2RI3A

Crystal structure of the 3-mbt repeats from human l3mbtl1 with n358q point mutation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
315
structure length
313
Chain Sequence
b'SWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMQPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 75
structure length 313
sequence length 315
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri3A03
2EFIA 2R57A 3F70A 5FROA 5CIUA 3OYEA 2BUDA 5FRMA 4Q5WA 3DLMA 2GFAA 3SD4A 3E9GA 3OYDA 3MEWA 3OMCA 1OYXA 1N27A 3E9FA 2RJCA 2FHDA 4C5GA 2X35A 2RHXA 3S3NA 2X4WA 4RG2A 4B9WA 2P0KA 2L3RA 3H8ZA 4X34A 5J39A 4B9XA 3L2VA 2O4XA 3OYFA 2JTFA 3PFSA 2CKKA 3BDLA 3LYIA 3QKJA 1SSFA 2G3RA 2VYTA 2RJEA 4LD6A 3PNWC 2RHZA 3META 3NTIA 2R5MA 4E7LA 3S3OA 3OA6A 4E7KA 2X4XA 3OS2A 2RI5A 4QQDA 3OYIA 4BD3A 5D6XA 3P8DA 3P8HA 3MP1A 2IG0A 3MEVA 3O8VA 1RI0A 2DIGA 2RJDA 2BIVA 4IUVA 3OYNA 2K3YA 4QW2A 4A4GA 2YRVA 5C0MA 3MEUA 2F5KA 4N4GA 4FU6A 4L59A 3L2UA 2L8DA 5KCOA 2HQEA 2NLUA 4IUPA 4BDYA 2M1HA 3DB3A 2L89A 5KE3A 4II1A 3QJ6A 3UT1A 3EAEA 2RI2A 3FC3A 1XNIA 3S3MA 3S6WA 4QQGA 3L2RA 2R5AA 5IN1A 2XDPA 3LGLA 5KH6A 3OS1A 2MWPA 3OYJA 3LLRA 5M9OA 3OYCA 1WGSA 3OQ5A 2EQMA 2QQSA 2JZ2A 3ME9A 5KE2A 4IURA 4IUUA 3OYLA 3L2WA 4HCZA 4E7JA 4BE2A 3LX7A 2RHYA 2D9TA 2X4YA 3NTHA 4OVAA 2E5QA 3FEOA 3GOXA 5KCHA 3DB4A 3MO8A 4ZTJA 4PLIA 2GF7A 5D6WA 3UWNA 3OMGA 2R58A 2M16A 2XK0A 2RJFA 3M9QA 2K3XA 3ZEHA 3LH0A 4A4EA 4A4HA 3L2QA 3FLGA 1KHCA 2LVMA 3OY9A 4PLLA 3OYAA 4QVZA 3OYHA 2PQWA 4BACA 2O4XB 4BE1A 4IKFA 4PL6A 3OYGA 3H6ZA 4FL6A 4NS5A 3OS0A 2RO0A 4UC4A 4E7IA 3CEYA 3L42A 4BDZA 2DAQA 2RHUA 2EQKA 2B8AA 4N4HA 4ZTFA 3PMTA 3ASKA 3QBYA 4C5HA 3QIIA 1G5VA 3PMIA 2EQUA 2EKOA 4GY5A 3MEAA 1OI1A 4C5IA 3OYMA 2DIQA 3C4SA 2LRQA 5FRNA 2LCCA 5C6SA 2HQXA 2RI3A 3NTKA 1H3ZA 3OYKA 3Q1JA 4QQ6A 3MP8A 1OZ2A 1MHNA 2LDMA 2WACA 3OB9A 4N4IA 5D6YA 3OYBA 5IAYA 3LGFA 1WJRA 2EQJA 2E6NA 2QQRA 2M0OA 3FDRA 4E7HA 4Z02A 2RHIA 3KUFA 4EDUA 4C5EA 1WJSA 2BKDN 4IUTA 1WJQA 4CRIA 5J26A 4BE0A 4IUQA 2LTOA 1OZ3A 3MP6A 2MWOA 4A4FA 2GFUA
chains in the Genus database with same CATH superfamily
3CCJA 1AD5A 4JJCA 2DYIA 4Q5WA 4AT1B 1VQ5A 2F2WA 2OX7A 3E9FA 2FHDA 5GMKh 4JS4A 3OYYA 3G6EA 2VASA 2HCKA 1YP5A 4ZGEB 1Z9QA 4FM4B 3M57A 2O31A 1NJIC 3S3OA 3CXCS 1KC8U 3OS2A 1M4ZA 4NL2A 1IHVA 4DBQA 2MYSA 2GCXA 2RJDA 3CPWP 4A4GA 1FYNA 4O6JA 4BY6B 4XTVA 1G83A 1RADB 4PK4A 3CCLA 3EAEA 4HT8A 5IHIA 4FT4A 2EYZA 3L2RA 3HRTA 3CCST 3CCRT 3H41A 4M7AA 2L0AA 1BIBA 4RCCA 4CC2A 3J81E 3PVQA 4RG8A 1PD1A 1Z9ZA 4LUDA 1AVZC 2QAZA 4DOWA 2EJGA 3CCUT 1Y96A 4M7AD 3CC7Q 2CZ0B 2XDBA 1PD0A 4NS5A 1SG5A 2DAQA 4F7UB 1GBRA 4DBRA 2PVDB 1H3HA 3E2UA 4OB2B 2DL3A 4JUVA 1U1SA 2RK1A 2AKKA 3M0UA 8AT1B 5KYYB 1YHQQ 3EG9B 1IHWA 3NTKA 4OP0A 1JO8A 1B07A 1VA7A 1ABQA 2DX1A 1Y07A 2BE9B 2CYZB 5D7UA 2JW4A 1WJQA 4BE0A 4M7DF 1SEMA 2RQTA 4JLIA 1VYUA 3JCMg 3A8OB 2L5QA 2R57A 1SF9A 3DLLA 1BCOA 3GNGA 2V1QA 2KRSA 4C5GA 3T9NA 4JZ3A 2DLPA 3R6NA 1YCYA 5KYWB 2PZ1A 1K8AU 2PVGB 2JMAA 1JXMA 3BDLA 3LYIA 2G3RA 2RJEA 3LWIA 2MI6A 1SRMA 2JN0A 1X2QA 3BDUA 3CCMQ 3RBBB 1QCOA 2CH4A 2E70A 2KRNA 3P8HA 4C8QF 4J5YA 2J6OA 3GIBA 2DIGA 3CCVT 1VOMA 3FB9A 6AT1B 1KC8C 1TSFA 5KCOA 1ZA2B 1SKUB 4KT0E 2F1LA 4MZPA 4BI4A 5FU6B 1TUDA 3CC2T 3CC4T 5KH6A 3SEMA 1QCNA 3KBGA 2DJQA 1VQ9T 2P0PA 3M0PA 4HCZA 2QQ9A 4F17A 1UUEA 2D9TA 2F2VA 2K9GA 5FWCA 3EGDA 5DM7R 1K9MR 1D3BB 2M51A 1ZSZA 3UWNA 1VQ8T 2BTTA 4AFZC 5GJWB 5LJ5f 3ZEHA 1WLPB 4DOVA 1ZUYA 2BZXA 4C92C 1CKAA 4BACA 1C0MA 4FL6A 1IXDA 3HRUA 1QP3A 4AG2C 3I56T 1AOJA 1KHIA 2BZYA 4V2SA 2CP0A 1WHKA 1U06A 1K8AR 2JTMA 1YJWQ 3JB9F 3VU3C 1JJ2P 4E47A 5D6YA 1VQNT 2DEQA 2COYA 1YHQA 3MJXA 3ULRB 1C1AA 2DXTA 4LXCA 7AT1B 1SPKA 5EG2A 3CD6A 2YLBA 5KYXB 2DYBA 4F7UF 4CC4B 3JCMh 3E1SA 2ZZDA 5I2MA 3HSBA 4M7DD 3VRYA 3OW2P 4MDWA 3PIPA 4B9WA 2CP5A 4E7SA 3VS1A 2K5FA 2QYZA 2D8JA 5GANd 2E1HA 3OYFA 2A08A 2EBPA 3X28B 2D0NA 4O5VA 1QP2A 1K73R 2Z0WA 5GAMf 2RK2A 2AK5A 2NYSA 1Q81U 1K8AC 1WI7A 1GXIE 1I0CA 2CP6A 3CCMA 1C6VX 2DD5A 1N9SA 4C8QD 2EPDA 3UT1A 3FC3A 1YJ9Q 3CMEQ 3I55A 4PJJA 5IH2A 3QG1A 3QXEB 2A28A 5M9OA 2EQMA 2YHTA 2FVUA 3VYHB 2YWWA 1VQPQ 1WXUA 3EGUA 3RKYA 2X4YA 2K6DA 1QVGS 2VKNA 2DF6A 1KD1U 2ED1A 1SHFA 2RJFA 3LW5E 1UHCA 3JSCA 2PQWA 2A37A 2LJ0A 2ROLA 3LH5A 4KUDK 1KFZA 2HNIA 3M5AA 5LJ3j 3TSZA 5CQYA 2L3SA 2HMAA 1VIEA 4KH0B 1G5VA 1M1GA 2FG0A 3JCMX 3G71T 3C4SA 3M54A 2KBTA 3FJ5A 4QQ6A 2QASA 1MHNA 4BB7A 4QT7A 2EGCA 2CP2A 3REAB 2EYYA 1LJOA 4N0AC 2EQIA 2RHIA 1G2BA 1VQKT 3JB9D 4F7UA 4ATOA 1GCQA 3CCEQ 1J3TA 2YLCA 5KYYA 3SB2A 2VXEA 5HCKA 3VYGA 3TSWA 2K5LA 3S3NA 3H0IA 5HY6A 5GMKi 1JXOA 1VQOT 3M4YA 2O4XA 2JTFA 4Z8AA 5GAN5 3NHNA 3JB9I 1OULA 4E7KA 1PNJA 2MK5A 1NLPC 1W70A 1MV3A 1M30A 1D1CA 1OU8A 4A4KA 2DXCA 2DKGA 3V7SA 2YT6A 3TU4K 5LJ3g 1BBZA 2QA4T 2L89A 1S72Q 1NEGA 2FO0A 3PGGA 4RTYA 3BFMA 5CKEA 2ROTA 1R0BG 1Q81C 2R5AA 1VQLQ 1HXDA 1H92A 1QW1A 4XU2A 4Y91A 3OYLA 1QKWA 1YJ9A 3CMEA 2RHYA 1W2BS 1FWZA 2I0NA 3MO8A 1WQWA 2QEXT 2SRCA 4J9FA 2XK0A 2RQVA 2OTJQ 2QG9B 2RQRA 1OX9A 4JJDA 3M4GA 2K3BA 1EIFA 4XTUA 1KD1C 1WIEA 1B34B 1VQ7T 4M7AE 3FJPA 3JCMd 1YI2Q 3V8LA 3C94A 3OSVA 2LQKA 2ENMA 2A7YA 2HKNA 4J9GA 3OYMA 3MPUB 2AZVA 2LCCA 4M7AG 3Q1JA 4BUGA 3OYBA 2KK4A 2LX7A 2DL8A 4E7HA 1KQSP 2RQWA 2JM9A 1PHTA 1V1CA 4EDUA 3AT1B 4IUTA 5J26A 2LC4A 2BUDA 4RTZA 1YCSB 5GANe 3OYDA 2WSCE 3A5ZB 3CCEA 2FPEA 2P4TA 3HRSA 4C0FA 2C0OA 2LQNA 2CDTA 1X6GA 1YIJT 1NBEB 2KI7A 4E7LA 4RTUA 1VQ6Q 2FEIA 5KYXA 5CAIA 4B6MA 1P92A 2MIOA 5CR2A 4PFPA 1ARKA 5C0MA 3OS5A 3EG3A 4PJOC 2VUBA 1UGRB 1Q86R 1OEBA 1TH7A 2NLUA 2KY9A 3DB3A 3QJ6A 5LJ3h 1WX6A 4ZN1A 3HHTB 2DZ9A 4L5GA 1U1TA 4KH1B 2MWPA 1W6XA 1WGSA 2EWNA 4J9HA 2QQSA 1VQMT 4HCCA 1X2KA 5KE2A 2DA9A 2RH2A 4BE2A 2CZ6B 1QVFS 1N5ZA 1NEBA 2P0QA 4K11A 2CGHA 4EMGA 1VQ4Q 2OTLA 3M9QA 4CC7A 2V8JA 1D0ZA 3FLGA 3G4SQ 3CCSQ 3KXTA 2A0FB 2X4JA 2GBQA 2MMPA 4M75C 1TUCA 3RR6A 2JUFA 3UA7A 2VC8A 2DNUA 3VV0A 3QIIA 4F16A 4QVDA 3VUBA 3QZ9B 3M56A 4FIBA 5LJ5e 1NE8A 1PM3A 1ZHIA 1PKTA 2EVRA 5HKCA 2ED0A 4MZMA 1YI2A 1Q86C 2KVQG 1Y0MA 2DO3A 4Z02A 1NJIR 3EG2A 2FZKB 1WJSA 1QVFA 2KDSA 4M7DB 4IUQA 3RESA 2L2PA 1GRIA 5DLOA 4OB0B 3GPLA 1XJWB 4XTWA 2G6FX 4F14A 1MV0B 2DFUA 1JQQA 2X35A 1JU5C 2JXBA 3ZFJA 3H8ZA 3L1AA 2C0IA 4M7DE 1Q7YU 1AT1B 4RTXA 2E12A 4LD6A 2DRMA 1YN8A 4M7DG 1RAHB 1PRMC 1VQ6A 5IHKA 1NM7A 5HK0A 5GAOr 5I2SA 1WQ7A 5GAMe 1XNIA 1EZZB 2COWA 4C8QE 3CCJT 1N8RU 1PCXA 2L3QA 3O5ZA 4C92F 1UHFA 1VQ5T 4JRPA 4LNPA 1U3OA 2VB6A 3G6ET 3L2WA 3QJYA 4C8QG 1IRXA 1W1FA 1OU9A 1UECA 1KHCA 3CC2Q 3CC4Q 1OQKA 3OYHA 4QVZA 4ELZC 1VQ4A 2QI2A 4M77C 3QHSA 4PJLA 1S1NA 2O9SA 3G4SA 2P4RA 4XU0A 2E65A 3CCLT 1VQ8Q 4RMOA 3EHRA 3CXCA 2DL7A 1MMGA 3M0RA 3EH1A 3JCMP 1DJ7B 5CVIA 1MUZA 