2RI5A

Crystal structure of the 3-mbt repeats from human l3mbtl1 with n358a point mutation
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
314
structure length
312
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMAPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 74
structure length 312
sequence length 314
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri5A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri5A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri5A03
4E7KA 3H8ZA 2RHUA 2DIQA 3OYDA 3OYGA 4QVZA 4CRIA 3OYCA 2CKKA 3GOXA 1WJRA 3CEYA 3OQ5A 2IG0A 3OYHA 5J26A 3OYJA 4BD3A 2BUDA 2F5KA 5D6WA 3P8HA 4QQDA 4IUPA 2O4XB 4ZTFA 3L2RA 3S3NA 2LRQA 2M16A 2NLUA 4ZTJA 4BE0A 2RHYA 4A4HA 2RO0A 4IUQA 3OMCA 1WGSA 2RI2A 5M9OA 3LX7A 2DAQA 2BIVA 2EKOA 3PMTA 3L2UA 2FHDA 4QQ6A 5KE2A 2M0OA 3OYMA 3PMIA 4IUVA 1KHCA 2G3RA 3MO8A 3QKJA 2L8DA 3OYIA 3LYIA 3F70A 4RG2A 4C5IA 2X4WA 2JTFA 3C4SA 3QBYA 4BE2A 2O4XA 4EDUA 2LTOA 4E7IA 3KUFA 2L3RA 2RI5A 3MEWA 3P8DA 4N4GA 4Q5WA 3OYLA 2RI3A 2MWOA 1N27A 1G5VA 1RI0A 3ZEHA 3L2QA 3ASKA 2LDMA 3MEVA 3FC3A 4BDYA 3OS0A 3OMGA 3UWNA 2P0KA 5IAYA 2EQKA 3OY9A 4E7LA 2RJFA 3SD4A 5C0MA 1MHNA 2K3XA 2YRVA 2LCCA 4LD6A 4B9XA 5KCOA 3META 4IUUA 5KH6A 2R5AA 3FDRA 3LH0A 2D9TA 3NTIA 3LLRA 2R5MA 3S6WA 5CIUA 4Z02A 3M9QA 4PL6A 2EFIA 2MWPA 2RJCA 4FL6A 3LGLA 2GF7A 5IN1A 3OYAA 3QJ6A 5KCHA 4IKFA 3DB3A 2LVMA 4UC4A 2EQUA 1OZ2A 1H3ZA 4QW2A 1OYXA 2JZ2A 2R57A 4IURA 2GFUA 3OYFA 3E9GA 3MP6A 2RHZA 1SSFA 2BKDN 2R58A 3EAEA 2E6NA 4GY5A 1OI1A 2RJDA 4A4EA 3FEOA 5KE3A 3OA6A 5FRMA 2RHXA 3MP1A 3LGFA 4BDZA 3FLGA 4N4HA 2K3YA 3OS1A 3QIIA 1OZ3A 3L2WA 2RHIA 4QQGA 4A4GA 3OYEA 3DLMA 4BE1A 4E7HA 3BDLA 4C5HA 1XNIA 3PNWC 3MEAA 3OYKA 3S3OA 2M1HA 2RJEA 3L42A 4B9WA 4E7JA 4N4IA 5D6YA 2QQRA 3OYBA 2X4XA 3UT1A 2GFAA 2XK0A 5J39A 2DIGA 4PLIA 4FU6A 4IUTA 4II1A 4X34A 3OYNA 4NS5A 3DB4A 2PQWA 3L2VA 4OVAA 3MEUA 3Q1JA 4BACA 2WACA 2B8AA 3OB9A 2EQMA 4A4FA 1WJSA 2HQXA 4HCZA 2L89A 5C6SA 2HQEA 3NTHA 4L59A 2E5QA 2XDPA 4C5GA 3O8VA 3ME9A 5D6XA 3H6ZA 3MP8A 2X35A 2EQJA 4C5EA 5FROA 4PLLA 2X4YA 2VYTA 3NTKA 3S3MA 3PFSA 1WJQA 2QQSA 3E9FA 3OS2A 5FRNA
chains in the Genus database with same CATH superfamily
1JXMA 2PVOB 4RTWA 1VYTA 4ZGEB 3VRYA 4OB2B 5FU7C 1NM7A 4EMKB 4OMOA 5FU7B 1BI1A 3E19A 5CKFA 4E2FB 5KE2A 1NJIC 2JM9A 5ECAA 4KT0E 2DRMA 1UG1A 3NGPA 3C4SA 3QBYA 5LJ3g 3QXEB 1YJNQ 2DTHA 4V2SA 1LNXA 1QVFA 4KULA 2A28A 3KBGA 2LDMA 3CPWA 4J9HA 3T9NA 2V8IA 4LD6A 2LCCA 4IUUA 1QVGP 3JB9J 1Q7YC 1MMDA 3GLXA 1VQPT 4Z02A 1VYUA 4F7UA 2EFIA 3QHSA 1UGVA 3QJ6A 5KCHA 2AIRB 5FU6B 1FMKA 1EFNA 5C0MA 1GRIA 2BKDN 2CH4W 2JTEA 3OSSC 3PIOA 1K73R 1I4K1 4J9IA 1QVGA 2OTLQ 2A37A 3RIRA 4C5HA 1KIKA 3PVLA 2JTMA 3H41A 4GBQA 3VUBA 4JJCA 4D6WA 5GAMd 3CCRT 4C92F 1VA7A 1X69A 4CC3A 2KNBB 1KQ1A 3GBQA 4RTXA 3OYNA 5LJ3f 1I1JA 5EC7A 3L2VA 3NFCA 5KYNA 1S72T 1KJWA 2I0NA 2K2MA 2DXCA 1XQHA 2JN0A 4ESRA 4M78D 1MMNA 2X4YA 5LJ5f 3A8GB 3OBWA 3X28B 2QASA 3OS2A 2EPDA 1FYNA 1AWWA 1UGSB 4HT8A 1SEMA 4M7AF 2O31A 4RTYA 3P8HA 1N9SA 3CCMA 1OQKA 2NLUA 5GAN5 1NJIU 1M9SA 4BI3A 3ZFJA 3WXMB 1OPLA 2KRSA 4OGCA 4OGEA 1Q95G 3JCMX 4M7DG 5GJWB 4XTYA 1OPKA 3RMSA 3DLLA 4ME7A 3JCMV 1PM3A 1VQMA 2C0OA 2BE9B 2NUPB 4WF2A 1VQ5Q 3X26B 1KSWA 3G6EA 3G6EQ 4XK8E 4NOYA 2PZ1A 3OS5A 1HD3A 2B86A 1Q7YU 2HBWA 2J06A 4Z8AA 2QEXQ 1AZGB 2FZCB 5CKHA 3G71A 2DL7A 4NL2A 4C8QA 1AVZC 4DEXA 4M77E 3CCVQ 4K11A 3OYAA 2G6FX 2LNHB 1IGQA 2PTKA 4OMQA 2LVMA 3AHUA 2DVEA 1OYXA 2E6NA 2EGEA 3HTRA 3OA6A 3CPWS 1O9SA 3OS1A 3A8HB 2ZPGB 1KQSS 4J83A 2ZCFB 2F2VA 3OYKA 3S3OA 1WFWA 2RJEA 1AT1B 1SKUB 2E70A 3L2ZA 2HCKA 3I55A 4M7DF 3LWHA 1O75A 2KXDA 3LW5E 2A3LA 1NPPA 4PLIA 1M1KC 1V76A 2PUOB 3EFOA 1BI0A 2LQKA 4Y91A 5GAN4 3VKIA 1WQ7A 2HKNA 3ULRB 3OB9A 3EGDA 1CKBA 1H8KA 1G3TA 2GTOA 2LCSA 2V26A 1U8RA 1I5LA 4PJLA 2K7AA 1FMVA 4XU3A 1KG1A 5FRNA 4MZPA 1JB0E 4LN2A 3NPFA 2YUOA 5GANh 1QP2A 2RK2A 3OYCA 4E7ZA 2KMTA 3G71Q 4HA8A 2J6FA 4BD3A 2F5KA 4RTVA 1N8RU 3CCVA 3L2RA 2CT3A 1KC8C 4JJBA 1KFZA 2CZ0B 1RAAB 1VQ5T 1IGUA 1BCMA 2CP5A 3M0QA 3SB2A 5GANf 2MPXC 1BCOA 3M4GA 1YITT 1OU9A 4ZN1A 5GAN3 2O4XA 3L1AA 4E7IA 3KUFA 2RI5A 2L5QA 3VRZA 4C0DC 3LH5A 3A5ZB 3OS0A 3R6NA 3CCJA 2J6OA 5IAYA 2FVUA 4M7DE 5LJ3j 4JLGA 2HD0A 3JRZA 4D8DA 9ATCB 3CD6Q 1JJ2S 3WVDB 1G8XA 2ZZDA 3I35A 2RF0A 2DYIA 1TH7A 2DL4A 2XU8A 1UB4A 3QZ9B 4QW2A 2M51A 4KRTA 1HK9A 5FRMA 4HCCA 2LJ1A 3QG1A 1QP3A 4JUVA 3CC7A 1M1KU 3TSZA 1JJ2P 4O6JA 3GNFB 3RKXA 1K8AC 3EFSA 1KC8R 3CCJQ 2P0QA 1H92A 1K73C 5A0DA 4OVAA 1HXDA 3JCMh 2WACA 2B8AA 3PE0A 1PNJA 1BI2A 2L89A 4M78B 1T0HA 4WCIA 3ZL7C 3RERA 3BY7A 2P4RA 2V1QA 2DVJA 1D3BA 2OJ2A 8ATCB 4FSSA 5HKCA 2NUZA 2CKKA 1PHTA 1WX6A 1YCYA 2OTJT 5GANd 4OMFB 3GP8A 1AEYA 4QQDA 3VV0A 2F2WA 2DPPB 3SEMA 1D3BB 2RI2A 5LJ3d 4F14A 1VQMT 5GAOn 4M75G 2OTJA 1K9MR 3OYMA 4FM4B 3PMIA 4J6YA 3TCJA 3QKJA 2D0NA 3CXCA 3MKDA 1WHHA 1JU5C 2ROLA 3EG0A 4PK4A 2DERA 1OX9A 2YWWA 3HP9A 1KD1R 4PJJA 2NUPA 3L2QA 3MEVA 2WSCE 4E7LA 2KBTA 4IIOA 4CC2A 1VQ6Q 3CBMA 2M0YA 4M78C 2M9UA 2EYXA 3HRUA 4C8QB 2DM1A 2GF7A 2YXYA 1LCKA 1VQ9T 1RAFB 4IKFA 2V8JA 2CDTA 3CBOA 4L5GA 2GFUA 3G4SQ 3CPWP 3EG9B 4C92E 2ATCB 4J8OA 1N8RC 4M75A 3CCUA 1U5SA 4X1VA 1M4ZA 2PUKB 2JMCA 3QZ5B 2EGAA 1X6GA 1AWXA 1K73U 3J81E 2EBPA 4JS4A 4D8KA 4II1A 1E6GA 3JB9F 4LXCA 1AOJA 4IIMA 2RN8A 3Q1JA 2FL7A 3JB9I 3JCMJ 1H3HA 4QKUA 3CC4Q 3M0SA 2HQEA 3NTHA 1QQJA 3JCMf 2IIMA 2YDLA 1ZBXA 3ME9A 4MMKA 1S72A 4ORZA 4FYXB 3PFSA 3RKWA 1D1BA 2EYYA 4XU2A 1WJQA 4LDXA 2RK1A 1YN8A 7AT1B 1NZ9A 4EMHA 1VQ7T 3C0CA 1XOVA 4DA4A 3G1JA 1P92A 4M75E 4RMOA 1JBMA 1BK2A 1YHQT 2FHDA 2E64A 2F69A 2L8DA 4J9BA 3H9NA 1JQQA 1UUEA 2DJZA 2YRCA 4OMLA 2FB7A 2QA4T 2JUFA 1VQ7Q 3I9QA 2W0ZA 2FEIA 2DD4A 2F5TX 2SEMA 2VGMA 2CP2A 3BE3A 3FB9A 3OYYA 4ANJA 4F17A 2K5LA 2DD5A 1YWPA 4HKEA 5KYUA 4FL6A 1BIBA 4JZ3A 1M1FA 1R77A 4OB0B 1W70A 2J05A 3NMZC 3FEOA 2LZ6B 3LGFA 1H641 4JJNK 4PFOA 1VQ4A 4PJOD 3V8KA 1YJNT 2O2OA 2DXBA 2QDYB 1QLYA 2LT4A 2AK5A 5D6YA 3I56A 4C0GA 4WTOB 2HQXA 1VQLQ 4C92B 1T0JA 1PSEA 1OV3A 1UECA 1M3BA 5D6XA 2LJ0A 5CKBA 4F7UB 2QA4A 3EG3A 3EH2A 3MP1A 4E7KA 1VQLT 1VQKQ 1M2OA 1KQ2A 1KQSA 1WLPB 2L0AA 4A4KA 4F7UE 4OP0A 1K9MU 2XIDA 1I81A 2LRQA 5A2QE 2RD1A 3JCMQ 1NEBA 3NHNA 4HVUA 2HNIA 2CP7A 2BE7D 4J9FA 3HRSA 1MGQA 3M56A 5CAIA 2X4WA 4AG1C 1Q7YR 