;  2EYY A;  3CCS Q;  1AWW A;  3FB9 A;  5GMK l;  4XTX A;  2LCC A;  4A63 B;  1KD1 U;  1UFF A;  1VQ9 Q;  4AFU C;  3QWY A;  5GAO q;  2E4H A;  4XK8 E;  1WIE A;  4KGX B;  4M75 D;  2ZPH B;  4C92 F;  3MJX A;  2QQA A;  3X28 B;  4DBF A;  4GBQ A;  1OOT A;  2K5F A;  1YJW Q;  3UDC A;  1VQK T;  2GGR A;  1YN8 A;  3M57 A;  4NL2 A;  4EDU A;  3EG9 B;  3REA B;  4AFZ C;  3X26 B;  2RQR A;  2X35 A;  4OGC A;  3VRZ A;  3NPF A;  2A37 A;  5KYW B;  5GJW B;  4A4F A;  4JS5 A;  1Y71 A;  2ED0 A;  1S72 Q;  4OF1 A;  1I5O B;  4LDX A;  3JAM E;  2Z0W A;  4WTO B;  4A53 A;  1HD3 A;  2CUD A;  4IUQ A;  5GAM d;  1ZUY A;  2I0N A;  3CBP A;  2PQW A;  3HFN A;  4HT8 A;  3GNG A;  3NGP A;  4DOV A;  4PJO F;  4M75 E;  2R57 A;  4IIM A;  2EJ9 A;  1N5Z A;  3JCM W;  3RUX A;  1VYU A;  5I11 A;  4E7S A;  1ARK A;  4J5Y A;  5IXF A;  2ZPI B;  4JJB A;  4TVR A;  2QQS A;  5GAN 7;  3ZEH A;  1V29 B;  1I07 A;  2JN0 A;  4M77 E;  3EGX B;  1SRM A;  4B9X A;  5HK0 A;  1K9M R;  1PD0 A;  3EFO A;  2M02 A;  3HL8 A;  4PJO E;  1MMG A;  2XD0 A;  3BW1 A;  4FCY A;  3A8G B;  2YUN A;  1WXU A;  3H41 A;  1PNJ A;  4DEY A;  1FYN A;  4KRT A;  2XDD A;  2B86 A;  2FVU A;  1KC8 R;  4EMK B;  2EGC A;  3CD6 A;  5GAM j;  2DL7 A;  2ESW A;  1EFN A;  2EYZ A;  1IGU A;  1M8M A;  4DBH A;  4QW2 A;  1JRI A;  4RMO A;  3QPH A;  3QBY A;  3JB9 G;  2OJ2 A;  5GMK m;  3CMA T;  3S6W A;  1GCP A;  2QYZ A;  2L5Q A;  1AHJ B;  2ZPE B;  2RH2 A;  2CDT A;  1M90 R;  4WF2 A;  1YCY A;  1U8R A;  2AIR B;  1AT1 B;  1UGV A;  1RAF B;  4C8Q B;  1VQL Q;  3FEO A;  4XU2 A;  5GAN 3;  4MML A;  4M75 F;  2BE7 D;  1NEG A;  1MHN A;  2VV5 A;  3PFS A;  1I81 A;  5LJ3 j;  1VQ7 Q;  4FYV B;  2EQM A;  3GNF B;  3BDL A;  2HD0 A;  1KD1 C;  2CH4 A;  2DRK A;  3LLR A;  2FRY A;  2RI5 A;  2GQV A;  5GAN 2;  2H3J A;  2MIO A;  3CME A;  2DJZ A;  1QVP A;  3SB2 A;  3SWN C;  1W1F A;  3L42 A;  2H3E B;  2VGM A;  4JRP A;  3C94 A;  4J9H A;  4JZ4 A;  3MP6 A;  3V8J A;  2JVV A;  4OB1 B;  1K1Z A;  3VS5 A;  4OMO A;  1ZUK A;  2K3X A;  3LWH A;  3FC3 A;  1QVG A;  2YRV A;  4GLM A;  1VIF A;  1X43 A;  5GMK h;  1JXO A;  