1VUBA 2KE9A 3VS2A 2BKDN 1NYGA 4CRIA 1KSWA 4X9DA 3REBB 5AYFA 4PLLA 4MDXA 3PE0A 2MAMA 1OV3A 2FRYA 3INZA 1RLQC 4J83A 2CUDA 2RJCA 3EFRA 1KC8R 3JB9G 1IZ6A 5LJ3d 4YTLA 5GANf 3QDRB 2CKKA 4MMKA 2RHZA 4F7UE 1LNXA 1WZOA 2K4YA 3OYIA 2DK3A 4X9CA 4BD3A 1M3CA 2EJFA 1Q7YC 2KNBB 4F7UG 1NPPA 2JT4A 4HXJA 3GBQA 3MEUA 2YUQA 5KYUB 5A0GA 2ZPHB 3HKSA 5L8RE 4IUPA 1GFDA 5KYNA 2OAWA 4JDSA 4DA4A 4DQ2A 2IVWA 1FMKA 4PFZA 3HPWA 4IUUA 5GAN4 4J9EA 4OVAA 3CMAQ 4C92D 5GAN2 5FU7C 2WSEE 4R56A 2DBKA 4E2FB 1I81A 2FYKA 5D6WA 2R58A 4A4EA 2CREA 4JJBA 4J9CA 2HZYA 1ZUKA 3QZ5B 1UGSB 2GQIA 2IIMA 2A36A 1H641 4ESRA 5GAOp 2LQWA 2PTKA 1ZX6A 4C5IA 4LE9A 1UDLA 1Y71A 1B3QA 3RKWA 2E41A 4PJOB 3JCMJ 2WACA 1X43A 2KSSA 4RTTA 3CXCP 3KUFA 2DTHA 1AHJB 1M2OA 4A4FA 1D0XA 2GNCA 2EFIA 4HVWA 5CKDA 2F5TX 3I5RA 3CC7A 2MF2A 2L3RA 1GFCA 4B9XA 3LWHA 4M7DA 3PFSA 1FMVA 4KBMB 4ZGJB 3CCQQ 5GAN3 4M75B 1JB0E 2XU8A 2V1RA 1ZSGA 1H8KA 4EPCA 1AZGB 2IG0A 3O8VA 4OMPA 2DEUA 2KYMA 1BKBA 3VS0A 1O75A 1RUWA 4KULA 5IXBA 1YHQT 1VQOQ 5IT9E 2V26A 2CZ7B 3CD6T 2VVKA 2PVOB 4HCKA 4OMNA 4RTWA 1Y7XA 4C8QA 4HCBA 3J80E 1ZLMA 3M59A 2VV5A 1ZQ1A 3PT9A 1FXXA 4AFQC 3JCMb 1NYFA 4J9BA 3HTRA 1M9SA 4DBFA 2WSFE 1I5OB 4IIMA 5A2QE 3UF4A 3RIRA 2QQBA 2HBPA 1T0HA 4PNOA 3SWNB 1U8RA 1ZSZC 2J6FA 2CUBA 3CMAA 2KRMA 4PJMA 4IKFA 2KMTA 2ZPEB 2NUZA 4C0DC 5GAN8 3JCMf 1KG1A 3CCMT 4C5HA 3ASKA 3U23A 3VJPA 3PMIA 4WCIA 2ESWA 4X1VA 1EX4A 2QEXQ 3HP9A 5FRNA 2VGNA 3I55T 2RI3A 3RUXA 1T3LA 4ZNXA 1NZ9A 3THKA 2M0OA 3FDRA 1UEBA 3QYHB 2GGRA 4FSSA 2DVJA 3V8KA 4RUGA 2GFUA 3F70A 2BE7D 4BI8B 1LOJA 5LL6S 2GFAA 5IHNA 4DBHA 5I21A 2D6FA 2YUNA 5J39A 4PJOF 1AWJA 3JCMc 3QKJA 1Q81R 3META 2R5MA 1QVGA 1WXTA 4JRQA 1YJWA 1YBYA 3GLXA 2RI5A 1M27C 1G3WA 4XAXB 2PUKB 4OB3B 2EYXA 3C12A 3MEVA 1TUGB 4IUVA 3EG9A 3CCQA 5CKHA 3D7SB 1UGVA 2X3WD 3TCJA 1YJNQ 4GLKA 2M1HA 5KE3A 1RLPC 2Y4XA 1BIAA 2V8IA 3IQLA 4KGXB 4M78F 2O88A 3OS1A 3LLRA 1KD1R 4OMOA 4OGCA 3JRZA 4M75F 2C0TA 1WHJA 5KYUA 3UATA 4BY6C 1K76A 1WA7A 4ZTJA 2DZCA 3I9QA 5KYWA 3L2QA 3RMSA 3V8JA 1I5LA 4KGZB 1YITQ 2FPDA 3OS0A 3MCAB 1ZUUA 1SSHA 2CSIA 4J6XA 2XD0A 1NPRA 2DMOA 4J9IA 2RD1A 4WF2A 1H3ZA 1PG5B 2CT4A 4TVRA 1VQPA 3G7ZA 3VKIA 1YJ9T 3CBPA 3CMET 1MMAA 2DE0X 5GMKe 9ATCB 1BYMA 2DILA 2DXUA 2AHJB 3MEWA 2FZCB 2X3XD 3VS5A 4PJOA 1D3BA 3A1PA 5FU7B 1UG1A 5CKFA 5DY9A 3CBOA 1IGUA 3L2ZA 5IXFA 4L6V5 1N9RA 1JRIA 1W2BA 3WVDB 2CP7A 4ELYC 5FW9A 2FZGB 1RABB 4PJOD 2A3LA 2VGMA 1QVGP 2DTIA 3EH2A 3M0QA 1WHGA 1T0JA 1RACB 4FT2A 4FU6A 1UTIA 2L8DA 4OMLA 4D8DA 2LZ6B 3RKXA 4BDYA 1JBMA 3M53A 1XOVA 1X6BA 4XTYA 4C92B 1K9AA 1QMCA 1YJNA 1Y57A 4DEXA 3OYCA 3M0SA 1X27A 2I2LA 3OQ5A 2LT4A 1M90U 3CCET 1GBQA 4M77F 4M78D 3KFVA 4CI0C 3DB4A 4R55A 3CPWS 2DXBA 4D8KA 3P8BB 3JB9H 4HT9A 4PFOA 4M75D 3A8MB 2M16A 4A4HA 4C92E 5CKBA 2LVMA 3SFMA 4E7IA 2CS7A 1IGQA 4BDZA 2DPPB 4C92G 3FIFA 3PMTA 1S72A 2AIRB 3A8GB 2EQUA 2MOXA 1YITA 3MEAA 1OI1A 4MMLA 1ZA1B 4R0KA 1VQLA 3SWNA 2HQXA 1R0CB 2ZPIB 2FL7A 5HK3A 3OYKA 1WDXA 3MP8A 1OZ2A 4M78C 5IAYA 1QQJA 3NFCA 2KYBA 2ZPBB 4JLGA 3QWYA 1G3YA 3CCRQ 1RL2A 1AWOA 3TVTA 4J7IA 2KAFA 2OTJA 1KIKA 2OTLT 3JCMW 5ECAA 4OMMA 4XTXA 3SD4A 5AT1B 1AEYA 1BK2A 5LJ3f 5GANg 3CCUQ 2RN8A 1ZSZB 4ZGDB 2LJ1A 2EYWA 2DM1A 1RAFB 3PNWC 1ACMB 4J7FA 3OA6A 5LJ5j 4AG1C 1JEGA 1BI3A 2LJ3A 5D6XA 2RA2A 5GAOn 1TWBA 1W2BP 1G3SA 3CPFA 1OX8A 1YI2T 3M55A 2K3YA 1ZBXA 3C95A 4L59A 4M4ZA 4OGEA 3HFOA 1UJ0A 3QWXX 3EHQA 1KQ1A 4JS5A 5GAOm 4IIOA 1N6AA 3S3MA 4Y28E 4QQGA 2EKHA 3I5SA 1HYOA 4EMKC 3H9NA 4HA8A 4C0ZA 3RERA 4JRIA 2RQUA 4LDWA 1RAGB 3NTHA 2GTJA 4P5NA 2LNVA 3GOXA 2JVVA 3HFNA 3OMGA 2K2MA 2EW3A 3LH0A 2DL4A 2XICA 4M77D 1M90C 3OYAA 3M58A 2FB7A 3MHXA 2FPFA 1W4SA 1Q95G 1M2VB 3M0TA 4FW2A 2B8AA 1QVPA 1VQ6T 3CCVQ 2J06A 3OBYA 4GY5A 5GMKm 2KQWA 3JV3A 4AFUC 5GAMj 3GF5A 1R77A 2LRQA 2LX9A 5FLXE 2LDMA 5LJ5g 3LGFA 2EQJA 3JCMe 1WHHA 2KXDA 4D6WA 4QVCA 1WHLA 5CQXA 4NL3A 1VQ9Q 2XG8D 2LCLA 1V76A 3VRZA 2E3IA 1Q7YR 2M0YA 3CCSA 1V29B 3DLMA 3OMCA 1N27A 3CCRA 2HD0A 2X4WA 2PUOB 4RG2A 1BI2A 4ANJA 2P0KA 1GCPA 2HL5C 4X34A 1VQ4T 1EFNA 1JJ2S 1MNEA 5GANh 3G4ST 1SHGA 4XK8E 2QTXA 1B34A 1A0NB 3I56Q 4JZ4A 3CCUA 2RMOA 3P8DA 2NUTB 1YWOA 1RI0A 1QVFP 1I4K1 1N8RR 4XTZA 4N4GA 8ATCB 1VQNQ 3OW2S 3J7AF 2COZA 2ZPFB 3JCMV 3PTAA 3RDVA 1NLOC 5GAOl 3EGXB 2E6ZA 4XU1A 2LNHB 4RKUE 1IB8A 5GAMg 2P84A 3NMZC 2YSQA 1I8FA 2JZ2A 1R8OB 1JJ2A 1K4US 1BI0A 1BB9A 2NUPB 2E5QA 5KCHA 4PLIA 2GF7A 3CD6Q 2O9VA 2D1XA 2VWFA 4LN2A 4C92A 3RMQA 3OY9A 4CC3A 1K1ZA 4BE1A 2O4XB 4LDUA 1K9MU 1TTHB 1TU0B 2DVEA 3FRNA 2CH4W 3OW2A 2E64A 3E19A 4M7AC 3QDFA 2HDAA 1CKBA 4A53A 2AT1B 5GMKl 1LVKA 2JMCA 2JTEA 4HVUA 1N8RC 2D0QB 3CCVA 2W0ZA 2ECZA 2E6NA 2QQAA 5LJ5h 1CSKA 4C5EA 1KJWA 1WNLA 2EJ9A 1OZ3A 3OYEA 5CIUA 5GJVB 1M8MA 3CC2A 3CC4A 4AMCA 4A63B 3I55Q 4EMHA 4LDXA 1QLYA 3GNFB 2HL3A 1VQ9A 2KXCA 4MZTA 1FMWA 1MGQA 3NTIA 1VQ8A 2K2VA 2VXFA 3BY7A 2JM8A 2NWMA 2YRDA 3MP1A 3G71Q 5EC7A 2QTVA 3R6OA 1K73U 4PJOE 4QW2A 3I56A 2F5KA 3L2UA 4KGVB 1NG2A 2AZSA 1M3BA 4OMQA 4M78B 2RI2A 1VQKQ 4PJOG 2RM4A 5IN1A 1MMNA 1TXQA 2HBWA 1VQNA 5I22A 3A8LB 3CC7T 3ME9A 4ZN3A 4JRKA 5GAMh 3PIOA 2E10A 3TREA 2H3EB 2M02A 4Y92A 1VYTA 3FEOA 1PKSA 2ATCB 4M78E 3NPFA 2CSQA 1QKXA 2K3XA 2LT1A 1M3AA 4GLMA 3V7CA 2YUOA 3HL8A 4M75E 2H3JA 4LUEA 1G8XA 2B86A 4M78G 2DBMA 2RO0A 4UC4A 3ZL7C 3CEYA 2EQKA 3VS6A 4Z89A 2EKOA 4M75G 3MKDA 1YFNA 1D0YA 3VS7A 4FYVB 1HSQA 3H0FA 2QA4Q 1K9MC 3QPHA 1WPYA 3QYGB 4LDYA 4N0AA 3ER0A 2QQRA 1OOTA 5A0DA 5A0LA 3DKMA 2DD4A 1M2VA 3QO3A 4NOYA 2AKLA 4LD9K 4KUIA 3MP6A 4EMKB 2K79A 5GAOq 1XQHA 4EIKA 3EFOB 3UPUA 5CO7A 4HVVA 2IPOB 1IREB 2RHXA 3CMAT 2JJ9A 2CT3A 2HKQB 3BE3A 1PSEA 3L2VA 1BCMA 2EGEA 4M7DC 1KQSS 1QWFA 2X4XA 1VQ7Q 5CCAA 3QUIA 2LMJA 2KR3A 2FRWA 4A54A 2KGTA 4LDVA 5LJ3e 1WFWA 3OYNA 1TS9A 2YDLA 2QXFA 1FX7A 2DRKA 2E5KA 1AWXA 2J6KA 2XDDA 3A8HB 1I1JA 4II1A 2LCSA 3G71A 1X75C 4VUBA 4RTVA 2RNAA 3S6WA 3LGLA 4C8QC 1K73C 2QDLA 4DEYA 2NUTA 1AWWA 3RNJA 1B7TA 4M77B 1X69A 2MPXC 3V7RA 1VQKA 4E7JA 3PVLA 2EGAA 1KQSA 3VUZA 1UGPB 1YJWT 1YIJQ 1UFFA 5LJ5d 3EGXA 2ZPGB 4FW1A 5GAN6 1PWTA 4M77E 3CCQT 1VQOA 1UB4A 2XKOC 4N4HA 2DL5A 2LP5A 2EIFA 2NUPA 2KEAA 3A98A 3C0CA 3OSSC 2DTOA 1OPKA 4M77G 1UJYA 3X25B 5C6SA 1VYVA 3QSUA 2QK0A 2HEQA 1WJRA 2O01E 3X24B 1QCFA 3WXMB 2D8HA 4OMFB 4ORZA 1WXBA 2QGGA 1VQMQ 4JPBW 2QA4A 1PC0A 1UGQB 2PNIA 3E9GA 1LPLA 2RF0A 1OYXA 1RI9A 1K0SA 2CZ1B 1M1KU 2XHCA 2JS2A 2ZAEA 1AZEA 4J8OA 1TG0A 1ZBJA 3EG1A 1MNDA 2VYTA 4Z88A 2QEXA 1T3SA 4C0GA 2J05A 2V8KA 1X6OA 1HK9A 4QQDA 1IO6A 2ZCFB 2OTLQ 5GAMd 2OAUA 4FCYA 1GCQC 5L23A 4FYYB 4M7AB 2BIVA 2H8HA 1WYXA 1VQPT 2C06A 4QKUA 1VQ7A 1BU1A 2OJ2A 1M8VA 3X20B 2EAYA 2HQEA 5GMKj 2XI9A 1X01A 1Q82U 3JCMQ 3TQ7P 4ME7A 4E7ZA 2QDYB 1Y96B 3OYJA 1Q86U 2JOYA 