4RCCA 2O88A 4N0AC 1ZQ1A 2AT1B 4VUBA 3UDCA 4N4GA 2KSSA 3I55Q 1ZUKA 3ZEHA 1M27C 1QCNA 2X4JA 1SRMA 5GAN6 3OY9A 4M77B 5DY9A 4PJMA 5GAN8 1X2KA 4KGVB 3PTAA 3UATA 4ZGDB 1X6BA 3DB3A 4J7FA 5GMKh 2LQNA 2H3JA 3CMEQ 2P84A 1UHCA 2QA4Q 3EAEA 4ZGJB 1X6OA 3GNGA 4KGZB 4C8QG 2M1HA 5A0GA 4E7JA 1YHQQ 5CR2A 2Y4XA 4N4IA 5LJ3e 3HFNA 2YRDA 2GNCA 3GPLA 2NYSA 4OMPA 1LPLA 1IHVA 1GL5A 5GAOq 1SPKA 5GMKj 1UJYA 2HQHA 4RG8A 1VQ9A 3P8BB 2JJ9A 4HCZA 5GJVB 5IHIA 1KD1C 1UE9A 2QG9B 4J6XA 2DEUA 2NUTB 5KYYB 1U3OA 2WSEE 4PKCC 1GCQA 2X3XD 4KH0B 3CCUT 2MIOA 4N4HA 3JB9G 2J7IA 4BY6B 1K9MC 1LJOA 4FIBA 1XJWB 1YHQA 1WXUA 2O4XB 4ZTFA 4JRQA 4M7DC 1Y96B 2M16A 4ZTJA 3E1SA 3CQTA 4CC4B 4XU1A 1Q86C 1QKWA 3V7SA 1NPRA 3EG1A 2XKOC 2BZYA 5LL6S 1YJ9A 3CMAQ 4M4ZA 3QWYA 1M8VA 2COWA 4DBQA 1CSKA 1ZUUA 2ZPHB 1IB8A 4LDYA 3ZBDA 3LYIA 3F70A 4CC7A 1GFCA 5J3BA 1QMCA 3C95A 4XAXB 3G71T 3M55A 5A0LA 3GF5A 4ZNXA 4EMGA 2QYZA 2KYMA 2RQUA 1NBEB 3RESA 1BI3A 3VS2A 3JCMW 2P0KA 2O01E 3JB9D 2YRVA 4J9CA 3RKYA 3M53A 3SWNC 3HRTA 2R5MA 1BKBA 2RQWA 1PKTA 4AFQC 2LX9A 2K5IA 5IN1A 1W2BA 4F04B 3MP6A 2HBPA 2HAXA 4GY5A 3X24B 4MZMA 1UGRB 2CREA 2VKNA 2QTXA 1D1AA 3EGXA 2MK5A 1AD5A 3URGA 2FYKA 4X9DA 1G83A 4ELYC 1Y7XA 2QQRA 4XTUA 4DBRA 4P5NA 4FU6A 4IUTA 1ZA1B 2JS2A 1Y71A 2OTJQ 4A4FA 2DX1A 2YLCA 1LOJA 1YIJQ 5GMKi 3O8VA 1YIJA 2P4TA 2YT6A 3CPFA 5I2SA 2ZPBB 2VYTA 1M1KR 2LT1A 3OYDA 2RHUA 2MAMA 1SF9A 4JRPA 5LJ5g 1ARKA 1G3WA 4OF1A 5J26A 4RTTA 4MZTA 5AYFA 2ENMA 2GQIA 2LMJA 4NL3A 2EJGA 4PFZA 2HDAA 2RHYA 1WGSA 5M9OA 2RQVA 3PIPA 5KYXB 4J9GA 2QGGA 2G3RA 3OYIA 3HHTB 1UTIA 1OULA 2XHCA 4Z88A 2JOYA 2OX7A 3JAME 4C92D 4M78A 1RI9A 2RI3A 3X20B 4XTVA 1MNEA 2VXFA 4PJOA 1NYFA 3A8MB 3CD6T 2E65A 1X01A 3UF4A 5KYYA 3FJPA 4BUGA 2JT4A 2ABLA 2ROTA 5IXFA 3I5SA 1W6XA 1OZ2A 3CXCP 1YI2A 2HSEB 2MYSA 1GXIE 2CS7A 2RJDA 4EMKC 3UA7A 4Z89A 1GCQC 2FO0A 4QQGA 3QSUA 3BDLA 1WI7A 1W4SA 1ZUYA 3DKMA 5CQXA 1W2BS 4JRKA 4XTXA 4M7AA 2HL3A 2XDDA 1C6VX 4DOWA 2D0QB 1J3TA 3M59A 5GANg 4M7DA 3CCLQ 3VS3A 5L8RE 2X9HA 1SHGA 4C5GA 2GQVA 5KYWB 1VQPQ 1NE8A 4KBMB 2HL5C 2K5FA 1PKSA 1ZSZB 2ZPEB 2ZPFB 3PT9A 4EPCA 2DTIA 4QVZA 2DL8A 1QVFP 1ZBJA 3OQ5A 1EX4A 3C94A 4JDSA 1OX8A 1M3CA 2K6DA 2VUBA 3UA6A 1R0CB 5CQYA 4M75F 2EKOA 4M7AG 2K57A 3OW2P 4FYWB 2HSPA 2K4YA 3I5RA 1VQMQ 1VQ5A 4AT1B 1VQ8Q 1YJNA 3OBYA 4Q5WA 1B34A 2PVGB 1Q86R 1GCPA 2VWFA 1K0XA 3CCEQ 4RTZA 2KQWA 1GFDA 4M75C 2EGCA 2ZAEA 5FW9A 1V29B 2D9TA 1WHMA 2YUNA 4M7DD 1XTDA 2QQAA 2RJCA 2E10A 3CCLT 1PD1A 2RMOA 4RUGA 3E9GA 2DLPA 1WHGA 3EHQA 4M7AD 2K2VA 4M77G 4HT9A 1B3QA 4MDXA 4DEYA 1TOVA 1TTHB 5DLQE 4JZ4A 1I0CA 2HZYA 1XNIA 1X27A 3M57A 4TVRA 1VQNQ 3CCJT 2VV5A 2CSQA 5I21A 1V1CA 5GMKe 2AKLA 2M02A 1Y96A 1RACB 2K9GA 3MEUA 1QVFS 3JCMe 2GGRA 1TS9A 2EJFA 3TEEA 1VQLA 2XDPA 1M30A 1Y57A 2E3IA 4BI8B 4C0ZA 4HXJA 4C5EA 4C92C 3TREA 1VQ8A 5LJ3h 3M58A 4C8QC 1VQ4T 1RAEB 4M77D 2O9SA 3VYHB 2FPFA 1NEGA 1VIEA 2MI6A 3RBBB 2KXCA 1EIFA 4M77A 2IG0A 4F7UF 5I11A 2QQBA 3INZA 1K76A 3S3NA 4BE0A 4A4HA 3V7CA 3CC2A 4KH1B 3PMTA 2DK3A 1IO6A 1VQNT 2QXFA 1CKAA 2CYZB 4C0FA 2DBMA 2DJQA 2DETA 5CKDA 2CT4A 1MNDA 3RUXA 3EGDB 4JLIA 1PWTA 3MEWA 1QKXA 4M78G 5GANj 2J6KA 4BDYA 3FC3A 1TWBA 1WHKA 1ZSZC 1Z9QA 3META 2R5AA 1Q82R 2A36A 2Z0WA 3LLRA 3MHXA 3VS7A 1RAHB 1VQ8T 3X25B 2A08A 2D1XA 1RAIB 3FLGA 1KK7A 3UPUA 1D0ZA 1M8MA 4EIKA 1PCXA 2KRMA 2BZXA 2EAYA 4B9WA 3QDRB 1WYXA 1MV3A 2X4XA 1UFFA 1PSFA 5GMKl 1KHIA 5GMKm 1E6HA 2K3BA 3DB4A 4QVCA 2JVVA 1SG5A 3HL8A 4LE9A 2DNUA 1U06A 1JO8A 2MOXA 1AHJB 4MMLA 2EVRA 3CCQQ 3MJXA 1ABOA 1ZLMA 3CCVT 2XK0A 4M78E 1JJ2A 3OYGA 2XMFA 1NJIR 2RNAA 1M3AA 3OYJA 1FMWA 4XTWA 3JV3A 1G3YA 1PG5B 3RR6A 6AT1B 4RKUE 2DYBA 2DKGA 2RH2A 1X43A 3WVEB 3JCMg 2DAQA 4PJOF 3CMAA 2LQ8A 5GAMg 2ECZA 1M5Q1 1WXBA 1A0NB 2L3RA 1HSQA 3SWNA 1FXXA 3OW2A 1BIAA 4DBFA 3ASKA 4J6WA 2EQKA 3SD4A 3EGUA 2QGFB 3QJYA 3SFMA 2WSFE 2YHTA 3S6WA 3CD6A 1BB9A 2ESWA 4BI4A 4PNOA 1VOMA 2R57A 2QDLA 4IURA 5GAN7 3OYFA 1IREB 1YFNA 1Q81R 2DMOA 2DZ9A 4E7HA 4J7IA 2IVWA 1NLOC 2E12A 3L42A 1YJWA 4LUDA 3SDZA 3E2UA 2CP6A 5KYUB 3BFMA 4PJNA 2DIGA 4OB3B 4OMNA 4FSXA 2OTLT 3CMET 2L3SA 2JNGA 3KFVA 3EG9A 4LNPA 1YWOA 4C0DB 1VQPA 3MP8A 2BTTA 4PLLA 3J80E 2L3QA 3NTKA 4C8QE 3JCMc 2QQSA 2E6ZA 3H0FA 1D0YA 2DXUA 3JSCA 4OMMA 3TU4K 3CCQT 3GOXA 3OYHA 4M7AE 4AFZC 4IUPA 3CCET 2XI9A 2CZ6B 3FJ5A 2CUBA 3OMCA 4XTZA 1YI2Q 1TSFA 2KGTA 3LX7A 2RB6A 1N6AA 1NYGA 3TQ7P 1RAGB 2VC8A 2KY9A 1UJ0A 2KRNA 2M0OA 1IXDA 1M2VB 4QVDA 3JCMP 3M0UA 4RG2A 1WZOA 4RTUA 2ZGWA 4N0AA 1I5OB 5D7UA 1I07A 1R8OB 2JW4A 2LCLA 4JS5A 2H8HA 4FT2A 4ZN3A 2W10A 2C06A 3UWNA 3M0PA 4M7AB 1WPYA 2KR3A 5KH6A 2RQTA 3FDRA 1C1AA 2YLBA 4BY6C 1QWFA 1VQOA 5GAOl 4LDWA 2XD0A 3QYHB 2EKHA 2A7YA 2JMAA 3A98A 3REAB 4PJOG 1VUBA 2QEXT 3G4SA 4J9DA 3CC2T 3EFOB 2RHXA 3ER0A 1OU8A 2XDBA 2K3YA 3QIIA 2GTJA 2F2XA 2OAUA 4AFUC 3G6ET 4BE1A 2E4HA 1RLQC 2CGHA 3GIBA 4GLKA 5GAMj 1IRXA 4EMKA 3CCEA 1K8AR 1AZEA 4PJOC 5LJ5d 3MPUB 2LNVA 3HKSA 1RL2A 2DRKA 2PQWA 3M5AA 1C0MA 2JXBA 3CC7T 2KI7A 4KUDK 1JEGA 3CCST 4C92A 2DL3A 1VQOQ 5GAMf 2QI2A 5C6SA 1U1TA 2X35A 5FROA 1E7OA 3C12A 1VQ7A 4QT7A 4DBHA 4OB1B 2KT8A 4M77C 3REBB 4MDWA 3VS0A 5L23A 1VQ4Q 4FYYB 4CRIA 3U23A 1G2BA 5HK3A 4RCBA 2D8JA 5EG2A 4M7DB 1GBQA 3QUIA 2C0TA 3PGGA 1VYVA 4IUQA 1TUCA 2ED1A 2KROA 5LJ5h 2RQRA 3CCLA 3MO8A 4XQ3A 1NLPC 2EIFA 2CZ7B 1QWEA 3CCRA 3CCRQ 4E47A 1K9AA 4GLMA 1VQNA 2KK4A 1YJ9T 3AT1B 2X3WD 1BU1A 1SHFA 1IZ6A 1N8RR 3I56Q 4AMCA 3OMGA 5CCAA 2LC4A 5IHKA 4B9XA 5GAMe 1OOTA 3M9QA 2MWPA 1M90R 3TSWA 1JXOA 3QYGB 4UC4A 2MF2A 2BZ8A 3QO3A 3CCSQ 1UGPB 5GAOr 1YIJT 1SSFA 2KT1A 1K0SA 2DBKA 2H3EB 1M90U 4BDZA 1OEBA 5AT1B 5IT9E 2SRCA 1X2QA 1B7TA 2GBQA 4ATOA 2PU9B 5DM7R 3MEAA 2K79A 1M2VA 3OYBA 2COZA 2ZPIB 1QVPA 1RADB 2EYZA 3EFRA 2NWMA 3CBPA 4X34A 3CCMT 3CC2Q 2D6FA 3TVTA 2QAZA 5FLXE 4JJDA 3G7ZA 2XG8D 1B07A 4DOVA 1Y07A 3J7AF 2GCXA 4M7AC 3M4YA 2DO3A 4HCKA 1VQ9Q 1KC8U 3H6ZA 2EQJA 3VS6A 5IHNA 3IQLA 3CCSA 1RLPC 1VQ6T 2AKKA 2X51A 1N9RA 1G5VA 1F1BB 1FX7A 2KE9A 1S1NA 2O9VA 2KDSA 3QPHA 5HY6A 4PJOE 2EYWA 3JCMd 3CEYA 1ZX6A 3D7SB 8AT1B 1DJ7B 2YUPA 3LWIA 3CCMQ 1WHLA 2C0IA 4CI0C 2DFUA 2BIVA 2LQWA 1ABQA 2OAWA 2FPDA 1YI2T 2DZCA 4IUVA 4M78F 4HCBA 1MV0B 4LDVA 2OTLA 3CMAT 4EDUA 2CZ1B 4E7SA 3OSVA 4AFSC 3R6OA 3HPWA 3RNJA 2MWOA 1Q82U 4FCYA 3M0RA 4FT4A 2HKQB 2EJ9A 3BW1A 2CP0A 2RJFA 2K3XA 