5A0D A;  2ECZ A;  4BDY A;  1OI1 A;  1UB4 A;  1VQO T;  1RI0 A;  1VQ5 A;  2BZY A;  2IVW A;  4C0D C;  1U3O A;  2RF0 A;  2CYZ B;  1KC8 C;  2OX7 A;  3E1S A;  3QYG B;  2LCS A;  1YHQ Q;  3H8Z A;  1AWX A;  1RLQ C;  2VAS A;  2HKN A;  2IG0 A;  3TSW A;  3CCR A;  1VQM A;  4M78 D;  3EG3 A;  3O5Z A;  1YCS B;  4J6W A;  1BU1 A;  1NJI U;  4HKE A;  2JTE A;  3J80 E;  2AKL A;  2O2O A;  2M0Y A;  1BBZ A;  2HL5 C;  1YJN Q;  1I5L A;  1RAI B;  4E7K A;  2E12 A;  1VQP T;  2RB6 A;  2DM1 A;  3VS7 A;  4F16 A;  1M1F A;  1M27 C;  2EVR A;  3CPW A;  2IPO B;  1ZSZ B;  4QVD A;  2LRQ A;  1TUD A;  2OTL T;  1VQ7 T;  3M56 A;  1LOJ A;  2L3Q A;  2XG8 D;  4JDS A;  2L8D A;  4A4K A;  5GAO p;  1WHJ A;  3VS4 A;  4BD3 A;  1VQL T;  4E7H A;  4RTY A;  3A98 A;  3VS0 A;  2DL5 A;  1GCQ A;  1H64 1;  1Q86 U;  3EFR A;  1KQ1 A;  3DB4 A;  1QCF A;  2JS2 A;  1VQO Q;  2MOX A;  3M55 A;  3U23 A;  2FEI A;  1T0H A;  1BIB A;  1NEB A;  1W6X A;  3LYI A;  1K4U S;  5GAN 4;  3OQ5 A;  3GF5 A;  2EYX A;  1NLO C;  2K9G A;  2EQJ A;  2E6Z A;  3H0F A;  4BI3 A;  3M58 A;  1BI0 A;  2WSE E;  4LDY A;  9ATC B;  1FMV A;  1PSF A;  3OYI A;  3CCE Q;  4HXJ A;  2LQW A;  3HRU A;  4D6W A;  3OYA A;  4F7U E;  1H3Z A;  4BI8 B;  4J8O A;  1AOJ A;  3X20 B;  3S3M A;  2RJC A;  1RLP C;  2ZZD A;  4EMG A;  4JZ3 A;  2CP6 A;  4QQ6 A;  3L2U A;  4RTV A;  3CCJ A;  1K0X A;  5KYY A;  3BFM A;  1ZQ1 A;  1K76 A;  3CCM A;  4Y91 A;  1ZHI A;  2J05 A;  2RNA A;  2RHY A;  1RAE B;  1X2K A;  3RMQ A;  4C5G A;  3M0U A;  4C0G A;  1F1B B;  4F04 B;  2KSS A;  5KE3 A;  2DD5 A;  5LJ5 h;  3HTR A;  2J06 A;  1OQK A;  1D09 B;  5GJV B;  4F7U G;  1VQ5 Q;  4DBQ A;  1Q86 C;  1M3C A;  3OYE A;  4HCK A;  4OMF B;  2HSE B;  3VYG A;  3I55 Q;  1SPK A;  1XOV A;  4NS5 A;  2CZ6 B;  2HMA A;  4BY6 B;  3UF4 A;  1E7O A;  4X9C A;  4HCB A;  2K3Y A;  3ZFJ A;  4OB0 B;  2EKO A;  2A3L A;  2R5A A;  2FB7 A;  3CCV A;  3VRY A;  1IGQ A;  2CUB A;  2NUP B;  5LJ5 f;  1H3H A;  1VYV A;  1N6A A;  2RQW A;  1K8A U;  5IXB A;  2GBQ A;  1D1C A;  1I8F A;  5GAO r;  1NJI C; 
#chains in the Genus database with same CATH homology