2OI3A 2HQHA 3WVEB 1K0XA 2YRCA 2JS0A 2PU9B 1G3TA 4HKEA 4JJNK 1F1BB 4M78A 4WTOB 5J3BA 2XMFA 4GBQA 4M75A 3OYGA 1E7OA 4XQ3A 4FYXB 1VIFA 5GANj 1D09B 1YIJA 1KQ2A 1M1KR 4ZTFA 2SEMA 2EYQA 1E6GA 2Y4YA 2DETA 2XIDA 1MMDA 1ABOA 2DIQA 2F69A 5CK9A 1YJNT 2J7IA 3CQTA 2E3HA 3OB9A 2O2OA 4OB1B 5FU6C 3CCJQ 2K7AA 1VQ5Q 4PKCC 3VS3A 2W10A 3G6EQ 2MWOA 4KRTA 3X26B 5FROA 2ZGWA 1PSFA 5FRMA 1NJIU 1Q82R 2M9UA 2GTOA 3CBMA 1VQMA 1BI1A 1RAIB 5GAN7 2MCNA 1O9SA 3UDCA 1D1BA 2GQVA 3NGPA 1SSFA 1S72T 2KT1A 2X9HA 1YITT 3G1JA 4EMKA 1YWPA 3EG0A 2ABLA 4RCBA 2HSPA 2KROA 3CPWA 1VQLT 1LCKA 1U5SA 3EFOA 2BZ8A 1M1KC 3CCLQ 2DERA 1M5Q1 3BW1A 3GP8A 2YRVA 1HD3A 3EGDB 1OPLA 3SDZA 3JB9J 4AFSC 1M90R 3EFSA 2RPNA 1GL5A 3I35A 2L3PA 3OBWA 2YUPA 2YXYA 2OTJT 4J6YA 1I07A 2CP3A 2XDPA 2HAXA 3AHUA 1HJDA 2RB6A 1RAAB 4J9DA 4J6WA 4C0DB 4IURA 2HSEB 3URGA 3LX7A 2X51A 1Q82C 2K5IA 1PRLC 4M7AF 2E4HA 4BI3A 2F2XA 4PJNA 1QWEA 1E6HA 1YNZA 3UA6A 4PL6A 3H6ZA 1KK7A 1SRLA 4FSXA 2KT8A 2QGFB 3L42A 3N5BB 4M77A 2RHUA 3QBYA 2DJZA 1WHMA 5DLQE 1RAEB 5I11A 4FYWB 1UE9A 3ZBDA 2K57A 1M1FA 2JNGA 4XU3A 3SWNC 3JAME 1D1AA 3TEEA 2Y90A 3VS4A 4N4IA 4E6RA 5FWBA 1XTDA 3SHWA 2LQ8A 3H0HA 1TOVA 2LTOA 4C8QB 4OF1A 4F04B
chains in the Genus database with same CATH topology
3F70A 3OYEA 5CIUA 3CCJA 2BUDA 1LOJA 4Q5WA 5LL6S 4BI8B 3CC2A 3CC4A 2GFAA 4EMHA 4LDXA 5GANe 3OYDA 1VQ5A 2WSCE 3E9FA 2FHDA 5I21A 3GNFB 5GMKh 4JS4A 3OYYA 3A5ZB 3G6EA 3CCEA 2P4TA 3HRSA 4C0FA 1VQ9A 2D6FA 5J39A 4PJOF 4ZGEB 1YIJT 4MZTA 4FM4B 3JCMc 1MGQA 3M57A 3QKJA 3META 1NJIC 3NTIA 2R5MA 4E7LA 3S3OA 1QVGA 3CXCS 1KC8U 4JRQA 1YJWA 1VQ8A 2K2VA 2VXFA 1YBYA 3GLXA 2RI5A 3OS2A 1G3WA 3BY7A 4XAXB 1M4ZA 4NL2A 2PUKB 3MP1A 4OB3B 3C12A 2GCXA 3MEVA 5CAIA 1P92A 2RJDA 5CR2A 3R6OA 4IUVA 3CCQA 1K73U 4PJOE 4QW2A 4A4GA 5C0MA 5CKHA 3I56A 3TCJA 2F5KA 3OS5A 3L2UA 4PJOC 2VUBA 4GLKA 1UGRB 4O6JA 4BY6B 1TH7A 2NLUA 4XTVA 2KY9A 2M1HA 3DB3A 5KE3A 2Y4XA 1BIAA 3QJ6A 2V8IA 4M78B 5LJ3h 4ZN1A 3EAEA 2RI2A 3CCLA 4HT8A 3HHTB 4PJOG 4FT4A 4M78F 2DZ9A 3L2RA 4L5GA 2RM4A 5IN1A 1U1TA 3HRTA 3CCST 3OS1A 2MWPA 3LLRA 1WGSA 2EWNA 1VQNA 1VQMT 2QQSA 3A8LB 3CC7T 4OGCA 3CCRT 4HCCA 5KE2A 3JRZA 3ME9A 4M75F 4M7AA 4ZN3A 2RH2A 1BIBA 4JRKA 5GAMh 3PIOA 2E10A 4RCCA 3TREA 4BE2A 2CZ6B 3J81E 3FEOA 4RG8A 1QVFS 4BY6C 4ZTJA 2P0QA 4M78E 2CGHA 2DZCA 4EMGA 2OTLA 4DOWA 3M9QA 2K3XA 2V8JA 2LT1A 2EJGA 3L2QA 3RMSA 3FLGA 3V7CA 3V8JA 3CCUT 1I5LA 3HL8A 4M75E 1Y96A 3KXTA 2X4JA 2H3JA 2MMPA 4M7AD 2CZ0B 4M75C 3OS0A 4NS5A 2XDBA 4M78G 2RO0A 4UC4A 3MCAB 3CEYA 2JUFA 2VC8A 2DAQA 4F7UB 2EQKA 2PVDB 3VV0A 3QIIA 4OB2B 4JUVA 2EKOA 4M75G 1U1SA 2RK1A 4J6XA 4QVDA 2XD0A 3VUBA 3QZ9B 1NPRA 3M56A 4FIBA 5LJ5e 1NE8A 1ZHIA 2RD1A 5HKCA 1K9MC 4WF2A 3NTKA 1H3ZA 4OP0A 3QPHA 4MZMA 1YI2A 1WPYA 1Q86C 2KVQG 3QYGB 4LDYA 4TVRA 4N0AA 2DO3A 1Y07A 3ER0A 2QQRA 1VQPA 2CYZB 4Z02A 5A0DA 5A0LA 3DKMA 2DD4A 3G7ZA 3VKIA 3QO3A 4NOYA 1WJSA 3CBPA 2KDSA 1YJ9T 1WJQA 3CMET 1QVFA 4BE0A 4IUQA 4LD9K 3RESA 4M7DF 5GMKe 4KUIA 3MP6A 4EMKB 4JLIA 3JCMg 1BYMA 3A8OB 2L5QA 2R57A 5DLOA 2DXUA 5GAOq 1XQHA 4OB0B 3DLLA 3GPLA 4XTWA 3UPUA 5CO7A 2AHJB 3GNGA 3MEWA 4PJOA 1D3BA 4C5GA 1IREB 2X35A 2RHXA 5FU7B 3CMAT 3T9NA 5CKFA 5DY9A 3ZFJA 3CBOA 3H8ZA 3L1AA 1YCYA 4M7DE 3L2ZA 1Q7YU 1PSEA 3L2VA 1K8AU 2PVGB 4M7DC 4L6V5 3BDLA 1N9RA 3LYIA 2G3RA 2E12A 2RJEA 4LD6A 1JRIA 1W2BA 3LWIA 2MI6A 3WVDB 1KQSS 2JN0A 2X4XA 3BDUA 4ELYC 5CCAA 3QUIA 4M7DG 2E70A 4PJOD 3P8HA 4C8QF 2A3LA 4A54A 2VGMA 4J5YA 4LDVA 3GIBA 2DIGA 5LJ3e 3CCVT 2DTIA 3FB9A 3OYNA 4M7DB 4FT2A 4FU6A 2QXFA 1VQ6A 1FX7A 2L8DA 1KC8C 5KCOA 3RKXA 4BDYA 5HK0A 5GAOr 2XDDA 3A8HB 5I2SA 4II1A 4KT0E 1WQ7A 4MZPA 4BI4A 1JBMA 1X75C 5FU6B 3M53A 1XOVA 1XNIA 5GAMe 4VUBA 4XTYA 4C8QE 1N8RU 3S6WA 3CCJT 4C92B 3CC2T 3CC4T 3LGLA 4C8QC 5KH6A 4C92F 1YJNA 1K73C 3OYCA 2I2LA 3OQ5A 1VQ5T 4JRPA 2LT4A 3KBGA 1M90U 3G6ET 3CCET 4M77B 3L2WA 3QJYA 1VQ9T 2P0PA 4HCZA 2QQ9A 3V7RA 4E7JA 1VQKA 4M77F 4C8QG 4M78D 2D9TA 1KQSA 4CI0C 3DB4A 3VUZA 5DM7R 4R55A 3CPWS 2DXBA 1D3BB 3P8BB 3JB9H 4HT9A 1UGPB 4M75D 3UWNA 1VQ8T 1YJWT 3A8MB 2M16A 4A4HA 3ZEHA 5CKBA 4C92E 4DOVA 5LJ5f 5LJ5d 1KHCA 2LVMA 4C92C 3SFMA 3OYHA 2ZPGB 4QVZA 4BACA 4ELZC 5GAN6 4FL6A 4M77E 4E7IA 3CCQT 3HRUA 2QI2A 1UB4A 2CS7A 2XKOC 4M77C 2DPPB 4C92G 1QP3A 3FIFA 3QHSA 1KHIA 4N4HA 3I56T 4V2SA 3PMTA 2EIFA 1S72A 3A8GB 2EQUA 3G4SA 1YITA 3MEAA 1OI1A 2JTMA 3OSSC 4XU0A 2DTOA 4MMLA 4M77G 2E65A 3CCLT 1VQLA 3SWNA 3X25B 3JB9F 3VU3C 5C6SA 4RMOA 2HQXA 3CXCA 2ZPIB 2FL7A 5HK3A 3OYKA 3QSUA 4E47A 3MP8A 1OZ2A 5D6YA 1VQNT 4M78C 5IAYA 1DJ7B 5CVIA 1WJRA 3JCMP 2O01E 3X24B 2DEQA 3WXMB 3NFCA 1YHQA 4OMFB 1VUBA 2ZPBB 2DXTA 4JLGA 2BKDN 4CRIA 1G3YA 2QA4A 1RL2A 4X9DA 5EG2A 3CD6A 5AYFA 2YLBA 4J7IA 4PLLA 1UGQB 2KAFA 4F7UF 4MDXA 2OTLT 2OTJA 3JCMW 3JCMh 4XTXA 2MAMA 2ZZDA 3E1SA 3E9GA 3SD4A 3INZA 1OYXA 4J83A 2RJCA 5I2MA 3EFRA 3HSBA 4M7DD 4MDWA 5LJ3f 3PIPA 4B9WA 2CZ1B 3JB9G 1IZ6A 5LJ3d 4YTLA 1M1KU 2XHCA 5GANg 2K5FA 5GANf 4ZGDB 4J8OA 5GANd 2E1HA 3OYFA 3QDRB 2CKKA 4MMKA 3X28B 2VYTA 4J7FA 3PNWC 2RHZA 2QEXA 4F7UE 4O5VA 4C0GA 1QP2A 3OA6A 1LNXA 2V8KA 2K4YA 5LJ5j 1X6OA 1HK9A 1BI3A 4QQDA 5GAMf 2DK3A 2RK2A 4X9CA 2ZCFB 3OYIA 5GAMd 4BD3A 2OAUA 5D6XA 2RA2A 5GAOn 2EJFA 1G3SA 3CPFA 1Q81U 4M7AB 1YI2T 1Q7YC 2BIVA 1K8AC 4F7UG 1NPPA 3M55A 2K3YA 1VQPT 2C06A 1ZBXA 1GXIE 1VQ7A 3MEUA 3C95A 4L59A 5A0GA 3CCMA 2ZPHB 4OGEA 1M8VA 3HFOA 3HKSA 3X20B 2DD5A 2EAYA 2HQEA 5L8RE 1N9SA 4IUPA 4C8QD 5GMKj 2XI9A 1KQ1A 4JS5A 5GAOm 3UT1A 1N6AA 3FC3A 1X01A 1Q82U 3JCMQ 3I55A 3S3MA 4ME7A 4Y28E 4QQGA 3QG1A 4JDSA 2QDYB 3QXEB 4DA4A 4DQ2A 3CCMT 1Y96B 3OYJA 5M9OA 2IVWA 4EMKC 1Q86U 2JOYA 2EQMA 4HA8A 2YHTA 2FVUA 3HPWA 3VYHB 4C0ZA 1VQOA 3RERA 4JRIA 4IUUA 5GAN4 3WVEB 4LDWA 3RKYA 2X4YA 4OVAA 3NTHA 4P5NA 1QVGS 2LNVA 2PU9B 4C92D 1G3TA 2JVVA 2WSEE 5FU7C 5GAN2 3GOXA 1KD1U 4R56A 4HKEA 1I81A 2FYKA 3HFNA 5D6WA 4JJNK 4M78A 3OMGA 2R58A 4A4EA 2RJFA 3LH0A 3LW5E 2XICA 4M77D 3JSCA 1M90C 5J3BA 3OYAA 3M58A 2PQWA 2FB7A 4KUDK 3MHXA 4M75A 2HNIA 3M5AA 5LJ3j 3OYGA 4XQ3A 1W4SA 5CQYA 3QZ5B 1UGSB 1VIFA 5GANj 1H641 1VQ4A 1YIJA 1KQ2A 1VIEA 2B8AA 1QVPA 4ZTFA 1VQ6T 1G5VA 2EYQA 3OBYA 5GAOp 4GY5A 2Y4YA 5GMKm 4C5IA 1M1GA 2KQWA 2XIDA 3JCMX 5GAMj 2DIQA 3C4SA 1Y71A 3GF5A 3M54A 3G71T 2LRQA 3RKWA 2F69A 2LX9A 2E41A 5CK9A 4PJOB 4QQ6A 5FLXE 1YJNT 1MHNA 2LDMA 2WACA 3OB9A 4BB7A 5LJ5g 3JCMJ 4OB1B 5FU6C 3LGFA 2EQJA 2KSSA 1LJOA 4N0AC 2RHIA 3JCMe 3KUFA 2DTHA 1VQKT 3JB9D 4F7UA 1AHJB 1KG1A 4D6WA 4PKCC 4ATOA 4QVCA 4NL3A 5CQXA 2MWOA 4A4FA 2XG8D 3X26B 2YLCA 2EFIA 2LCLA 3SB2A 5FROA 2VXEA 2ZGWA 1PSFA 5CKDA 5FRMA 1NJIU 2F5TX 3VYGA 3CCSA 1V29B 2M9UA 3DLMA 3OMCA 1N27A 3CBMA 1BI1A 3CC7A 1VQMA 3CCRA 2K5LA 2HD0A 2MF2A 5GAN7 3S3NA 2X4WA 2PUOB 4RG2A 5HY6A 