2QEXA 1AWOA 3N5BB 2QK0A 3NTIA 2L3PA 3VUZA 2DF6A 1RUWA 1K8AU 1TUGB 3VS5A 4O5VA 3RDVA 3KXTA 1TXQA 2CUDA 1YJ9Q 2RHZA 1KD1U 2CP3A 3V8LA 2YUQA 1VQKA 2JM8A 3L2WA 2RHIA 4A4GA 3OYEA 1MUZA 1Z9ZA 3PNWC 1UEBA 2I2LA 1YJWQ 2VVKA 4PFPA 5IXBA 2GFAA 2L2PA 1YJWT 1EZZB 4DQ2A 5LJ5j 5KYWA 2DXTA 1B34B 4M75B 4C92G 2A0FB 3EG2A 2DTOA 1Y0MA 5LJ5e 2EQIA 3O5ZA 2AZSA 2DE0X 4L59A 1TG0A 5DLOA 2DEQA 3CMEA 2KAFA 4AG2C 1YBYA 1G3SA 3JB9H 4A53A 3H0IA 4X9CA 3H8ZA 2DIQA 3CC4T 3FIFA 1QCOA 2D8HA 1QVGS 2EYQA 3VS4A 2BUDA 3CC7Q 1AWJA 1Q81U 1X75C 1M90C 2RO0A 3I55T 2KVQG 1ZSGA 4R56A 2HMAA 2PNIA 4QQ6A 3OW2S 1ZSZA 3EHRA 2PVDB 5CK9A 1KHCA 2VB6A 1D09B 5FWBA 5CVIA 1NG2A 1PC0A 1Q82C 2E41A 4HVVA 1I8FA 2HEQA 1D1CA 2LTOA 1IHWA 3EGXB 4LD9K 4HVWA 4R55A 1MMAA 4PJOB 4A54A 2LJ3A 1FWZA 1T3SA 3MCAB 1RABB 1MHNA 2VXEA 2ED0A 1Q86U 5CKEA 4LUEA 3THKA 4F7UG 5FU6C 1T3LA 4PL6A 3HSBA 3EH1A 2IPOB 4Y28E 2EQUA 4J9EA 1D0XA 2F1LA 1H3ZA 1ZA2B 2JZ2A 4YTLA 1ACMB 5GAOp 3VS1A 4A4EA 3RMQA 1N5ZA 5KE3A 1MMGA 3SHWA 2FZGB 1YITA 3M54A 1WHJA 3M0TA 1OZ3A 1TU0B 1PRLC 2NUTA 2CH4A 3UT1A 1WA7A 5J39A 2EWNA 2V8KA 5GANe 1UGQB 2VGNA 4BACA 2CSIA 2EQMA 1WJSA 3A8OB 5HK0A 2MCNA 1UHFA 2MMPA 1R0BG 1TUDA 3CCQA 1UDLA 5KYXA 1W1FA 1QCFA 3S3MA 2KEAA 3QWXX 5IH2A 1M1GA 2E3HA 4ELZC 3CCUQ 5GAOm 2AHJB 1WJRA 2E5KA 1YP5A 2FRWA 2LP5A 5D6WA 3I56T 2FPEA 1SSHA 1BYMA 1WXTA 4FW2A 3FRNA 1QW1A 1WNLA 3L2UA 2QQ9A 2V1RA 1ZHIA 1KQSP 1VIFA 4J5YA 3A1PA 5I2MA 4C5IA 1WDXA 4E6RA 2JTFA 4BE2A 4FYVB 3P8DA 3OYLA 1N27A 4C8QF 1RI0A 2DL5A 4L6V5 2COYA 3VYGA 4JRIA 2FG0A 3CXCS 3BDUA 2RM4A 1VQ6A 5HCKA 2P0PA 1LVKA 2AZVA 4JPBW 5KCOA 1YCSB 1SRLA 3H0HA 3LH0A 3VU3C 5CO7A 2RA2A 4R0KA 4C8QD 1JRIA 5CIUA 2OI3A 3LGLA 3V8JA 5FWCA 4M75D 2VASA 2KYBA 5GAN2 3HFOA 1S72Q 1WQWA 4XU0A 2JS0A 2RPNA 2FRYA 2LX7A 4BB7A 2R58A 1OI1A 1YNZA 4FW1A 1YITQ 3PVQA 1VQOT 2E1HA 1Q81C 3VJPA 4Y92A 5GAMh 3DLMA 2Y90A 2QTVA 1HYOA 1PRMC 2EW3A 2YSQA 1K1ZA 4M77F 4NS5A 2Y4YA 4LDUA 4KUIA 2DILA 2DA9A 3QDFA 4KGXB 2FZKB 3CC4A 1GBRA 3G4ST 3SWNB 2E5QA 2XICA 1PD0A 1W2BP 3A8LB 1WIEA 3JCMb 4A63B 5I22A 1U1SA 1K4US 4B6MA 1BBZA 4F16A 3V7RA 1VQKT 1HJDA 3E9FA
chains in the Genus database with same CATH topology
2DTIA 1NZ9A 4QVZA 4CRIA 5HK3A 4RCBA 5EG2A 4EMHA 4M7DB 2PVOB 1VQ7T 3OQ5A 3C94A 4JDSA 3QUIA 4ZGEB 1XOVA 4OB2B 2VUBA 3PGGA 5FU7C 4DA4A 1P92A 4M75E 4IUQA 4EMKB 4RMOA 5CQYA 5FU7B 4M75F 1JBMA 1BI1A 2EKOA 3E19A 5CKFA 5LJ5h 2FHDA 5KE2A 1YHQT 4M7AG 1NJIC 2K57A 3CCLA 2E64A 3MO8A 4XQ3A 2F69A 2L8DA 4KT0E 2EIFA 2CZ7B 3CCRA 4E47A 2K4YA 3C4SA 3QBYA 5LJ3g 1VQ5A 2DJZA 3QXEB 1VQNA 2KK4A 2FB7A 2QA4T 2JUFA 1YJNA 3OBYA 4Q5WA 1B34A 1YJ9T 2DTHA 4V2SA 2PVGB 1LNXA 1QVFA 4KULA 1IZ6A 3KBGA 2LDMA 2KQWA 3CPWA 2DD4A 2F5TX 2VGMA 3FB9A 2LC4A 3OMGA 3OYYA 4M75C 5CCAA 3T9NA 2V8IA 4LD6A 2LCCA 2K5LA 2DD5A 4B9XA 4IUUA 5GAMe 1V29B 2D9TA 3JB9J 1Q7YC 4HKEA 3GLXA 1VQPT 4Z02A 3M9QA 4F7UA 4M7DD 2EFIA 1XTDA 2MWPA 2QQAA 2RJCA 3QHSA 1BIBA 4FL6A 3QJ6A 3QYGB 5KCHA 2E10A 4UC4A 2MF2A 3CCLT 1M1FA 3QO3A 5FU6B 1UGPB 3E9GA 4OB0B 5GAOr 1YIJT 1SSFA 2BKDN 5C0MA 3OSSC 3PIOA 4M7AD 2K2VA 3FEOA 3LGFA 1I4K1 1H641 4M77G 4BDZA 1M90U 4JJNK 5IT9E 4HT9A 4MDXA 1VQ4A 4PJOD 5DLQE 1QVGA 3V8KA 1YJNT 3RIRA 2DXBA 4C5HA 2QDYB 1XNIA 4ATOA 2PU9B 5DM7R 2JTMA 2LT4A 3M57A 3MEAA 4TVRA 3VUBA 3CCJT 3CCRT 4D6WA 2VV5A 5D6YA 5GAMd 4C92F 5I21A 3OYBA 2ZPIB 1QVPA 5GMKe 3EFRA 3I56A 1KQ1A 4C0GA 3CBPA 4X34A 3OYNA 1Y96A 5LJ3f 3CCMT 2D6FA 3L2VA 3NFCA 5FLXE 3MEUA 3G7ZA 2XG8D 1S72T 3JCMe 1QVFS 4DOVA 1Y07A 2EJFA 2GCXA 2HQXA 3J7AF 3TEEA 4M7AC 3M4YA 2DO3A 1VQLA 2DXCA 1KC8U 4C92B 1XQHA 1PSEA 2XDPA 4C0ZA 4BI8B 5D6XA 2JN0A 3H6ZA 5CKBA 4C5EA 4F7UB 2EQJA 4M78D 4C92C 3CCSA 2X4YA 3TREA 5LJ5f 5LJ3h 1VQ8A 2QA4A 3M58A 4C8QC 1VQ4T 3A8GB 4M77D 1VQ6T 3VYHB 1VIEA 3OBWA 3X28B 1N9RA 1G5VA 2MI6A 3MP1A 3OS2A 4E7KA 1FX7A 1VQLT 1KQ2A 2KDSA 3QPHA 1KQSA 1UGSB 4HT8A 5HY6A 4PJOE 1EIFA 4M77A 3JCMd 4M7AF 3CEYA 4A4KA 2IG0A 4F7UF 4F7UE 1DJ7B 4OP0A 1K9MU 3P8HA 2XIDA 2QQBA 3INZA 1N9SA 3LWIA 3CCMA 1I81A 3S3NA 2LRQA 2NLUA 5A2QE 4BE0A 5GAN5 4A4HA 1NJIU 2RD1A 3V7CA 3JCMQ 4CI0C 1M9SA 4BI3A 3CC2A 3ZFJA 2BIVA 3WXMB 2DK3A 3PMTA 1VQNT 4OGCA 4OGEA 2QXFA 2HNIA 3JCMX 1YI2T 4M7DG 2CYZB 2DZCA 4IUVA 4XTYA 4C0FA 4M78F 3HRSA 4HCBA 3RMSA 1MGQA 3M56A 3DLLA 4LDVA 5CAIA 5CKDA 4ME7A 2OTLA 2X4WA 3JCMV 4RCCA 3RUXA 4EDUA 2CZ1B 1VQMA 4JLIA 4N0AC 1ZQ1A 3OSVA 4VUBA 4WF2A 3UDCA 3MEWA 3R6OA 3X26B 3HPWA 3G6EA 4N4GA 2KSSA 4M78G 2MWOA 4NOYA 4XK8E 3OS5A 1Q82U 5GANj 3CMAT 4FT4A 3ZEHA 4BDYA 3FC3A 2X4JA 2EJ9A 1Q7YU 5GAN6 3BW1A 3OY9A 4M77B 2RJFA 2K3XA 5DY9A 2QEXA 3META 5CKHA 3G71A 2R5AA 5GAN8 4NL2A 3N5BB 4C8QA 3NTIA 3LLRA 3VUZA 4M77E 3MHXA 3PTAA 1K8AU 4O5VA 3OYAA 4ZGDB 4J7FA 3DB3A 2LVMA 3KXTA 3AHUA 5GMKh 2DVEA 1OYXA 2H3JA 4XU2A 1VQ8T 3X25B 2RHZA 4LDXA 3EAEA 4ZGJB 2E6NA 1KD1U 3OA6A 1X6OA 3CPWS 3V8LA 3GNGA 1O9SA 3FLGA 4C8QG 1VQKA 3OS1A 3A8HB 2ZPGB 3L2WA 2RHIA 4A4GA 4J83A 3OYEA 3UPUA 1KQSS 3PNWC 2ZCFB 3OYKA 3S3OA 1UEBA 2M1HA 2EAYA 2RJEA 2E70A 3L2ZA 2I2LA 2Y4XA 4N4IA 4B9WA 3QDRB 5CR2A 3I55A 4M7DF 5LJ3e 3LWHA 2X4XA 1O75A 3HFNA 1PSFA 3GPLA 3LW5E 5GMKl 2GFAA 1KHIA 2A3LA 5GMKm 1NPPA 4PLIA 1M1KC 2PUOB 1YJWT 3DB4A 4DQ2A 1BI0A 2LQKA 4Y91A 2JVVA 4QVCA 3VKIA 5LJ5j 1WQ7A 5GAN4 5GAOq 2DXTA 1B34B 3HL8A 3OB9A 4M75B 5GMKj 4C92G 4RG8A 1VQ9A 3P8BB 2DTOA 5LJ5e 4HCZA 1G3TA 1KD1C 1AHJB 4L59A 4J6XA 4MMLA 2WSEE 5DLOA 2DEQA 3CMEA 1U8RA 1I5LA 2KAFA 4PKCC 1YBYA 1G3SA 3CCUT 3JB9H 4XU3A 4A53A 4X9CA 3CCVT 2XK0A 4M78E 4N4HA 1KG1A 5FRNA 3JB9G 1JJ2A 3H8ZA 2DIQA 4BY6B 4MZPA 1JB0E 3FIFA 3OYGA 3CC4T 5GANh 1K9MC 1QP2A 1QVGS 1LJOA 2EYQA 2RK2A 4FIBA 3OYCA 2KMTA 3OYJA 4HA8A 1YHQA 4BD3A 2BUDA 2F5KA 4XTWA 1G3YA 1N8RU 2O4XB 3CCVA 4JRQA 1X75C 4RKUE 1Y96B 3L2RA 5A0GA 2M16A 4ZTFA 4ZTJA 1KC8C 2DKGA 1M90C 3E1SA 2RH2A 2RO0A 3I55T 2KVQG 4XU1A 3V7SA 4R56A 1NPRA 3WVEB 2XKOC 5LL6S 1Q86C 3JCMg 2CZ0B 2DAQA 4PJOF 3CMAA 1YJ9A 1VQ5T 2LQ8A 1M8VA 4QQ6A 3OW2S 5GAMg 2PVDB 5CK9A 1M5Q1 1KHCA 2ZPHB 3SB2A 5GANf 4LDYA 3ZBDA 3LYIA 5CVIA 3F70A 3M4GA 5J3BA 1Q82C 2E41A 1YITT 5GAN3 1I8FA 4ZN1A 2O4XA 3L1AA 2LTOA 4E7IA 3KUFA 2L3RA 2RI5A 2L5QA 4LD9K 3SWNA 3C95A 4XAXB 4R55A 3G71T 1FXXA 3M55A 3OW2A 4PJOB 5A0LA 3GF5A 4A54A 1BIAA 4C0DC 4EMGA 3ASKA 3RESA 1FWZA 1BI3A 3A5ZB 3OS0A 3JCMW 3CCJA 4J6WA 2P0KA 3MCAB 2EQKA 2FVUA 2O01E 