 1Y96 B;  3OSS C;  3ME9 A;  4KBM B;  5HY6 A;  4N0A C;  2G3R A;  2K5L A;  4OGE A;  3I56 T;  2RK2 A;  1EIF A;  2RD1 A;  1BIA A;  4M7A B;  4QVZ A;  3SDZ A;  3QII A;  1VIE A;  4M75 A;  3CCM T;  5I2S A;  4L59 A;  1UGQ B;  5FU7 C;  1WQ7 A;  1VQ9 T;  2E65 A;  4RCB A;  2PUK B;  3HSB A;  1D3B A;  3NFC A;  2P4T A;  4OP0 A;  3F70 A;  5GAM h;  1JJ2 A;  3HKS A;  3VU3 C;  3CCS T;  1YJW A;  3RKW A;  3G7Z A;  4JUV A;  4FM4 B;  1U1T A;  4C8Q A;  2YLC A;  2CZ7 B;  2M16 A;  1Q81 U;  5GAN j;  1VQ6 T;  2PVG B;  2HBP A;  4M78 E;  2B8A A;  1OZ3 A;  2HQE A;  3V8K A;  4M77 G;  3CC4 A;  5D6W A;  1VQO A;  3QYH B;  3CD6 T;  1YBY A;  4R56 A;  4M77 B;  5FRN A;  2VXF A;  2M0O A;  4F7U F;  2M1H A;  3MCA B;  3JCM d;  4M7A D;  4PJO G;  3L2R A;  3OS1 A;  4M78 B;  5GAO n;  1VQN T;  4R55 A;  4F7U B;  4PJO C;  5GAN f;  1B34 B;  1QP2 A;  2DIQ A;  1W4S A;  5LJ5 j;  4MZT A;  2DXT A;  3M53 A;  4C8Q G;  3L2V A;  3MO8 A;  3OS2 A;  2K4Y A;  3WXM B;  1S72 T;  1K9M U;  4IUP A;  4M77 C;  4M7D D;  1Q82 C;  2OAU A;  1Y96 A;  3NTK A;  1K8A C;  4OB3 B;  2WSC E;  4C0F A;  1M9S A;  2CGH A;  3G4S T;  2XU8 A;  4ZGJ B;  5C0M A;  2CS7 A;  3RMS A;  3PIO A;  3CCQ T;  3V7R A;  1VQ9 A;  4ME7 A;  1LJO A;  4N0A A;  2E70 A;  1VQ6 A;  3LW5 E;  5LJ3 h;  4N4I A;  4BAC A;  5HK3 A;  1YJN T;  3OYD A;  5CCA A;  1D3B B;  4MMK A;  1W2B S;  1N27 A;  3FB9 A;  4MDW A;  5GMK l;  1YI2 T;  4L5G A;  4XTX A;  4M77 F;  2LCC A;  2Y90 A;  4PLI A;  2XK0 A;  1KD1 U;  1M90 U;  1U1S A;  4XTU A;  2PVD B;  2MMP A;  3M4G A;  2BUD A;  3EFS A;  4ZTF A;  2E41 A;  1FXX A;  2QQ9 A;  5GAO q;  3JCM Q;  2YLB A;  2DK3 A;  3LGF A;  4XK8 E;  2GCX A;  4M7D E;  4M75 D;  2ZPH B;  2VC8 A;  1B34 A;  4C92 F;  3BDU A;  3MET A;  3X24 B;  2A7Y A;  3G4S A;  4DA4 A;  2QQA A;  5LJ3 f;  4ELZ C;  3OYH A;  2P0P A;  4M7A G;  2WAC A;  3X28 B;  4ZGE B;  3P8B B;  2K5F A;  2PUO B;  2RJF A;  4C8Q D;  3UDC A;  2FL7 A;  3CCL T;  1YHQ A;  3VJP A;  1VQK T;  3L2W A;  5CO7 A;  3JRZ A;  3M57 A;  4NL2 A;  3SFM A;  3TRE A;  2LDM A;  3CBO A;  4C92 D;  4EDU A;  3QJY A;  1RL2 A;  