1BI2A 5GMKi 1O9SA 2P0KA 3UDCA 2L3RA 4X34A 2GQVA 4B9XA 1VQ4T 3M4YA 3LWHA 1VQOT 1JJ2S 2O4XA 4M7DA 2JTFA 3PFSA 4KBMB 5GAN5 1SSFA 5GANh 1S72T 4ZGJB 3G4ST 1YITT 4EMKA 3JB9I 4XK8E 2QTXA 1B34A 4RCBA 5GAN3 4M75B 3CPWA 4E7KA 1JB0E 2XU8A 1VQLT 3CCUA 4EPCA 3P8DA 1M1KC 2IG0A 3O8VA 1RI0A 1M5Q1 1I4K1 3BW1A 3GP8A 1BKBA 2DXCA 2YRVA 1O75A 4KULA 4XTZA 4A4KA 4N4GA 1YHQT 2DKGA 5IT9E 3V7SA 3TU4K 5LJ3g 3SDZA 3JB9J 3OW2S 2CZ7B 3J7AF 2QA4T 2L89A 2ZPFB 3G71A 3EFSA 3CD6T 2PVOB 3JCMV 3PTAA 4BDZA 3PGGA 5CKEA 3BFMA 5GAOl 3OBWA 1Q81C 2OTJT 2E6ZA 2R5AA 4J6YA 1HXDA 2XDPA 1Y7XA 4C8QA 2HAXA 4HCBA 3J80E 3AHUA 3M59A 2RB6A 2VV5A 1QW1A 4XU1A 4RKUE 4XU2A 5GAMg 1ZQ1A 3PT9A 4Y91A 1FXXA 1I8FA 2JZ2A 1R8OB 4J6WA 4C0DB 4IURA 3URGA 3OYLA 1JJ2A 3JCMb 1YJ9A 1BI0A 3LX7A 2RHYA 3CMEA 1W2BS 1M9SA 1FWZA 2E5QA 1Q82C 2K5IA 2WSFE 5KCHA 3MO8A 5A2QE 4M7AF 1WQWA 3RIRA 2QQBA 4PLIA 2GF7A 2HBPA 4BI3A 2QEXT 4PNOA 3SWNB 1U8RA 2XK0A 4C92A 3RMQA 3OY9A 4BE1A 2O4XB 3CMAA 3M4GA 4IKFA 4PL6A 4LDUA 2KMTA 3H6ZA 1K9MU 1EIFA 2ZPEB 4XTUA 2DVEA 3FRNA 4FSXA 3L42A 3N5BB 1B34B 4M77A 4C0DC 5GAN8 2RHUA 3OW2A 1KD1C 2E64A 3JCMf 1VQ7T 4M7AE 3FJPA 4C5HA 3ASKA 3QBYA 3VJPA 3JCMd 2DJZA 3V8LA 3C94A 3E19A 3OSVA 3PMIA 2LQKA 4M7AC 2A7YA 5DLQE 3OYMA 4A53A 5GMKl 3HP9A 3ZBDA 2K57A 1M1FA 2JNGA 5FRNA 2LCCA 4XU3A 2VGNA 3SWNC 3JAME 2RI3A 2Y90A 3TEEA 3I55T 1N8RC 4M7AG 3RUXA 3Q1JA 4BUGA 3OYBA 2D0QB 3CCVA 1NZ9A 4N4IA 2KK4A 2E6NA 2QQAA 1XTDA 2M0OA 3FDRA 4E7HA 1UEBA 2LQ8A 3QYHB 5LJ5h 4EDUA 4C5EA 4IUTA 5J26A 1WNLA 2EJ9A 2LTOA 1OZ3A 4C8QB 4OF1A 3V8KA 2GFUA 2LC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFI A;  2R57 A;  3F70 A;  5FRO A;  5CIU A;  3OYE A;  2BUD A;  5FRM A;  4Q5W A;  3DLM A;  2GFA A;  3SD4 A;  3E9G A;  3OYD A;  3MEW A;  3OMC A;  1OYX A;  1N27 A;  3E9F A;  2RJC A;  2FHD A;  4C5G A;  2X35 A;  2RHX A;  3S3N A;  2X4W A;  4RG2 A;  4B9W A;  2P0K A;  2L3R A;  3H8Z A;  4X34 A;  5J39 A;  4B9X A;  3L2V A;  2O4X A;  3OYF A;  2JTF A;  3PFS A;  2CKK A;  3BDL A;  3LYI A;  3QKJ A;  1SSF A;  2G3R A;  2VYT A;  2RJE A;  4LD6 A;  3PNW C;  2RHZ A;  3MET A;  3NTI A;  2R5M A;  4E7L A;  3S3O A;  3OA6 A;  4E7K A;  2X4X A;  3OS2 A;  2RI5 A;  4QQD A;  3OYI A;  4BD3 A;  5D6X A;  3P8D A;  3P8H A;  3MP1 A;  2IG0 A;  3MEV A;  3O8V A;  1RI0 A;  2DIG A;  2RJD A;  2BIV A;  4IUV A;  3OYN A;  2K3Y A;  4QW2 A;  4A4G A;  2YRV A;  5C0M A;  3MEU A;  2F5K A;  4N4G A;  4FU6 A;  4L59 A;  3L2U A;  2L8D A;  5KCO A;  2HQE A;  2NLU A;  4IUP A;  4BDY A;  2M1H A;  3DB3 A;  2L89 A;  5KE3 A;  4II1 A;  3QJ6 A;  3UT1 A;  3EAE A;  2RI2 A;  3FC3 A;  1XNI A;  3S3M A;  3S6W A;  4QQG A;  3L2R A;  2R5A A;  5IN1 A;  2XDP A;  3LGL A;  5KH6 A;  3OS1 A;  2MWP A;  3OYJ A;  3LLR A;  5M9O A;  3OYC A;  1WGS A;  3OQ5 A;  2EQM A;  2QQS A;  2JZ2 A;  3ME9 A;  5KE2 A;  4IUR A;  4IUU A;  3OYL A;  3L2W A;  4HCZ A;  4E7J A;  4BE2 A;  3LX7 A;  2RHY A;  2D9T A;  2X4Y A;  3NTH A;  4OVA A;  2E5Q A;  3FEO A;  3GOX A;  5KCH A;  3DB4 A;  3MO8 A;  4ZTJ A;  4PLI A;  2GF7 A;  5D6W A;  3UWN A;  3OMG A;  2R58 A;  2M16 A;  2XK0 A;  2RJF A;  3M9Q A;  2K3X A;  3ZEH A;  3LH0 A;  4A4E A;  4A4H A;  3L2Q A;  3FLG A;  1KHC A;  2LVM A;  3OY9 A;  4PLL A;  3OYA A;  4QVZ A;  3OYH A;  2PQW A;  4BAC A;  2O4X B;  4BE1 A;  4IKF A;  4PL6 A;  3OYG A;  3H6Z A;  4FL6 A;  4NS5 A;  3OS0 A;  2RO0 A;  4UC4 A;  4E7I A;  3CEY A;  3L42 A;  4BDZ A;  2DAQ A;  2RHU A;  2EQK A;  2B8A A;  4N4H A;  4ZTF A;  3PMT A;  3ASK A;  3QBY A;  4C5H A;  3QII A;  1G5V A;  3PMI A;  2EQU A;  2EKO A;  4GY5 A;  3MEA A;  1OI1 A;  4C5I A;  3OYM A;  2DIQ A;  3C4S A;  2LRQ A;  5FRN A;  2LCC A;  5C6S A;  2HQX A;  2RI3 A;  3NTK A;  1H3Z A;  3OYK A;  3Q1J A;  4QQ6 A;  3MP8 A;  1OZ2 A;  1MHN A;  2LDM A;  2WAC A;  3OB9 A;  4N4I A;  5D6Y A;  3OYB A;  5IAY A;  3LGF A;  1WJR A;  2EQJ A;  2E6N A;  2QQR A;  2M0O A;  3FDR A;  4E7H A;  4Z02 A;  2RHI A;  3KUF A;  4EDU A;  4C5E A;  1WJS A;  2BKD N;  4IUT A;  1WJQ A;  4CRI A;  5J26 A;  4BE0 A;  4IUQ A;  2LTO A;  1OZ3 A;  3MP6 A;  2MWO A;  4A4F A;  2GFU A; 
#chains in the Genus database with same CATH topology
 3CCJ A;  1AD5 A;  4JJC A;  2DYI A;  4Q5W A;  4AT1 B;  1VQ5 A;  2F2W A;  2OX7 A;  3E9F A;  2FHD A;  5GMK h;  4JS4 A;  3OYY A;  3G6E A;  2VAS A;  2HCK A;  1YP5 A;  4ZGE B;  1Z9Q A;  4FM4 B;  3M57 A;  2O31 A;  1NJI C;  3S3O A;  3CXC S;  1KC8 U;  3OS2 A;  1M4Z A;  4NL2 A;  1IHV A;  4DBQ A;  2MYS A;  2GCX A;  2RJD A;  3CPW P;  4A4G A;  1FYN A;  4O6J A;  4BY6 B;  4XTV A;  1G83 A;  1RAD B;  4PK4 A;  3CCL A;  3EAE A;  4HT8 A;  5IHI A;  4FT4 A;  2EYZ A;  3L2R A;  3HRT A;  3CCS T;  3CCR T;  3H41 A;  4M7A A;  2L0A A;  1BIB A;  4RCC A;  4CC2 A;  3J81 E;  3PVQ A;  4RG8 A;  1PD1 A;  1Z9Z A;  4LUD A;  1AVZ C;  2QAZ A;  4DOW A;  2EJG A;  3CCU T;  1Y96 A;  4M7A D;  3CC7 Q;  2CZ0 B;  2XDB A;  1PD0 A;  4NS5 A;  1SG5 A;  2DAQ A;  4F7U B;  1GBR A;  4DBR A;  2PVD B;  1H3H A;  3E2U A;  4OB2 B;  2DL3 A;  4JUV A;  1U1S A;  2RK1 A;  2AKK A;  3M0U A;  8AT1 B;  5KYY B;  1YHQ Q;  3EG9 B;  1IHW A;  3NTK A;  4OP0 A;  1JO8 A;  1B07 A;  1VA7 A;  1ABQ A;  2DX1 A;  1Y07 A;  2BE9 B;  2CYZ B;  5D7U A;  2JW4 A;  1WJQ A;  4BE0 A;  4M7D F;  1SEM A;  2RQT A;  4JLI A;  1VYU A;  3JCM g;  3A8O B;  2L5Q A;  2R57 A;  1SF9 A;  3DLL A;  1BCO A;  3GNG A;  2V1Q A;  2KRS A;  4C5G A;  3T9N A;  4JZ3 A;  2DLP A;  3R6N A;  1YCY A;  5KYW B;  2PZ1 A;  1K8A U;  2PVG B;  2JMA A;  1JXM A;  3BDL A;  3LYI A;  2G3R A;  2RJE A;  3LWI A;  2MI6 A;  1SRM A;  2JN0 A;  1X2Q A;  3BDU A;  3CCM Q;  3RBB B;  1QCO A;  2CH4 A;  2E70 A;  2KRN A;  3P8H A;  4C8Q F;  4J5Y A;  2J6O A;  3GIB A;  2DIG A;  3CCV T;  1VOM A;  3FB9 A;  6AT1 B;  1KC8 C;  1TSF A;  5KCO A;  1ZA2 B;  1SKU B;  4KT0 E;  2F1L A;  4MZP A;  4BI4 A;  5FU6 B;  1TUD A;  3CC2 T;  3CC4 T;  5KH6 A;  3SEM A;  1QCN A;  3KBG A;  2DJQ A;  1VQ9 T;  2P0P A;  3M0P A;  4HCZ A;  2QQ9 A;  4F17 A;  1UUE A;  2D9T A;  2F2V A;  2K9G A;  5FWC A;  3EGD A;  5DM7 R;  1K9M R;  1D3B B;  2M51 A;  1ZSZ A;  3UWN A;  1VQ8 T;  2BTT A;  4AFZ C;  5GJW B;  5LJ5 f;  3ZEH A;  1WLP B;  4DOV A;  1ZUY A;  2BZX A;  4C92 C;  1CKA A;  4BAC A;  1C0M A;  4FL6 A;  1IXD A;  3HRU A;  1QP3 A;  4AG2 C;  3I56 T;  1AOJ A;  1KHI A;  2BZY A;  4V2S A;  2CP0 A;  1WHK A;  1U06 A;  1K8A R;  2JTM A;  1YJW Q;  3JB9 F;  3VU3 C;  1JJ2 P;  4E47 A;  5D6Y A;  1VQN T;  2DEQ A;  2COY A;  1YHQ A;  3MJX A;  3ULR B;  1C1A A;  2DXT A;  4LXC A;  7AT1 B;  1SPK A;  5EG2 A;  3CD6 A;  2YLB A;  5KYX B;  2DYB A;  4F7U F;  4CC4 B;  3JCM h;  3E1S A;  2ZZD A;  5I2M A;  3HSB A;  4M7D D;  3VRY A;  3OW2 P;  4MDW A;  3PIP A;  4B9W A;  2CP5 