5IAYA 3SD4A 3JB9D 1MHNA 2YRVA 3RKYA 4M7DE 2VXEA 5LJ3j 4JLGA 3QJYA 1Q86U 5CKEA 3M53A 2HD0A 3HRTA 3SFMA 3SWNC 3JRZA 2R5MA 1BKBA 2WSFE 2YHTA 3S6WA 4F7UG 3CD6A 5FU6C 1JJ2S 4PL6A 2LX9A 3WVDB 2ZZDA 4BI4A 3HSBA 2K5IA 5IN1A 1W2BA 4PNOA 1TH7A 4Y28E 2EQUA 2XU8A 1H3ZA 1UB4A 3QZ9B 4QW2A 2JZ2A 2R57A 4IURA 4YTLA 5GAN7 3OYFA 3MP6A 1HK9A 2HBPA 5GAOp 2HAXA 5KE3A 4GY5A 3RMQA 4A4EA 1IREB 3X24B 5FRMA 4MZMA 1YITA 1UGRB 3M54A 2QTXA 4HCCA 1OZ3A 2DZ9A 4E7HA 3QG1A 4J7IA 2IVWA 2E12A 1QP3A 4JUVA 3URGA 3L42A 1YJWA 3CC7A 2FYKA 4X9DA 1M1KU 3SDZA 4O6JA 4ELYC 3GNFB 4EPCA 1Y7XA 2QQRA 4XTUA 3RKXA 1K8AC 3BFMA 4M7DC 3UT1A 5J39A 3EFSA 2DIGA 4P5NA 4FU6A 4IUTA 4OB3B 2P0QA 2EWNA 1K73C 5A0DA 2V8KA 5GANe 1Y71A 1UGQB 4OVAA 1HXDA 2VGNA 4FSXA 2OTLT 3JCMh 3CMET 2WACA 4BACA 2B8AA 2EQMA 2JNGA 4A4FA 1WJSA 3A8OB 5HK0A 1BI2A 2MMPA 2L89A 2YLCA 4M78B 1LOJA 5GMKi 3O8VA 4C0DB 1YIJA 3CCQA 2P4TA 3MP8A 1VQPA 3RERA 4PLLA 3J80E 3CPFA 5I2SA 3BY7A 2ZPBB 2VYTA 3NTKA 4C8QE 3S3MA 1D3BA 3JCMc 2QQSA 2E6ZA 1M1GA 2LT1A 3JSCA 2DXUA 3OYDA 2RHUA 4ELZC 5HKCA 2MAMA 4JRPA 5LJ5g 5GAOm 2CKKA 2AHJB 3TU4K 1G3WA 1YCYA 1WJRA 3GOXA 4OF1A 3OYHA 3CCQT 5J26A 2OTJT 4M7AE 5D6WA 4MZTA 5GANd 4OMFB 5AYFA 3GP8A 3I56T 4QQDA 4IUPA 3VV0A 3CCET 1BYMA 2XI9A 2CZ6B 4E7JA 4NL3A 2EJGA 2DPPB 2RHYA 3FRNA 3OMCA 1QW1A 1WGSA 4XTZA 1D3BB 2RI2A 5LJ3d 5M9OA 3LX7A 2RB6A 1VQMT 1WNLA 1N6AA 4M75G 5GAOn 3L2UA 2OTJA 2QQ9A 2KY9A 2VC8A 3PIPA 1ZHIA 2M0OA 3OYMA 4FM4B 3PMIA 4J6YA 3TCJA 2G3RA 1VIFA 3QKJA 4QVDA 3OYIA 3HHTB 4J5YA 3JCMP 3CXCA 5I2MA 2XHCA 4RG2A 4C5IA 2JTFA 4BE2A 2JOYA 2ZGWA 4N0AA 3JAME 3P8DA 3HP9A 1R8OB 4M78A 4C92D 3OYLA 2RI3A 1N27A 3X20B 2LCLA 4JS5A 4C8QF 1RI0A 4XTVA 4L6V5 3L2QA 3VYGA 2VXFA 3MEVA 4FT2A 4JRIA 4ZN3A 2C06A 4PJOA 3CXCS 3A8MB 3UWNA 3BDUA 3CD6T 2RM4A 2WSCE 4M7AB 4E7LA 1VQ6A 2E65A 1WPYA 2P0PA 3CBMA 5KCOA 5KH6A 3FDRA 1X01A 3LH0A 4M78C 3VU3C 2YLBA 5CO7A 4BY6C 2RA2A 4C8QD 1JRIA 1VQOA 5CIUA 5GAOl 4LDWA 2M9UA 3FJPA 3HRUA 4BUGA 4C8QB 3LGLA 2GF7A 3V8JA 2XD0A 3QYHB 1VQ9T 4IKFA 4M75D 2A7YA 1OZ2A 2V8JA 5GAN2 1YI2A 3HFOA 4PJOG 1WQWA 3CBOA 4L5GA 1VUBA 2GFUA 4XU0A 2QEXT 1GXIE 4BB7A 2R58A 3G4SA 1OI1A 2CS7A 2RJDA 4C92E 3CC2T 4J8OA 4EMKC 2RHXA 3ER0A 1VQOT 1N8RC 2E1HA 4M75A 3VJPA 1Q81C 3CCUA 2K3YA 2XDBA 3QIIA 2OAUA 4QQGA 3G6ET 5GAMh 3DLMA 4BE1A 3QSUA 1M4ZA 2PUKB 3BDLA 3QZ5B 1W4SA 2Y90A 2CGHA 3GIBA 4GLKA 3DKMA 5GAMj 5CQXA 1K73U 4EMKA 3CCEA 1W2BS 4JRKA 4M77F 4XTXA 3J81E 4JS4A 4M7AA 2XDDA 4II1A 4PJOC 5LJ5d 4DOWA 2LNVA 3JB9F 4NS5A 2Y4YA 1RL2A 3HKSA 2PQWA 3M5AA 4LDUA 2D0QB 3CC7T 4KUIA 4KUDK 3M59A 3Q1JA 5GANg 3CCST 2FL7A 4C92A 3JB9I 4M7DA 3JCMJ 5L8RE 5GAMf 3CC4A 2QI2A 5C6SA 2HQEA 3NTHA 3SWNB 3JCMf 4C5GA 2E5QA 3G4ST 2GQVA 1ZBXA 2XICA 3ME9A 1U1TA 3A8LB 1NE8A 2X35A 4KBMB 4MMKA 2K5FA 3JCMb 5FROA 3C12A 1S72A 1U1SA 1VQ7A 4OB1B 2ZPEB 4M77C 3V7RA 1Q81U 2ZPFB 1VQKT 4MDWA 3PT9A 3PFSA 3RKWA 1WJQA 3E9FA 2RK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7K A;  3H8Z A;  2RHU A;  2DIQ A;  3OYD A;  3OYG A;  4QVZ A;  4CRI A;  3OYC A;  2CKK A;  3GOX A;  1WJR A;  3CEY A;  3OQ5 A;  2IG0 A;  3OYH A;  5J26 A;  3OYJ A;  4BD3 A;  2BUD A;  2F5K A;  5D6W A;  3P8H A;  4QQD A;  4IUP A;  2O4X B;  4ZTF A;  3L2R A;  3S3N A;  2LRQ A;  2M16 A;  2NLU A;  4ZTJ A;  4BE0 A;  2RHY A;  4A4H A;  2RO0 A;  4IUQ A;  3OMC A;  1WGS A;  2RI2 A;  5M9O A;  3LX7 A;  2DAQ A;  2BIV A;  2EKO A;  3PMT A;  3L2U A;  2FHD A;  4QQ6 A;  5KE2 A;  2M0O A;  3OYM A;  3PMI A;  4IUV A;  1KHC A;  2G3R A;  3MO8 A;  3QKJ A;  2L8D A;  3OYI A;  3LYI A;  3F70 A;  4RG2 A;  4C5I A;  2X4W A;  2JTF A;  3C4S A;  3QBY A;  4BE2 A;  2O4X A;  4EDU A;  2LTO A;  4E7I A;  3KUF A;  2L3R A;  2RI5 A;  3MEW A;  3P8D A;  4N4G A;  4Q5W A;  3OYL A;  2RI3 A;  2MWO A;  1N27 A;  1G5V A;  1RI0 A;  3ZEH A;  3L2Q A;  3ASK A;  2LDM A;  3MEV A;  3FC3 A;  4BDY A;  3OS0 A;  3OMG A;  3UWN A;  2P0K A;  5IAY A;  2EQK A;  3OY9 A;  4E7L A;  2RJF A;  3SD4 A;  5C0M A;  1MHN A;  2K3X A;  2YRV A;  2LCC A;  4LD6 A;  4B9X A;  5KCO A;  3MET A;  4IUU A;  5KH6 A;  2R5A A;  3FDR A;  3LH0 A;  2D9T A;  3NTI A;  3LLR A;  2R5M A;  3S6W A;  5CIU A;  4Z02 A;  3M9Q A;  4PL6 A;  2EFI A;  2MWP A;  2RJC A;  4FL6 A;  3LGL A;  2GF7 A;  5IN1 A;  3OYA A;  3QJ6 A;  5KCH A;  4IKF A;  3DB3 A;  2LVM A;  4UC4 A;  2EQU A;  1OZ2 A;  1H3Z A;  4QW2 A;  1OYX A;  2JZ2 A;  2R57 A;  4IUR A;  2GFU A;  3OYF A;  3E9G A;  3MP6 A;  2RHZ A;  1SSF A;  2BKD N;  2R58 A;  3EAE A;  2E6N A;  4GY5 A;  1OI1 A;  2RJD A;  4A4E A;  3FEO A;  5KE3 A;  3OA6 A;  5FRM A;  2RHX A;  3MP1 A;  3LGF A;  4BDZ A;  3FLG A;  4N4H A;  2K3Y A;  3OS1 A;  3QII A;  1OZ3 A;  3L2W A;  2RHI A;  4QQG A;  4A4G A;  3OYE A;  3DLM A;  4BE1 A;  4E7H A;  3BDL A;  4C5H A;  1XNI A;  3PNW C;  3MEA A;  3OYK A;  3S3O A;  2M1H A;  2RJE A;  3L42 A;  4B9W A;  4E7J A;  4N4I A;  5D6Y A;  2QQR A;  3OYB A;  2X4X A;  3UT1 A;  2GFA A;  2XK0 A;  5J39 A;  2DIG A;  4PLI A;  4FU6 A;  4IUT A;  4II1 A;  4X34 A;  3OYN A;  4NS5 A;  3DB4 A;  2PQW A;  3L2V A;  4OVA A;  3MEU A;  3Q1J A;  4BAC A;  2WAC A;  2B8A A;  3OB9 A;  2EQM A;  4A4F A;  1WJS A;  2HQX A;  4HCZ A;  2L89 A;  5C6S A;  2HQE A;  3NTH A;  4L59 A;  2E5Q A;  2XDP A;  4C5G A;  3O8V A;  3ME9 A;  5D6X A;  3H6Z A;  3MP8 A;  2X35 A;  2EQJ A;  4C5E A;  5FRO A;  4PLL A;  2X4Y A;  2VYT A;  3NTK A;  3S3M A;  3PFS A;  1WJQ A;  2QQS A;  3E9F A;  3OS2 A;  5FRN A; 
#chains in the Genus database with same CATH topology