3V8L A;  1KQS A;  3X26 B;  4BY6 C;  2X35 A;  4OGC A;  3RER A;  3JCM J;  3MEU A;  3P8H A;  2VXE A;  4M75 C;  2LTO A;  2RJE A;  4N4H A;  3CXC A;  4A4F A;  1SSF A;  4JS5 A;  1Y71 A;  1YJ9 T;  1NJI C;  4OF1 A;  3NTH A;  5J26 A;  4C5E A;  5DLO A;  4XTY A;  2DXU A;  4LDX A;  3JAM E;  3HRT A;  3RES A;  3G6E A;  3JB9 H;  3I55 T;  2DEQ A;  4A53 A;  5GAM d;  4IUQ A;  4QQD A;  3JB9 J;  3LH0 A;  3CBP A;  1P92 A;  3CBM A;  5A0G A;  1KHI A;  2D6F A;  3L1A A;  1VQ4 A;  2PQW A;  3HFN A;  2GFU A;  2Y4X A;  2XKO C;  3BY7 A;  3GNG A;  1K73 U;  4HT8 A;  2DTH A;  4C0Z A;  4A54 A;  4PL6 A;  2RM4 A;  1JJ2 S;  2JZ2 A;  1Y7X A;  2D0Q B;  4PJO F;  2ZPB B;  4M75 E;  4DOV A;  3CCL A;  5FRM A;  2R57 A;  1BYM A;  1TH7 A;  2EJ9 A;  1OZ2 A;  3QZ9 B;  3RUX A;  2VUB A;  2F5T X;  3JCM W;  3PGG A;  1I4K 1;  4JJN K;  2DTO A;  1N9R A;  2JTM A;  1G3S A;  2AHJ B;  2E6N A;  1Q7Y C;  4M7D B;  4PJO B;  2OTJ A;  4J5Y A;  2P0K A;  2ZPI B;  3UT1 A;  5KCO A;  4C92 B;  4TVR A;  2DXB A;  1NZ9 A;  2LX9 A;  2QQS A;  5GAN 7;  1YIJ T;  1VQ8 T;  1DJ7 B;  4FT4 A;  4PLL A;  4VUB A;  3ZEH A;  1V29 B;  4BB7 A;  4L6V 5;  2QI2 A;  2HNI A;  2JN0 A;  4C8Q E;  4EMH A;  1VQ7 A;  2EIF A;  4M77 E;  2VYT A;  4B9X A;  5CAI A;  5HK0 A;  2QQB A;  3HL8 A;  4PJO E;  2XD0 A;  2DZC A;  4J6X A;  3BW1 A;  4YTL A;  1WJR A;  1M1G A;  1M4Z A;  2DIG A;  2F5K A;  5FU6 B;  3JCM P;  3A8G B;  1VQ4 T;  3G71 T;  4JRK A;  5GAN g;  4M77 D;  3DKM A;  4BE2 A;  2XDD A;  1YJW T;  3CCE T;  5A2Q E;  5GAN 6;  3CCU A;  3TU4 K;  2FVU A;  3KUF A;  2RHZ A;  2MWO A;  1NE8 A;  4P5N A;  4NOY A;  3JCM e;  4V2S A;  2OTL A;  2JNG A;  4IUT A;  2HAX A;  4EMK B;  3OYM A;  2OTJ T;  3CD6 A;  4XQ3 A;  5GAM j;  2JOY A;  2E10 A;  3FIF A;  5L8R E;  2CZ1 B;  3I56 A;  5J3B A;  1BKB A;  5CKH A;  5LL6 S;  4OB2 B;  3OYL A;  1X01 A;  4M7D A;  1ZBX A;  4QW2 A;  3RIR A;  1JRI A;  2Y4Y A;  3CEY A;  3M54 A;  3QUI A;  5GAM e;  4RMO A;  3QHS A;  2LQ8 A;  3QPH A;  4RCC A;  3J81 E;  3QBY A;  4KUI A;  3JB9 G;  1Q7Y U;  2DPP B;  2ZGW A;  5A0L A;  5GMK m;  3CMA T;  4HCC A;  4MDX A;  