A;  4E7S A;  3VS1 A;  2K5F A;  2QYZ A;  2D8J A;  5GAN d;  2E1H A;  3OYF A;  2A08 A;  2EBP A;  3X28 B;  2D0N A;  4O5V A;  1QP2 A;  1K73 R;  2Z0W A;  5GAM f;  2RK2 A;  2AK5 A;  2NYS A;  1Q81 U;  1K8A C;  1WI7 A;  1GXI E;  1I0C A;  2CP6 A;  3CCM A;  1C6V X;  2DD5 A;  1N9S A;  4C8Q D;  2EPD A;  3UT1 A;  3FC3 A;  1YJ9 Q;  3CME Q;  3I55 A;  4PJJ A;  5IH2 A;  3QG1 A;  3QXE B;  2A28 A;  5M9O A;  2EQM A;  2YHT A;  2FVU A;  3VYH B;  2YWW A;  1VQP Q;  1WXU A;  3EGU A;  3RKY A;  2X4Y A;  2K6D A;  1QVG S;  2VKN A;  2DF6 A;  1KD1 U;  2ED1 A;  1SHF A;  2RJF A;  3LW5 E;  1UHC A;  3JSC A;  2PQW A;  2A37 A;  2LJ0 A;  2ROL A;  3LH5 A;  4KUD K;  1KFZ A;  2HNI A;  3M5A A;  5LJ3 j;  3TSZ A;  5CQY A;  2L3S A;  2HMA A;  1VIE A;  4KH0 B;  1G5V A;  1M1G A;  2FG0 A;  3JCM X;  3G71 T;  3C4S A;  3M54 A;  2KBT A;  3FJ5 A;  4QQ6 A;  2QAS A;  1MHN A;  4BB7 A;  4QT7 A;  2EGC A;  2CP2 A;  3REA B;  2EYY A;  1LJO A;  4N0A C;  2EQI A;  2RHI A;  1G2B A;  1VQK T;  3JB9 D;  4F7U A;  4ATO A;  1GCQ A;  3CCE Q;  1J3T A;  2YLC A;  5KYY A;  3SB2 A;  2VXE A;  5HCK A;  3VYG A;  3TSW A;  2K5L A;  3S3N A;  3H0I A;  5HY6 A;  5GMK i;  1JXO A;  1VQO T;  3M4Y A;  2O4X A;  2JTF A;  4Z8A A;  5GAN 5;  3NHN A;  3JB9 I;  1OUL A;  4E7K A;  1PNJ A;  2MK5 A;  1NLP C;  1W70 A;  1MV3 A;  1M30 A;  1D1C A;  1OU8 A;  4A4K A;  2DXC A;  2DKG A;  3V7S A;  2YT6 A;  3TU4 K;  5LJ3 g;  1BBZ A;  2QA4 T;  2L89 A;  1S72 Q;  1NEG A;  2FO0 A;  3PGG A;  4RTY A;  3BFM A;  5CKE A;  2ROT A;  1R0B G;  1Q81 C;  2R5A A;  1VQL Q;  1HXD A;  1H92 A;  1QW1 A;  4XU2 A;  4Y91 A;  3OYL A;  1QKW A;  1YJ9 A;  3CME A;  2RHY A;  1W2B S;  1FWZ A;  2I0N A;  3MO8 A;  1WQW A;  2QEX T;  2SRC A;  4J9F A;  2XK0 A;  2RQV A;  2OTJ Q;  2QG9 B;  2RQR A;  1OX9 A;  4JJD A;  3M4G A;  2K3B A;  1EIF A;  4XTU A;  1KD1 C;  1WIE A;  1B34 B;  1VQ7 T;  4M7A E;  3FJP A;  3JCM d;  1YI2 Q;  3V8L A;  3C94 A;  3OSV A;  2LQK A;  2ENM A;  2A7Y A;  2HKN A;  4J9G A;  3OYM A;  3MPU B;  2AZV A;  2LCC A;  4M7A G;  3Q1J A;  4BUG A;  3OYB A;  2KK4 A;  2LX7 A;  2DL8 A;  4E7H A;  1KQS P;  2RQW A;  2JM9 A;  1PHT A;  1V1C A;  4EDU A;  3AT1 B;  4IUT A;  5J26 A;  2LC4 A;  2BUD A;  4RTZ A;  1YCS B;  5GAN e;  3OYD A;  2WSC E;  3A5Z B;  3CCE A;  2FPE A;  2P4T A;  3HRS A;  4C0F A;  2C0O A;  2LQN A;  2CDT A;  1X6G A;  1YIJ T;  1NBE B;  2KI7 A;  4E7L A;  4RTU A;  1VQ6 Q;  2FEI A;  5KYX A;  5CAI A;  4B6M A;  1P92 A;  2MIO A;  5CR2 A;  4PFP A;  1ARK A;  5C0M A;  3OS5 A;  3EG3 A;  4PJO C;  2VUB A;  1UGR B;  1Q86 R;  1OEB A;  1TH7 A;  2NLU A;  2KY9 A;  3DB3 A;  3QJ6 A;  5LJ3 h;  1WX6 A;  4ZN1 A;  3HHT B;  2DZ9 A;  4L5G A;  1U1T A;  4KH1 B;  2MWP A;  1W6X A;  1WGS A;  2EWN A;  4J9H A;  2QQS A;  1VQM T;  4HCC A;  1X2K A;  5KE2 A;  2DA9 A;  2RH2 A;  4BE2 A;  2CZ6 B;  1QVF S;  1N5Z A;  1NEB A;  2P0Q A;  4K11 A;  2CGH A;  4EMG A;  1VQ4 Q;  2OTL A;  3M9Q A;  4CC7 A;  2V8J A;  1D0Z A;  3FLG A;  3G4S Q;  3CCS Q;  3KXT A;  2A0F B;  2X4J A;  2GBQ A;  2MMP A;  4M75 C;  1TUC A;  3RR6 A;  2JUF A;  3UA7 A;  2VC8 A;  2DNU A;  3VV0 A;  3QII A;  4F16 A;  4QVD A;  3VUB A;  3QZ9 B;  3M56 A;  4FIB A;  5LJ5 e;  1NE8 A;  1PM3 A;  1ZHI A;  1PKT A;  2EVR A;  5HKC A;  2ED0 A;  4MZM A;  1YI2 A;  1Q86 C;  2KVQ G;  1Y0M A;  2DO3 A;  4Z02 A;  1NJI R;  3EG2 A;  2FZK B;  1WJS A;  1QVF A;  2KDS A;  4M7D B;  4IUQ A;  3RES A;  2L2P A;  1GRI A;  5DLO A;  4OB0 B;  3GPL A;  1XJW B;  4XTW A;  2G6F X;  4F14 A;  1MV0 B;  2DFU A;  1JQQ A;  2X35 A;  1JU5 C;  2JXB A;  3ZFJ A;  3H8Z A;  3L1A A;  2C0I A;  4M7D E;  1Q7Y U;  1AT1 B;  4RTX A;  2E12 A;  4LD6 A;  2DRM A;  1YN8 A;  4M7D G;  1RAH B;  1PRM C;  1VQ6 A;  5IHK A;  1NM7 A;  5HK0 A;  5GAO r;  5I2S A;  1WQ7 A;  5GAM e;  1XNI A;  1EZZ B;  2COW A;  4C8Q E;  3CCJ T;  1N8R U;  1PCX A;  2L3Q A;  3O5Z A;  4C92 F;  1UHF A;  1VQ5 T;  4JRP A;  4LNP A;  1U3O A;  2VB6 A;  3G6E T;  3L2W A;  3QJY A;  4C8Q G;  1IRX A;  1W1F A;  1OU9 A;  1UEC A;  1KHC A;  3CC2 Q;  3CC4 Q;  1OQK A;  3OYH A;  4QVZ A;  4ELZ C;  1VQ4 A;  2QI2 A;  4M77 C;  3QHS A;  4PJL A;  1S1N A;  2O9S A;  3G4S A;  2P4R A;  4XU0 A;  2E65 A;  3CCL T;  1VQ8 Q;  4RMO A;  3EHR A;  3CXC A;  2DL7 A;  1MMG A;  3M0R A;  3EH1 A;  3JCM P;  1DJ7 B;  5CVI A;  1MUZ A;  1VUB A;  2KE9 A;  3VS2 A;  2BKD N;  1NYG A;  4CRI A;  1KSW A;  4X9D A;  3REB B;  5AYF A;  4PLL A;  4MDX A;  3PE0 A;  2MAM A;  1OV3 A;  2FRY A;  3INZ A;  1RLQ C;  4J83 A;  2CUD A;  2RJC A;  3EFR A;  1KC8 R;  3JB9 G;  1IZ6 A;  5LJ3 d;  4YTL A;  5GAN f;  3QDR B;  2CKK A;  4MMK A;  2RHZ A;  4F7U E;  1LNX A;  1WZO A;  2K4Y A;  3OYI A;  2DK3 A;  4X9C A;  4BD3 A;  1M3C A;  2EJF A;  1Q7Y C;  2KNB B;  4F7U G;  1NPP A;  2JT4 A;  4HXJ A;  3GBQ A;  3MEU A;  2YUQ A;  5KYU B;  5A0G A;  2ZPH B;  3HKS A;  5L8R E;  4IUP A;  1GFD A;  5KYN A;  2OAW A;  4JDS A;  4DA4 A;  4DQ2 A;  2IVW A;  1FMK A;  4PFZ A;  3HPW A;  4IUU A;  5GAN 4;  4J9E A;  4OVA A;  3CMA Q;  4C92 D;  5GAN 2;  5FU7 C;  2WSE E;  4R56 A;  2DBK A;  4E2F B;  1I81 A;  2FYK A;  5D6W A;  2R58 A;  4A4E A;  2CRE A;  4JJB A;  4J9C A;  2HZY A;  1ZUK A;  3QZ5 B;  1UGS B;  2GQI A;  2IIM A;  2A36 A;  1H64 1;  4ESR A;  5GAO p;  2LQW A;  2PTK A;  1ZX6 A;  4C5I A;  4LE9 A;  1UDL A;  1Y71 A;  1B3Q A;  3RKW A;  2E41 A;  4PJO B;  3JCM J;  2WAC A;  1X43 A;  2KSS A;  4RTT A;  3CXC P;  3KUF A;  2DTH A;  1AHJ B;  1M2O A;  4A4F A;  1D0X A;  2GNC A;  2EFI A;  4HVW A;  5CKD A;  2F5T X;  3I5R A;  3CC7 A;  2MF2 A;  2L3R A;  1GFC A;  4B9X A;  3LWH A;  4M7D A;  3PFS A;  1FMV A;  4KBM B;  4ZGJ B;  3CCQ Q;  5GAN 3;  4M75 B;  1JB0 E;  2XU8 A;  2V1R A;  1ZSG A;  1H8K A;  4EPC A;  1AZG B;  2IG0 A;  3O8V A;  4OMP A;  2DEU A;  2KYM A;  1BKB A;  3VS0 A;  1O75 A;  1RUW A;  4KUL A;  5IXB A;  1YHQ T;  1VQO Q;  5IT9 E;  2V26 A;  2CZ7 B;  3CD6 T;  2VVK A;  2PVO B;  4HCK A;  4OMN A;  4RTW A;  1Y7X A;  4C8Q A;  4HCB A;  3J80 E;  1ZLM A;  3M59 A;  2VV5 A;  1ZQ1 A;  3PT9 A;  1FXX A;  4AFQ C;  3JCM b;  1NYF A;  4J9B A;  3HTR A;  1M9S A;  4DBF A;  2WSF E;  1I5O B;  4IIM A;  5A2Q E;  3UF4 A;  3RIR A;  2QQB A;  2HBP A;  1T0H A;  4PNO A;  3SWN B;  1U8R A;  1ZSZ C;  2J6F A;  2CUB A;  3CMA A;  2KRM A;  4PJM A;  4IKF A;  2KMT A;  2ZPE B;  2NUZ A;  4C0D C;  5GAN 8;  3JCM f;  1KG1 A;  3CCM T;  4C5H A;  3ASK A;  3U23 A;  3VJP A;  3PMI A;  4WCI A;  2ESW A;  4X1V A;  1EX4 A;  2QEX Q;  3HP9 A;  5FRN A;  2VGN A;  3I55 T;  2RI3 A;  3RUX A;  1T3L A;  4ZNX A;  1NZ9 A;  3THK A;  2M0O A;  3FDR A;  1UEB A;  3QYH B;  2GGR A;  4FSS A;  2DVJ A;  3V8K A;  4RUG A;  2GFU A;  3F70 A;  2BE7 D;  4BI8 B;  1LOJ A;  5LL6 S;  2GFA A;  5IHN