 1JXM A;  2PVO B;  4RTW A;  1VYT A;  4ZGE B;  3VRY A;  4OB2 B;  5FU7 C;  1NM7 A;  4EMK B;  4OMO A;  5FU7 B;  1BI1 A;  3E19 A;  5CKF A;  4E2F B;  5KE2 A;  1NJI C;  2JM9 A;  5ECA A;  4KT0 E;  2DRM A;  1UG1 A;  3NGP A;  3C4S A;  3QBY A;  5LJ3 g;  3QXE B;  1YJN Q;  2DTH A;  4V2S A;  1LNX A;  1QVF A;  4KUL A;  2A28 A;  3KBG A;  2LDM A;  3CPW A;  4J9H A;  3T9N A;  2V8I A;  4LD6 A;  2LCC A;  4IUU A;  1QVG P;  3JB9 J;  1Q7Y C;  1MMD A;  3GLX A;  1VQP T;  4Z02 A;  1VYU A;  4F7U A;  2EFI A;  3QHS A;  1UGV A;  3QJ6 A;  5KCH A;  2AIR B;  5FU6 B;  1FMK A;  1EFN A;  5C0M A;  1GRI A;  2BKD N;  2CH4 W;  2JTE A;  3OSS C;  3PIO A;  1K73 R;  1I4K 1;  4J9I A;  1QVG A;  2OTL Q;  2A37 A;  3RIR A;  4C5H A;  1KIK A;  3PVL A;  2JTM A;  3H41 A;  4GBQ A;  3VUB A;  4JJC A;  4D6W A;  5GAM d;  3CCR T;  4C92 F;  1VA7 A;  1X69 A;  4CC3 A;  2KNB B;  1KQ1 A;  3GBQ A;  4RTX A;  3OYN A;  5LJ3 f;  1I1J A;  5EC7 A;  3L2V A;  3NFC A;  5KYN A;  1S72 T;  1KJW A;  2I0N A;  2K2M A;  2DXC A;  1XQH A;  2JN0 A;  4ESR A;  4M78 D;  1MMN A;  2X4Y A;  5LJ5 f;  3A8G B;  3OBW A;  3X28 B;  2QAS A;  3OS2 A;  2EPD A;  1FYN A;  1AWW A;  1UGS B;  4HT8 A;  1SEM A;  4M7A F;  2O31 A;  4RTY A;  3P8H A;  1N9S A;  3CCM A;  1OQK A;  2NLU A;  5GAN 5;  1NJI U;  1M9S A;  4BI3 A;  3ZFJ A;  3WXM B;  1OPL A;  2KRS A;  4OGC A;  4OGE A;  1Q95 G;  3JCM X;  4M7D G;  5GJW B;  4XTY A;  1OPK A;  3RMS A;  3DLL A;  4ME7 A;  3JCM V;  1PM3 A;  1VQM A;  2C0O A;  2BE9 B;  2NUP B;  4WF2 A;  1VQ5 Q;  3X26 B;  1KSW A;  3G6E A;  3G6E Q;  4XK8 E;  4NOY A;  2PZ1 A;  3OS5 A;  1HD3 A;  2B86 A;  1Q7Y U;  2HBW A;  2J06 A;  4Z8A A;  2QEX Q;  1AZG B;  2FZC B;  5CKH A;  3G71 A;  2DL7 A;  4NL2 A;  4C8Q A;  1AVZ C;  4DEX A;  4M77 E;  3CCV Q;  4K11 A;  3OYA A;  2G6F X;  2LNH B;  1IGQ A;  2PTK A;  4OMQ A;  2LVM A;  3AHU A;  2DVE A;  1OYX A;  2E6N A;  2EGE A;  3HTR A;  3OA6 A;  3CPW S;  1O9S A;  3OS1 A;  3A8H B;  2ZPG B;  1KQS S;  4J83 A;  2ZCF B;  2F2V A;  3OYK A;  3S3O A;  1WFW A;  2RJE A;  1AT1 B;  1SKU B;  2E70 A;  3L2Z A;  2HCK A;  3I55 A;  4M7D F;  3LWH A;  1O75 A;  2KXD A;  3LW5 E;  2A3L A;  1NPP A;  4PLI A;  1M1K C;  1V76 A;  2PUO B;  3EFO A;  1BI0 A;  2LQK A;  4Y91 A;  5GAN 4;  3VKI A;  1WQ7 A;  2HKN A;  3ULR B;  3OB9 A;  3EGD A;  1CKB A;  1H8K A;  1G3T A;  2GTO A;  2LCS A;  2V26 A;  1U8R A;  1I5L A;  4PJL A;  2K7A A;  1FMV A;  4XU3 A;  1KG1 A;  5FRN A;  4MZP A;  1JB0 E;  4LN2 A;  3NPF A;  2YUO A;  5GAN h;  1QP2 A;  2RK2 A;  3OYC A;  4E7Z A;  2KMT A;  3G71 Q;  4HA8 A;  2J6F A;  4BD3 A;  2F5K A;  4RTV A;  1N8R U;  3CCV A;  3L2R A;  2CT3 A;  1KC8 C;  4JJB A;  1KFZ A;  2CZ0 B;  1RAA B;  1VQ5 T;  1IGU A;  1BCM A;  2CP5 A;  3M0Q A;  3SB2 A;  5GAN f;  2MPX C;  1BCO A;  3M4G A;  1YIT T;  1OU9 A;  4ZN1 A;  5GAN 3;  2O4X A;  3L1A A;  4E7I A;  3KUF A;  2RI5 A;  2L5Q A;  3VRZ A;  4C0D C;  3LH5 A;  3A5Z B;  3OS0 A;  3R6N A;  3CCJ A;  2J6O A;  5IAY A;  2FVU A;  4M7D E;  5LJ3 j;  4JLG A;  2HD0 A;  3JRZ A;  4D8D A;  9ATC B;  3CD6 Q;  1JJ2 S;  3WVD B;  1G8X A;  2ZZD A;  3I35 A;  2RF0 A;  2DYI A;  1TH7 A;  2DL4 A;  2XU8 A;  1UB4 A;  3QZ9 B;  4QW2 A;  2M51 A;  4KRT A;  1HK9 A;  5FRM A;  4HCC A;  2LJ1 A;  3QG1 A;  1QP3 A;  4JUV A;  3CC7 A;  1M1K U;  3TSZ A;  1JJ2 P;  4O6J A;  3GNF B;  3RKX A;  1K8A C;  3EFS A;  1KC8 R;  3CCJ Q;  2P0Q A;  1H92 A;  1K73 C;  5A0D A;  4OVA A;  1HXD A;  3JCM h;  2WAC A;  2B8A A;  3PE0 A;  1PNJ A;  1BI2 A;  2L89 A;  4M78 B;  1T0H A;  4WCI A;  3ZL7 C;  3RER A;  3BY7 A;  2P4R A;  2V1Q A;  2DVJ A;  1D3B A;  2OJ2 A;  8ATC B;  4FSS A;  5HKC A;  2NUZ A;  2CKK A;  1PHT A;  1WX6 A;  1YCY A;  2OTJ T;  5GAN d;  4OMF B;  3GP8 A;  1AEY A;  4QQD A;  3VV0 A;  2F2W A;  2DPP B;  3SEM A;  1D3B B;  2RI2 A;  5LJ3 d;  4F14 A;  1VQM T;  5GAO n;  4M75 G;  2OTJ A;  1K9M R;  3OYM A;  4FM4 B;  3PMI A;  4J6Y A;  3TCJ A;  3QKJ A;  2D0N A;  3CXC A;  3MKD A;  1WHH A;  1JU5 C;  2ROL A;  3EG0 A;  4PK4 A;  2DER A;  1OX9 A;  2YWW A;  3HP9 A;  1KD1 R;  4PJJ A;  2NUP A;  3L2Q A;  3MEV A;  2WSC E;  4E7L A;  2KBT A;  4IIO A;  4CC2 A;  1VQ6 Q;  3CBM A;  2M0Y A;  4M78 C;  2M9U A;  2EYX A;  3HRU A;  4C8Q B;  2DM1 A;  2GF7 A;  2YXY A;  1LCK A;  1VQ9 T;  1RAF B;  4IKF A;  2V8J A;  2CDT A;  3CBO A;  4L5G A;  2GFU A;  3G4S Q;  3CPW P;  3EG9 B;  4C92 E;  2ATC B;  4J8O A;  1N8R C;  4M75 A;  3CCU A;  1U5S A;  4X1V A;  1M4Z A;  2PUK B;  2JMC A;  3QZ5 B;  2EGA A;  1X6G A;  1AWX A;  1K73 U;  3J81 E;  2EBP A;  4JS4 A;  4D8K A;  4II1 A;  1E6G A;  3JB9 F;  4LXC A;  1AOJ A;  4IIM A;  2RN8 A;  3Q1J A;  2FL7 A;  3JB9 I;  3JCM J;  1H3H A;  4QKU A;  3CC4 Q;  3M0S A;  2HQE A;  3NTH A;  1QQJ A;  3JCM f;  2IIM A;  2YDL A;  1ZBX A;  3ME9 A;  4MMK A;  1S72 A;  4ORZ A;  4FYX B;  3PFS A;  3RKW A;  1D1B A;  2EYY A;  4XU2 A;  1WJQ A;  4LDX A;  2RK1 A;  1YN8 A;  7AT1 B;  1NZ9 A;  4EMH A;  1VQ7 T;  3C0C A;  1XOV A;  4DA4 A;  3G1J A;  1P92 A;  4M75 E;  4RMO A;  1JBM A;  1BK2 A;  1YHQ T;  2FHD A;  2E64 A;  2F69 A;  2L8D A;  4J9B A;  3H9N A;  1JQQ A;  1UUE A;  2DJZ A;  2YRC A;  4OML A;  2FB7 A;  2QA4 T;  2JUF A;  1VQ7 Q;  3I9Q A;  2W0Z A;  2FEI A;  2DD4 A;  2F5T X;  2SEM A;  2VGM A;  2CP2 A;  3BE3 A;  3FB9 A;  3OYY A;  4ANJ A;  4F17 A;  2K5L A;  2DD5 A;  1YWP A;  4HKE A;  5KYU A;  4FL6 A;  1BIB A;  4JZ3 A;  1M1F A;  1R77 A;  4OB0 B;  1W70 A;  2J05 A;  3NMZ C;  3FEO A;  2LZ6 B;  3LGF A;  1H64 1;  4JJN K;  4PFO A;  1VQ4 A;  4PJO D;  3V8K A;  1YJN T;  2O2O A;  2DXB A;  2QDY B;  1QLY A;  2LT4 A;  2AK5 A;  5D6Y A;  3I56 A;  4C0G A;  4WTO B;  2HQX A;  1VQL Q;  4C92 B;  1T0J A;  1PSE A;  1OV3 A;  1UEC A;  1M3B A;  5D6X A;  2LJ0 A;  5CKB A;  4F7U B;  2QA4 A;  3EG3 A;  3EH2 A;  3MP1 A;  4E7K A;  1VQL T;  1VQK Q;  1M2O A;  1KQ2 A;  1KQS A;  1WLP B;  2L0A A;  4A4K A;  4F7U E;  4OP0 A;  1K9M U;  2XID A;  1I81 A;  2LRQ A;  5A2Q E;  2RD1 A;  3JCM Q;  1NEB A;  3NHN A;  4HVU A;  2HNI A;  2CP7 A;  2BE7 D;  4J9F A;  3HRS A;  1MGQ A;  3M56 A;  5CAI A;  2X4W A;  4AG1 C;  1Q7Y R;  4RCC A;  2O88 A;  4N0A C;  1ZQ1 A;  2AT1 B;  4VUB A;  3UDC A;  4N4G A;  2KSS A;  3I55 Q;  1ZUK A;  3ZEH A;  1M27 C;  1QCN A;  2X4J A;  1SRM A;  5GAN 6;  3OY9 A;  4M77 B;  5DY9 A;  4PJM A;  5GAN 8;  1X2K A;  4KGV B;  3PTA A;  3UAT A;  4ZGD B;  1X6B A;  3DB3 A;  4J7F A;  5GMK h;  2LQN A;  2H3J A;  3CME Q;  2P84 A;  1UHC A;  2QA4 Q;  3EAE A;  4ZGJ B;  1X6O A;  3GNG A;  4KGZ B;  4C8Q G;  2M1H A;  5A0G A;  4E7J A;  1YHQ Q;  5CR2 A;  2Y4X A;  4N4I A;  5LJ3 e;  3HFN A;  2YRD A;  2GNC A;  3GPL A;  2NYS A;  4OMP A;  1LPL A;  1IHV A;  1GL5 A;  5GAO q;  1SPK A;  5GMK j;  1UJY A;  2HQH A;  4RG8 A;  1VQ9 A;  3P8B B;  2JJ9 A;  4HCZ A;  5GJV B;  5IHI A;  1KD1 C;  1UE9 A;  2QG9 B;  4J6X A;  2DEU A;  2NUT B;  5KYY B;  1U3O A;  2WSE E;  4PKC C;  1GCQ A;  2X3X D;  4KH0 B;  3CCU T;  2MIO A;  4N4H A;  3JB9 G;  2J7I A;  4BY6 B;  1K9M C;  1LJO A;  4FIB A;  1XJW B;  1YHQ A;  1WXU A;  2O4X B;  4ZTF A;  4JRQ A;  4M7D C;  1Y96 B;  2M16 A;  4ZTJ A;  3E1S A;  