3S6W A;  3G6E T;  2L5Q A;  1AHJ B;  2ZPE B;  1XTD A;  2RH2 A;  3OS0 A;  3I55 A;  1O9S A;  3AHU A;  3G71 A;  1BI1 A;  2MF2 A;  4J7I A;  4IUU A;  3ER0 A;  4E47 A;  4ZN1 A;  2GFA A;  3OYK A;  5CR2 A;  3GP8 A;  4WF2 A;  5GAN 8;  3CME T;  1YCY A;  4C92 E;  3CCQ A;  1U8R A;  1K73 C;  3L2Z A;  4FSX A;  4LD6 A;  4DOW A;  3DLL A;  2DD4 A;  3QG1 A;  4DQ2 A;  1KQ2 A;  4C8Q B;  3FEO A;  4XU2 A;  5GAN 3;  4MML A;  1G3Y A;  1X6O A;  5CK9 A;  4M75 F;  1VQM T;  3JB9 I;  2K57 A;  4LDV A;  4M78 C;  2K2V A;  1MHN A;  2VV5 A;  1S72 A;  5CKB A;  3PFS A;  3WVE B;  5IN1 A;  2QEX T;  3VV0 A;  1I81 A;  5DLQ E;  3MEA A;  4PNO A;  5FU6 C;  5LJ3 j;  4EMK A;  2DTI A;  1QW1 A;  2RA2 A;  3JSC A;  3M9Q A;  4M78 A;  4C5I A;  4A4E A;  3OYG A;  1M1K C;  2EQM A;  2O4X A;  3OBY A;  4F7U A;  4BE1 A;  1QVF S;  1HK9 A;  1VUB A;  3GNF B;  2XID A;  3BDL A;  2NLU A;  5CKD A;  5CQX A;  2HD0 A;  1KD1 C;  3LLR A;  2MAM A;  2X4Y A;  1VQP A;  2RI5 A;  2GQV A;  3PTA A;  5GAN 2;  4ELY C;  3CC7 A;  1VQ5 T;  2H3J A;  3A8L B;  3CME A;  2DJZ A;  3DB3 A;  4M7A C;  1QVP A;  2EYQ A;  3ZBD A;  3C95 A;  1W2B A;  2JTF A;  3SB2 A;  3SWN C;  4C8Q C;  4CI0 C;  3JCM X;  5GAO m;  3JB9 D;  3L42 A;  2K5I A;  3Q1J A;  2VGM A;  3GPL A;  4HT9 A;  4JRP A;  2X4J A;  5D6Y A;  3C94 A;  3OW2 A;  1Y07 A;  2RHU A;  3GLX A;  2FHD A;  5LJ5 d;  1XQH A;  5GAN d;  5LJ3 g;  2PU9 B;  3MP6 A;  3V8J A;  3OY9 A;  2KAF A;  2X4X A;  2JVV A;  1O75 A;  4OB1 B;  3SWN A;  2WSF E;  2XDP A;  3QSU A;  1QVF A;  1K9M C;  1BI3 A;  4CRI A;  2K3X A;  4JS4 A;  3OMG A;  3LWH A;  3FC3 A;  2LCL A;  3E9F A;  2YRV A;  4XTZ A;  1QVG A;  4BUG A;  1VIF A;  4M7D F;  4GY5 A;  3HHT B;  5J39 A;  3QDR B;  1WJQ A;  1QVG S;  4MZP A;  3HP9 A;  5GMK h;  1YHQ T;  5A0D A;  3KBG A;  4BDY A;  2KK4 A;  2DVE A;  1OI1 A;  1UB4 A;  3N5B B;  1VQO T;  1RI0 A;  1VQ5 A;  2YHT A;  3V7S A;  2LT1 A;  4EMK C;  2R5M A;  1BI2 A;  3MEV A;  2V8J A;  2IVW A;  5I21 A;  1JB0 E;  3S3N A;  3OW2 S;  3JCM h;  1YIT T;  5GMK i;  4C0D C;  2CYZ B;  1KC8 C;  3CCV T;  2C06 A;  3E1S A;  1M5Q 1;  2XIC