A;  4DBH A;  5I21 A;  2D6F A;  2YUN A;  5J39 A;  4PJO F;  1AWJ A;  3JCM c;  3QKJ A;  1Q81 R;  3MET A;  2R5M A;  1QVG A;  1WXT A;  4JRQ A;  1YJW A;  1YBY A;  3GLX A;  2RI5 A;  1M27 C;  1G3W A;  4XAX B;  2PUK B;  4OB3 B;  2EYX A;  3C12 A;  3MEV A;  1TUG B;  4IUV A;  3EG9 A;  3CCQ A;  5CKH A;  3D7S B;  1UGV A;  2X3W D;  3TCJ A;  1YJN Q;  4GLK A;  2M1H A;  5KE3 A;  1RLP C;  2Y4X A;  1BIA A;  2V8I A;  3IQL A;  4KGX B;  4M78 F;  2O88 A;  3OS1 A;  3LLR A;  1KD1 R;  4OMO A;  4OGC A;  3JRZ A;  4M75 F;  2C0T A;  1WHJ A;  5KYU A;  3UAT A;  4BY6 C;  1K76 A;  1WA7 A;  4ZTJ A;  2DZC A;  3I9Q A;  5KYW A;  3L2Q A;  3RMS A;  3V8J A;  1I5L A;  4KGZ B;  1YIT Q;  2FPD A;  3OS0 A;  3MCA B;  1ZUU A;  1SSH A;  2CSI A;  4J6X A;  2XD0 A;  1NPR A;  2DMO A;  4J9I A;  2RD1 A;  4WF2 A;  1H3Z A;  1PG5 B;  2CT4 A;  4TVR A;  1VQP A;  3G7Z A;  3VKI A;  1YJ9 T;  3CBP A;  3CME T;  1MMA A;  2DE0 X;  5GMK e;  9ATC B;  1BYM A;  2DIL A;  2DXU A;  2AHJ B;  3MEW A;  2FZC B;  2X3X D;  3VS5 A;  4PJO A;  1D3B A;  3A1P A;  5FU7 B;  1UG1 A;  5CKF A;  5DY9 A;  3CBO A;  1IGU A;  3L2Z A;  5IXF A;  4L6V 5;  1N9R A;  1JRI A;  1W2B A;  3WVD B;  2CP7 A;  4ELY C;  5FW9 A;  2FZG B;  1RAB B;  4PJO D;  2A3L A;  2VGM A;  1QVG P;  2DTI A;  3EH2 A;  3M0Q A;  1WHG A;  1T0J A;  1RAC B;  4FT2 A;  4FU6 A;  1UTI A;  2L8D A;  4OML A;  4D8D A;  2LZ6 B;  3RKX A;  4BDY A;  1JBM A;  3M53 A;  1XOV A;  1X6B A;  4XTY A;  4C92 B;  1K9A A;  1QMC A;  1YJN A;  1Y57 A;  4DEX A;  3OYC A;  3M0S A;  1X27 A;  2I2L A;  3OQ5 A;  2LT4 A;  1M90 U;  3CCE T;  1GBQ A;  4M77 F;  4M78 D;  3KFV A;  4CI0 C;  3DB4 A;  4R55 A;  3CPW S;  2DXB A;  4D8K A;  3P8B B;  3JB9 H;  4HT9 A;  4PFO A;  4M75 D;  3A8M B;  2M16 A;  4A4H A;  4C92 E;  5CKB A;  2LVM A;  3SFM A;  4E7I A;  2CS7 A;  1IGQ A;  4BDZ A;  2DPP B;  4C92 G;  3FIF A;  3PMT A;  1S72 A;  2AIR B;  3A8G B;  2EQU A;  2MOX A;  1YIT A;  3MEA A;  1OI1 A;  4MML A;  1ZA1 B;  4R0K A;  1VQL A;  3SWN A;  2HQX A;  1R0C B;  2ZPI B;  2FL7 A;  5HK3 A;  3OYK A;  1WDX A;  3MP8 A;  1OZ2 A;  4M78 C;  5IAY A;  1QQJ A;  3NFC A;  2KYB A;  2ZPB B;  4JLG A;  3QWY A;  1G3Y A;  3CCR Q;  1RL2 A;  1AWO A;  3TVT A;  4J7I A;  2KAF A;  2OTJ A;  1KIK A;  2OTL T;  3JCM W;  5ECA A;  4OMM A;  4XTX A;  3SD4 A;  5AT1 B;  1AEY A;  1BK2 A;  5LJ3 f;  5GAN g;  3CCU Q;  2RN8 A;  1ZSZ B;  4ZGD B;  2LJ1 A;  2EYW A;  2DM1 A;  1RAF B;  3PNW C;  1ACM B;  4J7F A;  3OA6 A;  5LJ5 j;  4AG1 C;  1JEG A;  1BI3 A;  2LJ3 A;  5D6X A;  2RA2 A;  5GAO n;  1TWB A;  1W2B P;  1G3S A;  3CPF A;  1OX8 A;  1YI2 T;  3M55 A;  2K3Y A;  1ZBX A;  3C95 A;  4L59 A;  4M4Z A;  4OGE A;  3HFO A;  1UJ0 A;  3QWX X;  3EHQ A;  1KQ1 A;  4JS5 A;  5GAO m;  4IIO A;  1N6A A;  3S3M A;  4Y28 E;  4QQG A;  2EKH A;  3I5S A;  1HYO A;  4EMK C;  3H9N A;  4HA8 A;  4C0Z A;  3RER A;  4JRI A;  2RQU A;  4LDW A;  1RAG B;  3NTH A;  2GTJ A;  4P5N A;  2LNV A;  3GOX A;  2JVV A;  3HFN A;  3OMG A;  2K2M A;  2EW3 A;  3LH0 A;  2DL4 A;  2XIC A;  4M77 D;  1M90 C;  3OYA A;  3M58 A;  2FB7 A;  3MHX A;  2FPF A;  1W4S A;  1Q95 G;  1M2V B;  3M0T A;  4FW2 A;  2B8A A;  1QVP A;  1VQ6 T;  3CCV Q;  2J06 A;  3OBY A;  4GY5 A;  5GMK m;  2KQW A;  3JV3 A;  4AFU C;  5GAM j;  3GF5 A;  1R77 A;  2LRQ A;  2LX9 A;  5FLX E;  2LDM A;  5LJ5 g;  3LGF A;  2EQJ A;  3JCM e;  1WHH A;  2KXD A;  4D6W A;  4QVC A;  1WHL A;  5CQX A;  4NL3 A;  1VQ9 Q;  2XG8 D;  2LCL A;  1V76 A;  3VRZ A;  2E3I A;  1Q7Y R;  2M0Y A;  3CCS A;  1V29 B;  3DLM A;  3OMC A;  1N27 A;  3CCR A;  2HD0 A;  2X4W A;  2PUO B;  4RG2 A;  1BI2 A;  4ANJ A;  2P0K A;  1GCP A;  2HL5 C;  4X34 A;  1VQ4 T;  1EFN A;  1JJ2 S;  1MNE A;  5GAN h;  3G4S T;  1SHG A;  4XK8 E;  2QTX A;  1B34 A;  1A0N B;  3I56 Q;  4JZ4 A;  3CCU A;  2RMO A;  3P8D A;  2NUT B;  1YWO A;  1RI0 A;  1QVF P;  1I4K 1;  1N8R R;  4XTZ A;  4N4G A;  8ATC B;  1VQN Q;  3OW2 S;  3J7A F;  2COZ A;  2ZPF B;  3JCM V;  3PTA A;  3RDV A;  1NLO C;  5GAO l;  3EGX B;  2E6Z A;  4XU1 A;  2LNH B;  4RKU E;  1IB8 A;  5GAM g;  2P84 A;  3NMZ C;  2YSQ A;  1I8F A;  2JZ2 A;  1R8O B;  1JJ2 A;  1K4U S;  1BI0 A;  1BB9 A;  2NUP B;  2E5Q A;  5KCH A;  4PLI A;  2GF7 A;  3CD6 Q;  2O9V A;  2D1X A;  2VWF A;  4LN2 A;  4C92 A;  3RMQ A;  3OY9 A;  4CC3 A;  1K1Z A;  4BE1 A;  2O4X B;  4LDU A;  1K9M U;  1TTH B;  1TU0 B;  2DVE A;  3FRN A;  2CH4 W;  3OW2 A;  2E64 A;  3E19 A;  4M7A C;  3QDF A;  2HDA A;  1CKB A;  4A53 A;  2AT1 B;  5GMK l;  1LVK A;  2JMC A;  2JTE A;  4HVU A;  1N8R C;  2D0Q B;  3CCV A;  2W0Z A;  2ECZ A;  2E6N A;  2QQA A;  5LJ5 h;  1CSK A;  4C5E A;  1KJW A;  1WNL A;  2EJ9 A;  1OZ3 A;  3OYE A;  5CIU A;  5GJV B;  1M8M A;  3CC2 A;  3CC4 A;  4AMC A;  4A63 B;  3I55 Q;  4EMH A;  4LDX A;  1QLY A;  3GNF B;  2HL3 A;  1VQ9 A;  2KXC A;  4MZT A;  1FMW A;  1MGQ A;  3NTI A;  1VQ8 A;  2K2V A;  2VXF A;  3BY7 A;  2JM8 A;  2NWM A;  2YRD A;  3MP1 A;  3G71 Q;  5EC7 A;  2QTV A;  3R6O A;  1K73 U;  4PJO E;  4QW2 A;  3I56 A;  2F5K A;  3L2U A;  4KGV B;  1NG2 A;  2AZS A;  1M3B A;  4OMQ A;  4M78 B;  2RI2 A;  1VQK Q;  4PJO G;  2RM4 A;  5IN1 A;  1MMN A;  1TXQ A;  2HBW A;  1VQN A;  5I22 A;  3A8L B;  3CC7 T;  3ME9 A;  4ZN3 A;  4JRK A;  5GAM h;  3PIO A;  2E10 A;  3TRE A;  2H3E B;  2M02 A;  4Y92 A;  1VYT A;  3FEO A;  1PKS A;  2ATC B;  4M78 E;  3NPF A;  2CSQ A;  1QKX A;  2K3X A;  2LT1 A;  1M3A A;  4GLM A;  3V7C A;  2YUO A;  3HL8 A;  4M75 E;  2H3J A;  4LUE A;  1G8X A;  2B86 A;  4M78 G;  2DBM A;  2RO0 A;  4UC4 A;  3ZL7 C;  3CEY A;  2EQK A;  3VS6 A;  4Z89 A;  2EKO A;  4M75 G;  3MKD A;  1YFN A;  1D0Y A;  3VS7 A;  4FYV B;  1HSQ A;  3H0F A;  2QA4 Q;  1K9M C;  3QPH A;  1WPY A;  3QYG B;  4LDY A;  4N0A A;  3ER0 A;  2QQR A;  1OOT A;  5A0D A;  5A0L A;  3DKM A;  2DD4 A;  1M2V A;  3QO3 A;  4NOY A;  2AKL A;  4LD9 K;  4KUI A;  3MP6 A;  4EMK B;  2K79 A;  5GAO q;  1XQH A;  4EIK A;  3EFO B;  3UPU A;  5CO7 A;  4HVV A;  2IPO B;  1IRE B;  2RHX A;  3CMA T;  2JJ9 A;  2CT3 A;  2HKQ B;  3BE3 A;  1PSE A;  3L2V A;  1BCM A;  2EGE A;  4M7D C;  1KQS S;  1QWF A;  2X4X A;  1VQ7 Q;  5CCA A;  3QUI A;  2LMJ A;  2KR3 A;  2FRW A;  4A54 A;  2KGT A;  4LDV A;  5LJ3 e;  1WFW A;  3OYN A;  1TS9 A;  2YDL A;  2QXF A;  1FX7 A;  2DRK A;  2E5K A;  1AWX A;  2J6K A;  2XDD A;  3A8H B;  1I1J A;  4II1 A;  2LCS A;  3G71 A;  1X75 C;  4VUB A;  4RTV A;  2RNA A;  3S6W A;  3LGL A;  4C8Q C;  1K73 C;  2QDL A;  4DEY A;  2NUT A;  1AWW A;  3RNJ A;  1B7T A;  4M77 B;  1X69 A;  2MPX C;  3V7R A;  1VQK A;  4E7J A;  3PVL A;  2EGA A;  1KQS A;  3VUZ A;  1UGP B;  1YJW T;  1YIJ Q;  1UFF A;  5LJ5 d;  3EGX A;  2ZPG B;  4FW1 A;  5GAN 6;  1PWT A;  4M77 E;  3CCQ T;  1VQO A;  