3CQT A;  4CC4 B;  4XU1 A;  1Q86 C;  1QKW A;  3V7S A;  1NPR A;  3EG1 A;  2XKO C;  2BZY A;  5LL6 S;  1YJ9 A;  3CMA Q;  4M4Z A;  3QWY A;  1M8V A;  2COW A;  4DBQ A;  1CSK A;  1ZUU A;  2ZPH B;  1IB8 A;  4LDY A;  3ZBD A;  3LYI A;  3F70 A;  4CC7 A;  1GFC A;  5J3B A;  1QMC A;  3C95 A;  4XAX B;  3G71 T;  3M55 A;  5A0L A;  3GF5 A;  4ZNX A;  4EMG A;  2QYZ A;  2KYM A;  2RQU A;  1NBE B;  3RES A;  1BI3 A;  3VS2 A;  3JCM W;  2P0K A;  2O01 E;  3JB9 D;  2YRV A;  4J9C A;  3RKY A;  3M53 A;  3SWN C;  3HRT A;  2R5M A;  1BKB A;  2RQW A;  1PKT A;  4AFQ C;  2LX9 A;  2K5I A;  5IN1 A;  1W2B A;  4F04 B;  3MP6 A;  2HBP A;  2HAX A;  4GY5 A;  3X24 B;  4MZM A;  1UGR B;  2CRE A;  2VKN A;  2QTX A;  1D1A A;  3EGX A;  2MK5 A;  1AD5 A;  3URG A;  2FYK A;  4X9D A;  1G83 A;  4ELY C;  1Y7X A;  2QQR A;  4XTU A;  4DBR A;  4P5N A;  4FU6 A;  4IUT A;  1ZA1 B;  2JS2 A;  1Y71 A;  2OTJ Q;  4A4F A;  2DX1 A;  2YLC A;  1LOJ A;  1YIJ Q;  5GMK i;  3O8V A;  1YIJ A;  2P4T A;  2YT6 A;  3CPF A;  5I2S A;  2ZPB B;  2VYT A;  1M1K R;  2LT1 A;  3OYD A;  2RHU A;  2MAM A;  1SF9 A;  4JRP A;  5LJ5 g;  1ARK A;  1G3W A;  4OF1 A;  5J26 A;  4RTT A;  4MZT A;  5AYF A;  2ENM A;  2GQI A;  2LMJ A;  4NL3 A;  2EJG A;  4PFZ A;  2HDA A;  2RHY A;  1WGS A;  5M9O A;  2RQV A;  3PIP A;  5KYX B;  4J9G A;  2QGG A;  2G3R A;  3OYI A;  3HHT B;  1UTI A;  1OUL A;  2XHC A;  4Z88 A;  2JOY A;  2OX7 A;  3JAM E;  4C92 D;  4M78 A;  1RI9 A;  2RI3 A;  3X20 B;  4XTV A;  1MNE A;  2VXF A;  4PJO A;  1NYF A;  3A8M B;  3CD6 T;  2E65 A;  1X01 A;  3UF4 A;  5KYY A;  3FJP A;  4BUG A;  2JT4 A;  2ABL A;  2ROT A;  5IXF A;  3I5S A;  1W6X A;  1OZ2 A;  3CXC P;  1YI2 A;  2HSE B;  2MYS A;  1GXI E;  2CS7 A;  2RJD A;  4EMK C;  3UA7 A;  4Z89 A;  1GCQ C;  2FO0 A;  4QQG A;  3QSU A;  3BDL A;  1WI7 A;  1W4S A;  1ZUY A;  3DKM A;  5CQX A;  1W2B S;  4JRK A;  4XTX A;  4M7A A;  2HL3 A;  2XDD A;  1C6V X;  4DOW A;  2D0Q B;  1J3T A;  3M59 A;  5GAN g;  4M7D A;  3CCL Q;  3VS3 A;  5L8R E;  2X9H A;  1SHG A;  4C5G A;  2GQV A;  5KYW B;  1VQP Q;  1NE8 A;  4KBM B;  2HL5 C;  2K5F A;  1PKS A;  1ZSZ B;  2ZPE B;  2ZPF B;  3PT9 A;  4EPC A;  2DTI A;  4QVZ A;  2DL8 A;  1QVF P;  1ZBJ A;  3OQ5 A;  1EX4 A;  3C94 A;  4JDS A;  1OX8 A;  1M3C A;  2K6D A;  2VUB A;  3UA6 A;  1R0C B;  5CQY A;  4M75 F;  2EKO A;  4M7A G;  2K57 A;  3OW2 P;  4FYW B;  2HSP A;  2K4Y A;  3I5R A;  1VQM Q;  1VQ5 A;  4AT1 B;  1VQ8 Q;  1YJN A;  3OBY A;  4Q5W A;  1B34 A;  2PVG B;  1Q86 R;  1GCP A;  2VWF A;  1K0X A;  3CCE Q;  4RTZ A;  2KQW A;  1GFD A;  4M75 C;  2EGC A;  2ZAE A;  5FW9 A;  1V29 B;  2D9T A;  1WHM A;  2YUN A;  4M7D D;  1XTD A;  2QQA A;  2RJC A;  2E10 A;  3CCL T;  1PD1 A;  2RMO A;  4RUG A;  3E9G A;  2DLP A;  1WHG A;  3EHQ A;  4M7A D;  2K2V A;  4M77 G;  4HT9 A;  1B3Q A;  4MDX A;  4DEY A;  1TOV A;  1TTH B;  5DLQ E;  4JZ4 A;  1I0C A;  2HZY A;  1XNI A;  1X27 A;  3M57 A;  4TVR A;  1VQN Q;  3CCJ T;  2VV5 A;  2CSQ A;  5I21 A;  1V1C A;  5GMK e;  2AKL A;  2M02 A;  1Y96 A;  1RAC B;  2K9G A;  3MEU A;  1QVF S;  3JCM e;  2GGR A;  1TS9 A;  2EJF A;  3TEE A;  1VQL A;  2XDP A;  1M30 A;  1Y57 A;  2E3I A;  4BI8 B;  4C0Z A;  4HXJ A;  4C5E A;  4C92 C;  3TRE A;  1VQ8 A;  5LJ3 h;  3M58 A;  4C8Q C;  1VQ4 T;  1RAE B;  4M77 D;  2O9S A;  3VYH B;  2FPF A;  1NEG A;  1VIE A;  2MI6 A;  3RBB B;  2KXC A;  1EIF A;  4M77 A;  2IG0 A;  4F7U F;  5I11 A;  2QQB A;  3INZ A;  1K76 A;  3S3N A;  4BE0 A;  4A4H A;  3V7C A;  3CC2 A;  4KH1 B;  3PMT A;  2DK3 A;  1IO6 A;  1VQN T;  2QXF A;  1CKA A;  2CYZ B;  4C0F A;  2DBM A;  2DJQ A;  2DET A;  5CKD A;  2CT4 A;  1MND A;  3RUX A;  3EGD B;  4JLI A;  1PWT A;  3MEW A;  1QKX A;  4M78 G;  5GAN j;  2J6K A;  4BDY A;  3FC3 A;  1TWB A;  1WHK A;  1ZSZ C;  1Z9Q A;  3MET A;  2R5A A;  1Q82 R;  2A36 A;  2Z0W A;  3LLR A;  3MHX A;  3VS7 A;  1RAH B;  1VQ8 T;  3X25 B;  2A08 A;  2D1X A;  1RAI B;  3FLG A;  1KK7 A;  3UPU A;  1D0Z A;  1M8M A;  4EIK A;  1PCX A;  2KRM A;  2BZX A;  2EAY A;  4B9W A;  3QDR B;  1WYX A;  1MV3 A;  2X4X A;  1UFF A;  1PSF A;  5GMK l;  1KHI A;  5GMK m;  1E6H A;  2K3B A;  3DB4 A;  4QVC A;  2JVV A;  1SG5 A;  3HL8 A;  4LE9 A;  2DNU A;  1U06 A;  1JO8 A;  2MOX A;  1AHJ B;  4MML A;  2EVR A;  3CCQ Q;  3MJX A;  1ABO A;  1ZLM A;  3CCV T;  2XK0 A;  4M78 E;  1JJ2 A;  3OYG A;  2XMF A;  1NJI R;  2RNA A;  1M3A A;  3OYJ A;  1FMW A;  4XTW A;  3JV3 A;  1G3Y A;  1PG5 B;  3RR6 A;  6AT1 B;  4RKU E;  2DYB A;  2DKG A;  2RH2 A;  1X43 A;  3WVE B;  3JCM g;  2DAQ A;  4PJO F;  3CMA A;  2LQ8 A;  5GAM g;  2ECZ A;  1M5Q 1;  1WXB A;  1A0N B;  2L3R A;  1HSQ A;  3SWN A;  1FXX A;  3OW2 A;  1BIA A;  4DBF A;  3ASK A;  4J6W A;  2EQK A;  3SD4 A;  3EGU A;  2QGF B;  3QJY A;  3SFM A;  2WSF E;  2YHT A;  3S6W A;  3CD6 A;  1BB9 A;  2ESW A;  4BI4 A;  4PNO A;  1VOM A;  2R57 A;  2QDL A;  4IUR A;  5GAN 7;  3OYF A;  1IRE B;  1YFN A;  1Q81 R;  2DMO A;  2DZ9 A;  4E7H A;  4J7I A;  2IVW A;  1NLO C;  2E12 A;  3L42 A;  1YJW A;  4LUD A;  3SDZ A;  3E2U A;  2CP6 A;  5KYU B;  3BFM A;  4PJN A;  2DIG A;  4OB3 B;  4OMN A;  4FSX A;  2OTL T;  3CME T;  2L3S A;  2JNG A;  3KFV A;  3EG9 A;  4LNP A;  1YWO A;  4C0D B;  1VQP A;  3MP8 A;  2BTT A;  4PLL A;  3J80 E;  2L3Q A;  3NTK A;  4C8Q E;  3JCM c;  2QQS A;  2E6Z A;  3H0F A;  1D0Y A;  2DXU A;  3JSC A;  4OMM A;  3TU4 K;  3CCQ T;  3GOX A;  3OYH A;  4M7A E;  4AFZ C;  4IUP A;  3CCE T;  2XI9 A;  2CZ6 B;  3FJ5 A;  2CUB A;  3OMC A;  4XTZ A;  1YI2 Q;  1TSF A;  2KGT A;  3LX7 A;  2RB6 A;  1N6A A;  1NYG A;  3TQ7 P;  1RAG B;  2VC8 A;  2KY9 A;  1UJ0 A;  2KRN A;  2M0O A;  1IXD A;  1M2V B;  4QVD A;  3JCM P;  3M0U A;  4RG2 A;  1WZO A;  4RTU A;  2ZGW A;  4N0A A;  1I5O B;  5D7U A;  1I07 A;  1R8O B;  2JW4 A;  2LCL A;  4JS5 A;  2H8H A;  4FT2 A;  4ZN3 A;  2W10 A;  2C06 A;  3UWN A;  3M0P A;  4M7A B;  1WPY A;  2KR3 A;  5KH6 A;  2RQT A;  3FDR A;  1C1A A;  2YLB A;  4BY6 C;  1QWF A;  1VQO A;  5GAO l;  4LDW A;  2XD0 A;  3QYH B;  2EKH A;  2A7Y A;  2JMA A;  3A98 A;  3REA B;  4PJO G;  1VUB A;  2QEX T;  3G4S A;  4J9D A;  3CC2 T;  3EFO B;  2RHX A;  3ER0 A;  1OU8 A;  2XDB A;  2K3Y A;  3QII A;  2GTJ A;  2F2X A;  2OAU A;  4AFU C;  3G6E T;  4BE1 A;  2E4H A;  1RLQ C;  2CGH A;  3GIB A;  4GLK A;  5GAM j;  1IRX A;  4EMK A;  