A;  3QYG B;  4JLG A;  4M7A E;  5GAO r;  2ZCF B;  1YJ9 A;  1Q82 U;  1WGS A;  3H8Z A;  5DY9 A;  3URG A;  1M1K U;  3JCM f;  2EQK A;  2IG0 A;  4RG2 A;  3OYF A;  3CCR A;  3VUZ A;  2VGN A;  1N8R U;  1VQM A;  4QVC A;  3CCJ T;  4M78 D;  1N8R C;  4LDW A;  1QP3 A;  4J6W A;  5GAM g;  4PKC C;  3SWN B;  3CMA A;  1UGP B;  3QZ5 B;  1NJI U;  2L89 A;  4HKE A;  4JRI A;  3C4S A;  2KQW A;  4B9W A;  3PT9 A;  3J80 E;  1IRE B;  4XU1 A;  1KC8 U;  2FYK A;  1WPY A;  2LNV A;  3L2Q A;  3SD4 A;  1Q81 C;  3E19 A;  4M77 A;  1YI2 A;  3CCS A;  1G5V A;  3H6Z A;  2O01 E;  3PMI A;  4E7K A;  2E12 A;  4N4G A;  1I5L A;  1WNL A;  2X4W A;  2L3R A;  4M7D C;  5IAY A;  2E5Q A;  2RB6 A;  3LGL A;  5AYF A;  1VQP T;  5GMK j;  3NTI A;  1M1F A;  3JCM b;  2I2L A;  2R58 A;  3CC4 T;  3CPW A;  4UC4 A;  4FL6 A;  2P0Q A;  2XDB A;  2EWN A;  3OSV A;  3CCE A;  1VQ8 A;  4QVD A;  3C12 A;  4Z02 A;  4J7F A;  2LRQ A;  3JCM g;  3A8O B;  2OTL T;  1VQ7 T;  4A4G A;  3M56 A;  1LOJ A;  4XU0 A;  2EFI A;  2EQU A;  2XG8 D;  3E9G A;  3S3O A;  4JDS A;  2XHC A;  2L8D A;  5GAM f;  3MHX A;  3FLG A;  3X25 B;  2HQX A;  5I2M A;  4A4K A;  4NL3 A;  2DKG A;  5GAO p;  1G3W A;  4KT0 E;  4BD3 A;  1VQL T;  2DAQ A;  2RO0 A;  2QDY B;  5FLX E;  4XAX B;  3VYH B;  4FU6 A;  3UPU A;  4E7H A;  2RJD A;  1LNX A;  4KUL A;  4O6J A;  5LJ3 d;  4BDZ A;  2RHI A;  1OYX A;  1H64 1;  3OB9 A;  1HXD A;  4J6Y A;  1PSE A;  3MP8 A;  3EFR A;  1KQ1 A;  1Q86 U;  3DB4 A;  4M78 G;  3JB9 F;  4IUV A;  3CCU T;  3OS5 A;  4PJO D;  2RK1 A;  4C5H A;  3INZ A;  4XU3 A;  3T9N A;  3M55 A;  4RKU E;  1VQN A;  2JUF A;  1YJN A;  4MZM A;  2D9T A;  4ZGD B;  1BIB A;  5CIU A;  3LYI A;  2LT4 A;  5GAN 4;  3OQ5 A;  3PNW C;  5D6X A;  1KQS S;  3GF5 A;  2DXC A;  3FJP A;  2KMT A;  3GIB A;  2BIV A;  5FU7 B;  5CKE A;  1N9S A;  2E6Z A;  2EQJ A;  4BI3 A;  3M58 A;  2QEX A;  3R6O A;  3VKI A;  3VUB A;  1BI0 A;  1JBM A;  3ASK A;  3GOX A;  2WSE E;  3OA6 A;  4BE0 A;  4EPC A;  4LDY A;  3JCM c;  1UGR B;  2QQR A;  4HCZ A;  4ZTJ A;  1PSF A;  3OYI A;  2PVO B;  2QA4 A;  5KE2 A;  1R8O B;  4C92 G;  3LX7 A;  