1UB4 A;  2XKO C;  4N4H A;  2DL5 A;  2LP5 A;  2EIF A;  2NUP A;  2KEA A;  3A98 A;  3C0C A;  3OSS C;  2DTO A;  1OPK A;  4M77 G;  1UJY A;  3X25 B;  5C6S A;  1VYV A;  3QSU A;  2QK0 A;  2HEQ A;  1WJR A;  2O01 E;  3X24 B;  1QCF A;  3WXM B;  2D8H A;  4OMF B;  4ORZ A;  1WXB A;  2QGG A;  1VQM Q;  4JPB W;  2QA4 A;  1PC0 A;  1UGQ B;  2PNI A;  3E9G A;  1LPL A;  2RF0 A;  1OYX A;  1RI9 A;  1K0S A;  2CZ1 B;  1M1K U;  2XHC A;  2JS2 A;  2ZAE A;  1AZE A;  4J8O A;  1TG0 A;  1ZBJ A;  3EG1 A;  1MND A;  2VYT A;  4Z88 A;  2QEX A;  1T3S A;  4C0G A;  2J05 A;  2V8K A;  1X6O A;  1HK9 A;  4QQD A;  1IO6 A;  2ZCF B;  2OTL Q;  5GAM d;  2OAU A;  4FCY A;  1GCQ C;  5L23 A;  4FYY B;  4M7A B;  2BIV A;  2H8H A;  1WYX A;  1VQP T;  2C06 A;  4QKU A;  1VQ7 A;  1BU1 A;  2OJ2 A;  1M8V A;  3X20 B;  2EAY A;  2HQE A;  5GMK j;  2XI9 A;  1X01 A;  1Q82 U;  3JCM Q;  3TQ7 P;  4ME7 A;  4E7Z A;  2QDY B;  1Y96 B;  3OYJ A;  1Q86 U;  2JOY A;  2OI3 A;  2HQH A;  3WVE B;  1K0X A;  2YRC A;  2JS0 A;  2PU9 B;  1G3T A;  4HKE A;  4JJN K;  1F1B B;  4M78 A;  4WTO B;  5J3B A;  2XMF A;  4GBQ A;  4M75 A;  3OYG A;  1E7O A;  4XQ3 A;  4FYX B;  1VIF A;  5GAN j;  1D09 B;  1YIJ A;  1KQ2 A;  1M1K R;  4ZTF A;  2SEM A;  2EYQ A;  1E6G A;  2Y4Y A;  2DET A;  2XID A;  1MMD A;  1ABO A;  2DIQ A;  2F69 A;  5CK9 A;  1YJN T;  2J7I A;  3CQT A;  2E3H A;  3OB9 A;  2O2O A;  4OB1 B;  5FU6 C;  3CCJ Q;  2K7A A;  1VQ5 Q;  4PKC C;  3VS3 A;  2W10 A;  3G6E Q;  2MWO A;  4KRT A;  3X26 B;  5FRO A;  2ZGW A;  1PSF A;  5FRM A;  1NJI U;  1Q82 R;  2M9U A;  2GTO A;  3CBM A;  1VQM A;  1BI1 A;  1RAI B;  5GAN 7;  2MCN A;  1O9S A;  3UDC A;  1D1B A;  2GQV A;  3NGP A;  1SSF A;  1S72 T;  2KT1 A;  2X9H A;  1YIT T;  3G1J A;  4EMK A;  1YWP A;  3EG0 A;  2ABL A;  4RCB A;  2HSP A;  2KRO A;  3CPW A;  1VQL T;  1LCK A;  1U5S A;  3EFO A;  2BZ8 A;  1M1K C;  3CCL Q;  2DER A;  1M5Q 1;  3BW1 A;  3GP8 A;  2YRV A;  1HD3 A;  3EGD B;  1OPL A;  3SDZ A;  3JB9 J;  4AFS C;  1M90 R;  3EFS A;  2RPN A;  1GL5 A;  3I35 A;  2L3P A;  3OBW A;  2YUP A;  2YXY A;  2OTJ T;  4J6Y A;  1I07 A;  2CP3 A;  2XDP A;  2HAX A;  3AHU A;  1HJD A;  2RB6 A;  1RAA B;  4J9D A;  4J6W A;  4C0D B;  4IUR A;  2HSE B;  3URG A;  3LX7 A;  2X51 A;  1Q82 C;  2K5I A;  1PRL C;  4M7A F;  2E4H A;  4BI3 A;  2F2X A;  4PJN A;  1QWE A;  1E6H A;  1YNZ A;  3UA6 A;  4PL6 A;  3H6Z A;  1KK7 A;  1SRL A;  4FSX A;  2KT8 A;  2QGF B;  3L42 A;  3N5B B;  4M77 A;  2RHU A;  3QBY A;  2DJZ A;  1WHM A;  5DLQ E;  1RAE B;  5I11 A;  4FYW B;  1UE9 A;  3ZBD A;  2K57 A;  1M1F A;  2JNG A;  4XU3 A;  3SWN C;  3JAM E;  1D1A A;  3TEE A;  2Y90 A;  3VS4 A;  4N4I A;  4E6R A;  5FWB A;  1XTD A;  3SHW A;  2LQ8 A;  3H0H A;  1TOV A;  2LTO A;  4C8Q B;  4OF1 A;  4F04 B; 
#chains in the Genus database with same CATH homology
 3F70 A;  3OYE A;  5CIU A;  3CCJ A;  2BUD A;  1LOJ A;  4Q5W A;  5LL6 S;  4BI8 B;  3CC2 A;  3CC4 A;  2GFA A;  4EMH A;  4LDX A;  5GAN e;  3OYD A;  1VQ5 A;  2WSC E;  3E9F A;  2FHD A;  5I21 A;  3GNF B;  5GMK h;  4JS4 A;  3OYY A;  3A5Z B;  3G6E A;  3CCE A;  2P4T A;  3HRS A;  4C0F A;  1VQ9 A;  2D6F A;  5J39 A;  4PJO F;  4ZGE B;  1YIJ T;  4MZT A;  4FM4 B;  3JCM c;  1MGQ A;  3M57 A;  3QKJ A;  3MET A;  1NJI C;  3NTI A;  2R5M A;  4E7L A;  3S3O A;  1QVG A;  3CXC S;  1KC8 U;  4JRQ A;  1YJW A;  1VQ8 A;  2K2V A;  2VXF A;  1YBY A;  3GLX A;  2RI5 A;  3OS2 A;  1G3W A;  3BY7 A;  4XAX B;  1M4Z A;  4NL2 A;  2PUK B;  3MP1 A;  4OB3 B;  3C12 A;  2GCX A;  3MEV A;  5CAI A;  1P92 A;  2RJD A;  5CR2 A;  3R6O A;  4IUV A;  3CCQ A;  1K73 U;  4PJO E;  4QW2 A;  4A4G A;  5C0M A;  5CKH A;  3I56 A;  3TCJ A;  2F5K A;  3OS5 A;  3L2U A;  4PJO C;  2VUB A;  4GLK A;  1UGR B;  4O6J A;  4BY6 B;  1TH7 A;  2NLU A;  4XTV A;  2KY9 A;  2M1H A;  3DB3 A;  5KE3 A;  2Y4X A;  1BIA A;  3QJ6 A;  2V8I A;  4M78 B;  5LJ3 h;  4ZN1 A;  3EAE A;  2RI2 A;  3CCL A;  4HT8 A;  3HHT B;  4PJO G;  4FT4 A;  4M78 F;  2DZ9 A;  3L2R A;  4L5G A;  2RM4 A;  5IN1 A;  1U1T A;  3HRT A;  3CCS T;  3OS1 A;  2MWP A;  3LLR A;  1WGS A;  2EWN A;  1VQN A;  1VQM T;  2QQS A;  3A8L B;  3CC7 T;  4OGC A;  3CCR T;  4HCC A;  5KE2 A;  3JRZ A;  3ME9 A;  4M75 F;  4M7A A;  4ZN3 A;  2RH2 A;  1BIB A;  4JRK A;  5GAM h;  3PIO A;  2E10 A;  4RCC A;  3TRE A;  4BE2 A;  2CZ6 B;  3J81 E;  3FEO A;  4RG8 A;  1QVF S;  4BY6 C;  4ZTJ A;  2P0Q A;  4M78 E;  2CGH A;  2DZC A;  4EMG A;  2OTL A;  4DOW A;  3M9Q A;  2K3X A;  2V8J A;  2LT1 A;  2EJG A;  3L2Q A;  3RMS A;  3FLG A;  3V7C A;  3V8J A;  3CCU T;  1I5L A;  3HL8 A;  4M75 E;  1Y96 A;  3KXT A;  2X4J A;  2H3J A;  2MMP A;  4M7A D;  2CZ0 B;  4M75 C;  3OS0 A;  4NS5 A;  2XDB A;  4M78 G;  2RO0 A;  4UC4 A;  3MCA B;  3CEY A;  2JUF A;  2VC8 A;  2DAQ A;  4F7U B;  2EQK A;  2PVD B;  3VV0 A;  3QII A;  4OB2 B;  4JUV A;  2EKO A;  4M75 G;  1U1S A;  2RK1 A;  4J6X A;  4QVD A;  2XD0 A;  3VUB A;  3QZ9 B;  1NPR A;  3M56 A;  4FIB A;  5LJ5 e;  1NE8 A;  1ZHI A;  2RD1 A;  5HKC A;  1K9M C;  4WF2 A;  3NTK A;  1H3Z A;  4OP0 A;  3QPH A;  4MZM A;  1YI2 A;  1WPY A;  1Q86 C;  2KVQ G;  3QYG B;  4LDY A;  4TVR A;  4N0A A;  2DO3 A;  1Y07 A;  3ER0 A;  2QQR A;  1VQP A;  2CYZ B;  4Z02 A;  5A0D A;  5A0L A;  3DKM A;  2DD4 A;  3G7Z A;  3VKI A;  3QO3 A;  4NOY A;  1WJS A;  3CBP A;  2KDS A;  1YJ9 T;  1WJQ A;  3CME T;  1QVF A;  4BE0 A;  4IUQ A;  4LD9 K;  3RES A;  4M7D F;  5GMK e;  4KUI A;  3MP6 A;  4EMK B;  4JLI A;  3JCM g;  1BYM A;  3A8O B;  2L5Q A;  2R57 A;  5DLO A;  2DXU A;  5GAO q;  1XQH A;  4OB0 B;  3DLL A;  3GPL A;  4XTW A;  3UPU A;  5CO7 A;  2AHJ B;  3GNG A;  3MEW A;  4PJO A;  1D3B A;  4C5G A;  1IRE B;  2X35 A;  2RHX A;  5FU7 B;  3CMA T;  3T9N A;  5CKF A;  5DY9 A;  3ZFJ A;  3CBO A;  3H8Z A;  3L1A A;  1YCY A;  4M7D E;  3L2Z A;  1Q7Y U;  1PSE A;  3L2V A;  1K8A U;  2PVG B;  4M7D C;  4L6V 5;  3BDL A;  1N9R A;  3LYI A;  2G3R A;  2E12 A;  2RJE A;  4LD6 A;  1JRI A;  1W2B A;  3LWI A;  2MI6 A;  3WVD B;  1KQS S;  2JN0 A;  2X4X A;  3BDU A;  4ELY C;  5CCA A;  3QUI A;  4M7D G;  2E70 A;  4PJO D;  3P8H A;  4C8Q F;  2A3L A;  4A54 A;  2VGM A;  4J5Y A;  4LDV A;  3GIB A;  2DIG A;  5LJ3 e;  3CCV T;  2DTI A;  3FB9 A;  3OYN A;  4M7D B;  4FT2 A;  4FU6 A;  2QXF A;  1VQ6 A;  1FX7 A;  2L8D A;  1KC8 C;  5KCO A;  3RKX A;  4BDY A;  5HK0 A;  5GAO r;  2XDD A;  3A8H B;  5I2S A;  4II1 A;  4KT0 E;  1WQ7 A;  4MZP A;  4BI4 A;  1JBM A;  1X75 C;  5FU6 B;  3M53 A;  1XOV A;  1XNI A;  5GAM e;  4VUB A;  4XTY A;  4C8Q E;  1N8R U;  3S6W A;  3CCJ T;  4C92 B;  3CC2 T;  3CC4 T;  3LGL A;  4C8Q C;  5KH6 A;  4C92 F;  1YJN A;  1K73 C;  3OYC A;  2I2L A;  3OQ5 A;  1VQ5 T;  4JRP A;  2LT4 A;  3KBG A;  1M90 U;  3G6E T;  3CCE T;  