3CCE A;  1K8A R;  1AZE A;  4PJO C;  5LJ5 d;  3MPU B;  2LNV A;  3HKS A;  1RL2 A;  2DRK A;  2PQW A;  3M5A A;  1C0M A;  2JXB A;  3CC7 T;  2KI7 A;  4KUD K;  1JEG A;  3CCS T;  4C92 A;  2DL3 A;  1VQO Q;  5GAM f;  2QI2 A;  5C6S A;  1U1T A;  2X35 A;  5FRO A;  1E7O A;  3C12 A;  1VQ7 A;  4QT7 A;  4DBH A;  4OB1 B;  2KT8 A;  4M77 C;  3REB B;  4MDW A;  3VS0 A;  5L23 A;  1VQ4 Q;  4FYY B;  4CRI A;  3U23 A;  1G2B A;  5HK3 A;  4RCB A;  2D8J A;  5EG2 A;  4M7D B;  1GBQ A;  3QUI A;  2C0T A;  3PGG A;  1VYV A;  4IUQ A;  1TUC A;  2ED1 A;  2KRO A;  5LJ5 h;  2RQR A;  3CCL A;  3MO8 A;  4XQ3 A;  1NLP C;  2EIF A;  2CZ7 B;  1QWE A;  3CCR A;  3CCR Q;  4E47 A;  1K9A A;  4GLM A;  1VQN A;  2KK4 A;  1YJ9 T;  3AT1 B;  2X3W D;  1BU1 A;  1SHF A;  1IZ6 A;  1N8R R;  3I56 Q;  4AMC A;  3OMG A;  5CCA A;  2LC4 A;  5IHK A;  4B9X A;  5GAM e;  1OOT A;  3M9Q A;  2MWP A;  1M90 R;  3TSW A;  1JXO A;  3QYG B;  4UC4 A;  2MF2 A;  2BZ8 A;  3QO3 A;  3CCS Q;  1UGP B;  5GAO r;  1YIJ T;  1SSF A;  2KT1 A;  1K0S A;  2DBK A;  2H3E B;  1M90 U;  4BDZ A;  1OEB A;  5AT1 B;  5IT9 E;  2SRC A;  1X2Q A;  1B7T A;  2GBQ A;  4ATO A;  2PU9 B;  5DM7 R;  3MEA A;  2K79 A;  1M2V A;  3OYB A;  2COZ A;  2ZPI B;  1QVP A;  1RAD B;  2EYZ A;  3EFR A;  2NWM A;  3CBP A;  4X34 A;  3CCM T;  3CC2 Q;  2D6F A;  3TVT A;  2QAZ A;  5FLX E;  4JJD A;  3G7Z A;  2XG8 D;  1B07 A;  4DOV A;  1Y07 A;  3J7A F;  2GCX A;  4M7A C;  3M4Y A;  2DO3 A;  4HCK A;  1VQ9 Q;  1KC8 U;  3H6Z A;  2EQJ A;  3VS6 A;  5IHN A;  3IQL A;  3CCS A;  1RLP C;  1VQ6 T;  2AKK A;  2X51 A;  1N9R A;  1G5V A;  1F1B B;  1FX7 A;  2KE9 A;  1S1N A;  2O9V A;  2KDS A;  3QPH A;  5HY6 A;  4PJO E;  2EYW A;  3JCM d;  3CEY A;  1ZX6 A;  3D7S B;  8AT1 B;  1DJ7 B;  2YUP A;  3LWI A;  3CCM Q;  1WHL A;  2C0I A;  4CI0 C;  2DFU A;  2BIV A;  2LQW A;  1ABQ A;  2OAW A;  2FPD A;  1YI2 T;  2DZC A;  4IUV A;  4M78 F;  4HCB A;  1MV0 B;  4LDV A;  2OTL A;  3CMA T;  4EDU A;  2CZ1 B;  4E7S A;  3OSV A;  4AFS C;  3R6O A;  3HPW A;  3RNJ A;  2MWO A;  1Q82 U;  4FCY A;  3M0R A;  4FT4 A;  2HKQ B;  2EJ9 A;  3BW1 A;  2CP0 A;  2RJF A;  2K3X A;  2QEX A;  1AWO A;  3N5B B;  2QK0 A;  3NTI A;  2L3P A;  3VUZ A;  2DF6 A;  1RUW A;  1K8A U;  1TUG B;  3VS5 A;  4O5V A;  3RDV A;  3KXT A;  1TXQ A;  2CUD A;  1YJ9 Q;  2RHZ A;  1KD1 U;  2CP3 A;  3V8L A;  2YUQ A;  1VQK A;  2JM8 A;  3L2W A;  2RHI A;  4A4G A;  3OYE A;  1MUZ A;  1Z9Z A;  3PNW C;  1UEB A;  2I2L A;  1YJW Q;  2VVK A;  4PFP A;  5IXB A;  2GFA A;  2L2P A;  1YJW T;  1EZZ B;  4DQ2 A;  5LJ5 j;  5KYW A;  2DXT A;  1B34 B;  4M75 B;  4C92 G;  2A0F B;  3EG2 A;  2DTO A;  1Y0M A;  5LJ5 e;  2EQI A;  3O5Z A;  2AZS A;  2DE0 X;  4L59 A;  1TG0 A;  5DLO A;  2DEQ A;  3CME A;  2KAF A;  4AG2 C;  1YBY A;  1G3S A;  3JB9 H;  4A53 A;  3H0I A;  4X9C A;  3H8Z A;  2DIQ A;  3CC4 T;  3FIF A;  1QCO A;  2D8H A;  1QVG S;  2EYQ A;  3VS4 A;  2BUD A;  3CC7 Q;  1AWJ A;  1Q81 U;  1X75 C;  1M90 C;  2RO0 A;  3I55 T;  2KVQ G;  1ZSG A;  4R56 A;  2HMA A;  2PNI A;  4QQ6 A;  3OW2 S;  1ZSZ A;  3EHR A;  2PVD B;  5CK9 A;  1KHC A;  2VB6 A;  1D09 B;  5FWB A;  5CVI A;  1NG2 A;  1PC0 A;  1Q82 C;  2E41 A;  4HVV A;  1I8F A;  2HEQ A;  1D1C A;  2LTO A;  1IHW A;  3EGX B;  4LD9 K;  4HVW A;  4R55 A;  1MMA A;  4PJO B;  4A54 A;  2LJ3 A;  1FWZ A;  1T3S A;  3MCA B;  1RAB B;  1MHN A;  2VXE A;  2ED0 A;  1Q86 U;  5CKE A;  4LUE A;  3THK A;  4F7U G;  5FU6 C;  1T3L A;  4PL6 A;  3HSB A;  3EH1 A;  2IPO B;  4Y28 E;  2EQU A;  4J9E A;  1D0X A;  2F1L A;  1H3Z A;  1ZA2 B;  2JZ2 A;  4YTL A;  1ACM B;  5GAO p;  3VS1 A;  4A4E A;  3RMQ A;  1N5Z A;  5KE3 A;  1MMG A;  3SHW A;  2FZG B;  1YIT A;  3M54 A;  1WHJ A;  3M0T A;  1OZ3 A;  1TU0 B;  1PRL C;  2NUT A;  2CH4 A;  3UT1 A;  1WA7 A;  5J39 A;  2EWN A;  2V8K A;  5GAN e;  1UGQ B;  2VGN A;  4BAC A;  2CSI A;  2EQM A;  1WJS A;  3A8O B;  5HK0 A;  2MCN A;  1UHF A;  2MMP A;  1R0B G;  1TUD A;  3CCQ A;  1UDL A;  5KYX A;  1W1F A;  1QCF A;  3S3M A;  2KEA A;  3QWX X;  5IH2 A;  1M1G A;  2E3H A;  4ELZ C;  3CCU Q;  5GAO m;  2AHJ B;  1WJR A;  2E5K A;  1YP5 A;  2FRW A;  2LP5 A;  5D6W A;  3I56 T;  2FPE A;  1SSH A;  1BYM A;  1WXT A;  4FW2 A;  3FRN A;  1QW1 A;  1WNL A;  3L2U A;  2QQ9 A;  2V1R A;  1ZHI A;  1KQS P;  1VIF A;  4J5Y A;  3A1P A;  5I2M A;  4C5I A;  1WDX A;  4E6R A;  2JTF A;  4BE2 A;  4FYV B;  3P8D A;  3OYL A;  1N27 A;  4C8Q F;  1RI0 A;  2DL5 A;  4L6V 5;  2COY A;  3VYG A;  4JRI A;  2FG0 A;  3CXC S;  3BDU A;  2RM4 A;  1VQ6 A;  5HCK A;  2P0P A;  1LVK A;  2AZV A;  4JPB W;  5KCO A;  1YCS B;  1SRL A;  3H0H A;  3LH0 A;  3VU3 C;  5CO7 A;  2RA2 A;  4R0K A;  4C8Q D;  1JRI A;  5CIU A;  2OI3 A;  3LGL A;  3V8J A;  5FWC A;  4M75 D;  2VAS A;  2KYB A;  5GAN 2;  3HFO A;  1S72 Q;  1WQW A;  4XU0 A;  2JS0 A;  2RPN A;  2FRY A;  2LX7 A;  4BB7 A;  2R58 A;  1OI1 A;  1YNZ A;  4FW1 A;  1YIT Q;  3PVQ A;  1VQO T;  2E1H A;  1Q81 C;  3VJP A;  4Y92 A;  5GAM h;  3DLM A;  2Y90 A;  2QTV A;  1HYO A;  1PRM C;  2EW3 A;  2YSQ A;  1K1Z A;  4M77 F;  4NS5 A;  2Y4Y A;  4LDU A;  4KUI A;  2DIL A;  2DA9 A;  3QDF A;  4KGX B;  2FZK B;  3CC4 A;  1GBR A;  3G4S T;  3SWN B;  2E5Q A;  2XIC A;  1PD0 A;  1W2B P;  3A8L B;  1WIE A;  3JCM b;  4A63 B;  5I22 A;  1U1S A;  1K4U S;  4B6M A;  1BBZ A;  4F16 A;  3V7R A;  1VQK T;  1HJD A;  3E9F A; 
#chains in the Genus database with same CATH homology