3HPW A;  3HRU A;  2MI6 A;  4D6W A;  1IZ6 A;  3OYA A;  4F7U E;  4JRQ A;  2V8I A;  5CQY A;  4BI8 B;  2E64 A;  1H3Z A;  1GXI E;  1WQW A;  2MWP A;  4IUR A;  4J8O A;  2KVQ G;  4X9D A;  3X20 B;  4E7I A;  2RJC A;  3MP1 A;  3S3M A;  5EG2 A;  3CC7 T;  5M9O A;  4Q5W A;  2ZZD A;  5LJ5 e;  5GAN e;  2RHX A;  2BKD N;  4EMG A;  4X34 A;  1NPR A;  4ZN3 A;  2KDS A;  3OBW A;  3A5Z B;  2CKK A;  4QQ6 A;  3L2U A;  3OYC A;  2ZPF B;  3CCJ A;  1G3T A;  4M7A F;  3BFM A;  3WVD B;  3FRN A;  1ZQ1 A;  3CCM A;  4Y28 E;  2EJG A;  4Y91 A;  4BI4 A;  3KXT A;  3TCJ A;  3LWI A;  1ZHI A;  3DLM A;  3FDR A;  3CPW S;  2RHY A;  3V7C A;  3OYJ A;  3RMQ A;  4C5G A;  5GAO l;  3M4Y A;  4C0G A;  2XI9 A;  3RKX A;  5HKC A;  3UWN A;  4LDU A;  2KSS A;  5KE3 A;  1VQK A;  5LJ3 e;  2DD5 A;  4C92 C;  2O4X B;  4FT2 A;  5LJ5 h;  4ATO A;  2QTX A;  2F69 A;  5KH6 A;  1VQL A;  4E7L A;  3OYY A;  1X75 C;  2EAY A;  4QQG A;  3QKJ A;  3A8M B;  4PJO A;  4F7U G;  2ZPG B;  2M9U A;  4IKF A;  2LQK A;  1Q86 C;  3OYE A;  5C6S A;  3HRS A;  4C92 A;  4OMF B;  3O8V A;  3QXE B;  4M78 F;  3CC2 T;  3PIP A;  5FRO A;  4C8Q F;  1KG1 A;  3VYG A;  2CZ0 B;  1YIT A;  5GAN 5;  3A8H B;  2EJF A;  1FX7 A;  5CKF A;  4M7A A;  1XOV A;  3CXC S;  2DZ9 A;  3OMC A;  5LJ5 g;  4M75 B;  2V8K A;  4E7J A;  2LVM A;  4XTW A;  1YIJ A;  1FWZ A;  4OVA A;  4C0D B;  1KHC A;  4HA8 A;  3OYB A;  4NS5 A;  3RKY A;  2QXF A;  4GLK A;  2CZ6 B;  4O5V A;  4BY6 B;  4II1 A;  2LC4 A;  5GAN h;  1UEB A;  4X9C A;  3TEE A;  1NPP A;  4JLI A;  5KCH A;  1M90 C;  3M59 A;  4HCB A;  4KUD K;  2KY9 A;  2K3Y A;  3ZFJ A;  3M5A A;  4OB0 B;  5GMK e;  3QO3 A;  4M75 G;  2EKO A;  2A3L A;  2R5A A;  5CVI A;  3JCM V;  2FB7 A;  3CCV A;  4LD9 K;  1XNI A;  3P8D A;  1M8V A;  2QA4 T;  5DM7 R;  3CC2 A;  4M7D G;  2RI3 A;  3PMT A;  3HFO A;  5LJ5 f;  3CPF A;  1UGS B;  2DO3 A;  2E1H A;  4RG8 A;  3EAE A;  3CCR T;  1N6A A;  3MEW A;  3QJ6 A;  5IT9 E;  4XTV A;  1K8A U;  1I8F A;  1MGQ A;  3J7A F;  2GF7 A;  2RI2 A;  4J83 A;  4FIB A;  3OYN A;  1WJS A;  4A4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...