4M77 B;  3L2W A;  3QJY A;  1VQ9 T;  2P0P A;  4HCZ A;  2QQ9 A;  3V7R A;  4E7J A;  1VQK A;  4M77 F;  4C8Q G;  4M78 D;  2D9T A;  1KQS A;  4CI0 C;  3DB4 A;  3VUZ A;  5DM7 R;  4R55 A;  3CPW S;  2DXB A;  1D3B B;  3P8B B;  3JB9 H;  4HT9 A;  1UGP B;  4M75 D;  3UWN A;  1VQ8 T;  1YJW T;  3A8M B;  2M16 A;  4A4H A;  3ZEH A;  5CKB A;  4C92 E;  4DOV A;  5LJ5 f;  5LJ5 d;  1KHC A;  2LVM A;  4C92 C;  3SFM A;  3OYH A;  2ZPG B;  4QVZ A;  4BAC A;  4ELZ C;  5GAN 6;  4FL6 A;  4M77 E;  4E7I A;  3CCQ T;  3HRU A;  2QI2 A;  1UB4 A;  2CS7 A;  2XKO C;  4M77 C;  2DPP B;  4C92 G;  1QP3 A;  3FIF A;  3QHS A;  1KHI A;  4N4H A;  3I56 T;  4V2S A;  3PMT A;  2EIF A;  1S72 A;  3A8G B;  2EQU A;  3G4S A;  1YIT A;  3MEA A;  1OI1 A;  2JTM A;  3OSS C;  4XU0 A;  2DTO A;  4MML A;  4M77 G;  2E65 A;  3CCL T;  1VQL A;  3SWN A;  3X25 B;  3JB9 F;  3VU3 C;  5C6S A;  4RMO A;  2HQX A;  3CXC A;  2ZPI B;  2FL7 A;  5HK3 A;  3OYK A;  3QSU A;  4E47 A;  3MP8 A;  1OZ2 A;  5D6Y A;  1VQN T;  4M78 C;  5IAY A;  1DJ7 B;  5CVI A;  1WJR A;  3JCM P;  2O01 E;  3X24 B;  2DEQ A;  3WXM B;  3NFC A;  1YHQ A;  4OMF B;  1VUB A;  2ZPB B;  2DXT A;  4JLG A;  2BKD N;  4CRI A;  1G3Y A;  2QA4 A;  1RL2 A;  4X9D A;  5EG2 A;  3CD6 A;  5AYF A;  2YLB A;  4J7I A;  4PLL A;  1UGQ B;  2KAF A;  4F7U F;  4MDX A;  2OTL T;  2OTJ A;  3JCM W;  3JCM h;  4XTX A;  2MAM A;  2ZZD A;  3E1S A;  3E9G A;  3SD4 A;  3INZ A;  1OYX A;  4J83 A;  2RJC A;  5I2M A;  3EFR A;  3HSB A;  4M7D D;  4MDW A;  5LJ3 f;  3PIP A;  4B9W A;  2CZ1 B;  3JB9 G;  1IZ6 A;  5LJ3 d;  4YTL A;  1M1K U;  2XHC A;  5GAN g;  2K5F A;  5GAN f;  4ZGD B;  4J8O A;  5GAN d;  2E1H A;  3OYF A;  3QDR B;  2CKK A;  4MMK A;  3X28 B;  2VYT A;  4J7F A;  3PNW C;  2RHZ A;  2QEX A;  4F7U E;  4O5V A;  4C0G A;  1QP2 A;  3OA6 A;  1LNX A;  2V8K A;  2K4Y A;  5LJ5 j;  1X6O A;  1HK9 A;  1BI3 A;  4QQD A;  5GAM f;  2DK3 A;  2RK2 A;  4X9C A;  2ZCF B;  3OYI A;  5GAM d;  4BD3 A;  2OAU A;  5D6X A;  2RA2 A;  5GAO n;  2EJF A;  1G3S A;  3CPF A;  1Q81 U;  4M7A B;  1YI2 T;  1Q7Y C;  2BIV A;  1K8A C;  4F7U G;  1NPP A;  3M55 A;  2K3Y A;  1VQP T;  2C06 A;  1ZBX A;  1GXI E;  1VQ7 A;  3MEU A;  3C95 A;  4L59 A;  5A0G A;  3CCM A;  2ZPH B;  4OGE A;  1M8V A;  3HFO A;  3HKS A;  3X20 B;  2DD5 A;  2EAY A;  2HQE A;  5L8R E;  1N9S A;  4IUP A;  4C8Q D;  5GMK j;  2XI9 A;  1KQ1 A;  4JS5 A;  5GAO m;  3UT1 A;  1N6A A;  3FC3 A;  1X01 A;  1Q82 U;  3JCM Q;  3I55 A;  3S3M A;  4ME7 A;  4Y28 E;  4QQG A;  3QG1 A;  4JDS A;  2QDY B;  3QXE B;  4DA4 A;  4DQ2 A;  3CCM T;  1Y96 B;  3OYJ A;  5M9O A;  2IVW A;  4EMK C;  1Q86 U;  2JOY A;  2EQM A;  4HA8 A;  2YHT A;  2FVU A;  3HPW A;  3VYH B;  4C0Z A;  1VQO A;  3RER A;  4JRI A;  4IUU A;  5GAN 4;  3WVE B;  4LDW A;  3RKY A;  2X4Y A;  4OVA A;  3NTH A;  4P5N A;  1QVG S;  2LNV A;  2PU9 B;  4C92 D;  1G3T A;  2JVV A;  2WSE E;  5FU7 C;  5GAN 2;  3GOX A;  1KD1 U;  4R56 A;  4HKE A;  1I81 A;  2FYK A;  3HFN A;  5D6W A;  4JJN K;  4M78 A;  3OMG A;  2R58 A;  4A4E A;  2RJF A;  3LH0 A;  3LW5 E;  2XIC A;  4M77 D;  3JSC A;  1M90 C;  5J3B A;  3OYA A;  3M58 A;  2PQW A;  2FB7 A;  4KUD K;  3MHX A;  4M75 A;  2HNI A;  3M5A A;  5LJ3 j;  3OYG A;  4XQ3 A;  1W4S A;  5CQY A;  3QZ5 B;  1UGS B;  1VIF A;  5GAN j;  1H64 1;  1VQ4 A;  1YIJ A;  1KQ2 A;  1VIE A;  2B8A A;  1QVP A;  4ZTF A;  1VQ6 T;  1G5V A;  2EYQ A;  3OBY A;  5GAO p;  4GY5 A;  2Y4Y A;  5GMK m;  4C5I A;  1M1G A;  2KQW A;  2XID A;  3JCM X;  5GAM j;  2DIQ A;  3C4S A;  1Y71 A;  3GF5 A;  3M54 A;  3G71 T;  2LRQ A;  3RKW A;  2F69 A;  2LX9 A;  2E41 A;  5CK9 A;  4PJO B;  4QQ6 A;  5FLX E;  1YJN T;  1MHN A;  2LDM A;  2WAC A;  3OB9 A;  4BB7 A;  5LJ5 g;  3JCM J;  4OB1 B;  5FU6 C;  3LGF A;  2EQJ A;  2KSS A;  1LJO A;  4N0A C;  2RHI A;  3JCM e;  3KUF A;  2DTH A;  1VQK T;  3JB9 D;  4F7U A;  1AHJ B;  1KG1 A;  4D6W A;  4PKC C;  4ATO A;  4QVC A;  4NL3 A;  5CQX A;  2MWO A;  4A4F A;  2XG8 D;  3X26 B;  2YLC A;  2EFI A;  2LCL A;  3SB2 A;  5FRO A;  2VXE A;  2ZGW A;  1PSF A;  5CKD A;  5FRM A;  1NJI U;  2F5T X;  3VYG A;  3CCS A;  1V29 B;  2M9U A;  3DLM A;  3OMC A;  1N27 A;  3CBM A;  1BI1 A;  3CC7 A;  1VQM A;  3CCR A;  2K5L A;  2HD0 A;  2MF2 A;  5GAN 7;  3S3N A;  2X4W A;  2PUO B;  4RG2 A;  5HY6 A;  1BI2 A;  5GMK i;  1O9S A;  2P0K A;  3UDC A;  2L3R A;  4X34 A;  2GQV A;  4B9X A;  1VQ4 T;  3M4Y A;  3LWH A;  1VQO T;  1JJ2 S;  2O4X A;  4M7D A;  2JTF A;  3PFS A;  4KBM B;  5GAN 5;  1SSF A;  5GAN h;  1S72 T;  4ZGJ B;  3G4S T;  1YIT T;  4EMK A;  3JB9 I;  4XK8 E;  2QTX A;  1B34 A;  4RCB A;  5GAN 3;  4M75 B;  3CPW A;  4E7K A;  1JB0 E;  2XU8 A;  1VQL T;  3CCU A;  4EPC A;  3P8D A;  1M1K C;  2IG0 A;  3O8V A;  1RI0 A;  1M5Q 1;  1I4K 1;  3BW1 A;  3GP8 A;  1BKB A;  2DXC A;  2YRV A;  1O75 A;  4KUL A;  4XTZ A;  4A4K A;  4N4G A;  1YHQ T;  2DKG A;  5IT9 E;  3V7S A;  3TU4 K;  5LJ3 g;  3SDZ A;  3JB9 J;  3OW2 S;  2CZ7 B;  3J7A F;  2QA4 T;  2L89 A;  2ZPF B;  3G71 A;  3EFS A;  3CD6 T;  2PVO B;  3JCM V;  3PTA A;  4BDZ A;  3PGG A;  5CKE A;  3BFM A;  5GAO l;  3OBW A;  1Q81 C;  2OTJ T;  2E6Z A;  2R5A A;  4J6Y A;  1HXD A;  2XDP A;  1Y7X A;  4C8Q A;  2HAX A;  4HCB A;  3J80 E;  3AHU A;  3M59 A;  2RB6 A;  2VV5 A;  1QW1 A;  4XU1 A;  4RKU E;  4XU2 A;  5GAM g;  1ZQ1 A;  3PT9 A;  4Y91 A;  1FXX A;  1I8F A;  2JZ2 A;  1R8O B;  4J6W A;  4C0D B;  4IUR A;  3URG A;  3OYL A;  1JJ2 A;  3JCM b;  1YJ9 A;  1BI0 A;  3LX7 A;  2RHY A;  3CME A;  1W2B S;  1M9S A;  1FWZ A;  2E5Q A;  1Q82 C;  2K5I A;  2WSF E;  5KCH A;  3MO8 A;  5A2Q E;  4M7A F;  1WQW A;  3RIR A;  2QQB A;  4PLI A;  2GF7 A;  2HBP A;  4BI3 A;  2QEX T;  4PNO A;  3SWN B;  1U8R A;  2XK0 A;  4C92 A;  3RMQ A;  3OY9 A;  4BE1 A;  2O4X B;  3CMA A;  3M4G A;  4IKF A;  4PL6 A;  4LDU A;  2KMT A;  3H6Z A;  1K9M U;  1EIF A;  2ZPE B;  4XTU A;  2DVE A;  3FRN A;  4FSX A;  3L42 A;  3N5B B;  1B34 B;  4M77 A;  4C0D C;  5GAN 8;  2RHU A;  3OW2 A;  1KD1 C;  2E64 A;  3JCM f;  1VQ7 T;  4M7A E;  3FJP A;  4C5H A;  3ASK A;  3QBY A;  3VJP A;  3JCM d;  2DJZ A;  3V8L A;  3C94 A;  3E19 A;  3OSV A;  3PMI A;  2LQK A;  4M7A C;  2A7Y A;  5DLQ E;  3OYM A;  4A53 A;  5GMK l;  3HP9 A;  3ZBD A;  2K57 A;  1M1F A;  2JNG A;  5FRN A;  2LCC A;  4XU3 A;  2VGN A;  3SWN C;  3JAM E;  2RI3 A;  2Y90 A;  3TEE A;  3I55 T;  1N8R C;  4M7A G;  3RUX A;  3Q1J A;  4BUG A;  3OYB A;  2D0Q B;  3CCV A;  1NZ9 A;  4N4I A;  2KK4 A;  2E6N A;  2QQA A;  1XTD A;  2M0O A;  3FDR A;  4E7H A;  1UEB A;  2LQ8 A;  3QYH B;  5LJ5 h;  4EDU A;  4C5E A;  4IUT A;  5J26 A;  1WNL A;  2EJ9 A;  2LTO A;  1OZ3 A;  4C8Q B;  4OF1 A;  3V8K A;  2GFU A;  2LC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...