 2DTI A;  1NZ9 A;  4QVZ A;  4CRI A;  5HK3 A;  4RCB A;  5EG2 A;  4EMH A;  4M7D B;  2PVO B;  1VQ7 T;  3OQ5 A;  3C94 A;  4JDS A;  3QUI A;  4ZGE B;  1XOV A;  4OB2 B;  2VUB A;  3PGG A;  5FU7 C;  4DA4 A;  1P92 A;  4M75 E;  4IUQ A;  4EMK B;  4RMO A;  5CQY A;  5FU7 B;  4M75 F;  1JBM A;  1BI1 A;  2EKO A;  3E19 A;  5CKF A;  5LJ5 h;  2FHD A;  5KE2 A;  1YHQ T;  4M7A G;  1NJI C;  2K57 A;  3CCL A;  2E64 A;  3MO8 A;  4XQ3 A;  2F69 A;  2L8D A;  4KT0 E;  2EIF A;  2CZ7 B;  3CCR A;  4E47 A;  2K4Y A;  3C4S A;  3QBY A;  5LJ3 g;  1VQ5 A;  2DJZ A;  3QXE B;  1VQN A;  2KK4 A;  2FB7 A;  2QA4 T;  2JUF A;  1YJN A;  3OBY A;  4Q5W A;  1B34 A;  1YJ9 T;  2DTH A;  4V2S A;  2PVG B;  1LNX A;  1QVF A;  4KUL A;  1IZ6 A;  3KBG A;  2LDM A;  2KQW A;  3CPW A;  2DD4 A;  2F5T X;  2VGM A;  3FB9 A;  2LC4 A;  3OMG A;  3OYY A;  4M75 C;  5CCA A;  3T9N A;  2V8I A;  4LD6 A;  2LCC A;  2K5L A;  2DD5 A;  4B9X A;  4IUU A;  5GAM e;  1V29 B;  2D9T A;  3JB9 J;  1Q7Y C;  4HKE A;  3GLX A;  1VQP T;  4Z02 A;  3M9Q A;  4F7U A;  4M7D D;  2EFI A;  1XTD A;  2MWP A;  2QQA A;  2RJC A;  3QHS A;  1BIB A;  4FL6 A;  3QJ6 A;  3QYG B;  5KCH A;  2E10 A;  4UC4 A;  2MF2 A;  3CCL T;  1M1F A;  3QO3 A;  5FU6 B;  1UGP B;  3E9G A;  4OB0 B;  5GAO r;  1YIJ T;  1SSF A;  2BKD N;  5C0M A;  3OSS C;  3PIO A;  4M7A D;  2K2V A;  3FEO A;  3LGF A;  1I4K 1;  1H64 1;  4M77 G;  4BDZ A;  1M90 U;  4JJN K;  5IT9 E;  4HT9 A;  4MDX A;  1VQ4 A;  4PJO D;  5DLQ E;  1QVG A;  3V8K A;  1YJN T;  3RIR A;  2DXB A;  4C5H A;  2QDY B;  1XNI A;  4ATO A;  2PU9 B;  5DM7 R;  2JTM A;  2LT4 A;  3M57 A;  3MEA A;  4TVR A;  3VUB A;  3CCJ T;  3CCR T;  4D6W A;  2VV5 A;  5D6Y A;  5GAM d;  4C92 F;  5I21 A;  3OYB A;  2ZPI B;  1QVP A;  5GMK e;  3EFR A;  3I56 A;  1KQ1 A;  4C0G A;  3CBP A;  4X34 A;  3OYN A;  1Y96 A;  5LJ3 f;  3CCM T;  2D6F A;  3L2V A;  3NFC A;  5FLX E;  3MEU A;  3G7Z A;  2XG8 D;  1S72 T;  3JCM e;  1QVF S;  4DOV A;  1Y07 A;  2EJF A;  2GCX A;  2HQX A;  3J7A F;  3TEE A;  4M7A C;  3M4Y A;  2DO3 A;  1VQL A;  2DXC A;  1KC8 U;  4C92 B;  1XQH A;  1PSE A;  2XDP A;  4C0Z A;  4BI8 B;  5D6X A;  2JN0 A;  3H6Z A;  5CKB A;  4C5E A;  4F7U B;  2EQJ A;  4M78 D;  4C92 C;  3CCS A;  2X4Y A;  3TRE A;  5LJ5 f;  5LJ3 h;  1VQ8 A;  2QA4 A;  3M58 A;  4C8Q C;  1VQ4 T;  3A8G B;  4M77 D;  1VQ6 T;  3VYH B;  1VIE A;  3OBW A;  3X28 B;  1N9R A;  1G5V A;  2MI6 A;  3MP1 A;  3OS2 A;  4E7K A;  1FX7 A;  1VQL T;  1KQ2 A;  2KDS A;  3QPH A;  1KQS A;  1UGS B;  4HT8 A;  5HY6 A;  4PJO E;  1EIF A;  4M77 A;  3JCM d;  4M7A F;  3CEY A;  4A4K A;  2IG0 A;  4F7U F;  4F7U E;  1DJ7 B;  4OP0 A;  1K9M U;  3P8H A;  2XID A;  2QQB A;  3INZ A;  1N9S A;  3LWI A;  3CCM A;  1I81 A;  3S3N A;  2LRQ A;  2NLU A;  5A2Q E;  4BE0 A;  5GAN 5;  4A4H A;  1NJI U;  2RD1 A;  3V7C A;  3JCM Q;  4CI0 C;  1M9S A;  4BI3 A;  3CC2 A;  3ZFJ A;  2BIV A;  3WXM B;  2DK3 A;  3PMT A;  1VQN T;  4OGC A;  4OGE A;  2QXF A;  2HNI A;  3JCM X;  1YI2 T;  4M7D G;  2CYZ B;  2DZC A;  4IUV A;  4XTY A;  4C0F A;  4M78 F;  3HRS A;  4HCB A;  3RMS A;  1MGQ A;  3M56 A;  3DLL A;  4LDV A;  5CAI A;  5CKD A;  4ME7 A;  2OTL A;  2X4W A;  3JCM V;  4RCC A;  3RUX A;  4EDU A;  2CZ1 B;  1VQM A;  4JLI A;  4N0A C;  1ZQ1 A;  3OSV A;  4VUB A;  4WF2 A;  3UDC A;  3MEW A;  3R6O A;  3X26 B;  3HPW A;  3G6E A;  4N4G A;  2KSS A;  4M78 G;  2MWO A;  4NOY A;  4XK8 E;  3OS5 A;  1Q82 U;  5GAN j;  3CMA T;  4FT4 A;  3ZEH A;  4BDY A;  3FC3 A;  2X4J A;  2EJ9 A;  1Q7Y U;  5GAN 6;  3BW1 A;  3OY9 A;  4M77 B;  2RJF A;  2K3X A;  5DY9 A;  2QEX A;  3MET A;  5CKH A;  3G71 A;  2R5A A;  5GAN 8;  4NL2 A;  3N5B B;  4C8Q A;  3NTI A;  3LLR A;  3VUZ A;  4M77 E;  3MHX A;  3PTA A;  1K8A U;  4O5V A;  3OYA A;  4ZGD B;  4J7F A;  3DB3 A;  2LVM A;  3KXT A;  3AHU A;  5GMK h;  2DVE A;  1OYX A;  2H3J A;  4XU2 A;  1VQ8 T;  3X25 B;  2RHZ A;  4LDX A;  3EAE A;  4ZGJ B;  2E6N A;  1KD1 U;  3OA6 A;  1X6O A;  3CPW S;  3V8L A;  3GNG A;  1O9S A;  3FLG A;  4C8Q G;  1VQK A;  3OS1 A;  3A8H B;  2ZPG B;  3L2W A;  2RHI A;  4A4G A;  4J83 A;  3OYE A;  3UPU A;  1KQS S;  3PNW C;  2ZCF B;  3OYK A;  3S3O A;  1UEB A;  2M1H A;  2EAY A;  2RJE A;  2E70 A;  3L2Z A;  2I2L A;  2Y4X A;  4N4I A;  4B9W A;  3QDR B;  5CR2 A;  3I55 A;  4M7D F;  5LJ3 e;  3LWH A;  2X4X A;  1O75 A;  3HFN A;  1PSF A;  3GPL A;  3LW5 E;  5GMK l;  2GFA A;  1KHI A;  2A3L A;  5GMK m;  1NPP A;  4PLI A;  1M1K C;  2PUO B;  1YJW T;  3DB4 A;  4DQ2 A;  1BI0 A;  2LQK A;  4Y91 A;  2JVV A;  4QVC A;  3VKI A;  5LJ5 j;  1WQ7 A;  5GAN 4;  5GAO q;  2DXT A;  1B34 B;  3HL8 A;  3OB9 A;  4M75 B;  5GMK j;  4C92 G;  4RG8 A;  1VQ9 A;  3P8B B;  2DTO A;  5LJ5 e;  4HCZ A;  1G3T A;  1KD1 C;  1AHJ B;  4L59 A;  4J6X A;  4MML A;  2WSE E;  5DLO A;  2DEQ A;  3CME A;  1U8R A;  1I5L A;  2KAF A;  4PKC C;  1YBY A;  1G3S A;  3CCU T;  3JB9 H;  4XU3 A;  4A53 A;  4X9C A;  3CCV T;  2XK0 A;  4M78 E;  4N4H A;  1KG1 A;  5FRN A;  3JB9 G;  1JJ2 A;  3H8Z A;  2DIQ A;  4BY6 B;  4MZP A;  1JB0 E;  3FIF A;  3OYG A;  3CC4 T;  5GAN h;  1K9M C;  1QP2 A;  1QVG S;  1LJO A;  2EYQ A;  2RK2 A;  4FIB A;  3OYC A;  2KMT A;  3OYJ A;  4HA8 A;  1YHQ A;  4BD3 A;  2BUD A;  2F5K A;  4XTW A;  1G3Y A;  1N8R U;  2O4X B;  3CCV A;  4JRQ A;  1X75 C;  4RKU E;  1Y96 B;  3L2R A;  5A0G A;  2M16 A;  4ZTF A;  4ZTJ A;  1KC8 C;  2DKG A;  1M90 C;  3E1S A;  2RH2 A;  2RO0 A;  3I55 T;  2KVQ G;  4XU1 A;  3V7S A;  4R56 A;  1NPR A;  3WVE B;  2XKO C;  5LL6 S;  1Q86 C;  3JCM g;  2CZ0 B;  2DAQ A;  4PJO F;  3CMA A;  1YJ9 A;  1VQ5 T;  2LQ8 A;  1M8V A;  4QQ6 A;  3OW2 S;  5GAM g;  2PVD B;  5CK9 A;  1M5Q 1;  1KHC A;  2ZPH B;  3SB2 A;  5GAN f;  4LDY A;  3ZBD A;  3LYI A;  5CVI A;  3F70 A;  3M4G A;  5J3B A;  1Q82 C;  2E41 A;  1YIT T;  5GAN 3;  1I8F A;  4ZN1 A;  2O4X A;  3L1A A;  2LTO A;  4E7I A;  3KUF A;  2L3R A;  2RI5 A;  2L5Q A;  4LD9 K;  3SWN A;  3C95 A;  4XAX B;  4R55 A;  3G71 T;  1FXX A;  3M55 A;  3OW2 A;  4PJO B;  5A0L A;  3GF5 A;  4A54 A;  1BIA A;  4C0D C;  4EMG A;  3ASK A;  3RES A;  1FWZ A;  1BI3 A;  3A5Z B;  3OS0 A;  3JCM W;  3CCJ A;  4J6W A;  2P0K A;  3MCA B;  2EQK A;  2FVU A;  2O01 E;  5IAY A;  3SD4 A;  3JB9 D;  1MHN A;  2YRV A;  3RKY A;  4M7D E;  2VXE A;  5LJ3 j;  4JLG A;  3QJY A;  1Q86 U;  5CKE A;  3M53 A;  2HD0 A;  3HRT A;  3SFM A;  3SWN C;  3JRZ A;  2R5M A;  1BKB A;  2WSF E;  2YHT A;  3S6W A;  4F7U G;  3CD6 A;  5FU6 C;  1JJ2 S;  4PL6 A;  2LX9 A;  3WVD B;  2ZZD A;  4BI4 A;  3HSB A;  2K5I A;  5IN1 A;  1W2B A;  4PNO A;  1TH7 A;  4Y28 E;  2EQU A;  2XU8 A;  1H3Z A;  1UB4 A;  3QZ9 B;  4QW2 A;  2JZ2 A;  2R57 A;  4IUR A;  4YTL A;  5GAN 7;  3OYF A;  3MP6 A;  1HK9 A;  2HBP A;  5GAO p;  2HAX A;  5KE3 A;  4GY5 A;  3RMQ A;  4A4E A;  1IRE B;  3X24 B;  5FRM A;  4MZM A;  1YIT A;  1UGR B;  3M54 A;  2QTX A;  4HCC A;  1OZ3 A;  2DZ9 A;  4E7H A;  3QG1 A;  4J7I A;  2IVW A;  2E12 A;  1QP3 A;  4JUV A;  3URG A;  3L42 A;  1YJW A;  3CC7 A;  2FYK A;  4X9D A;  1M1K U;  3SDZ A;  4O6J A;  4ELY C;  3GNF B;  4EPC A;  1Y7X A;  2QQR A;  4XTU A;  3RKX A;  1K8A C;  3BFM A;  4M7D C;  3UT1 A;  5J39 A;  3EFS A;  2DIG A;  4P5N A;  4FU6 A;  4IUT A;  4OB3 B;  2P0Q A;  2EWN A;  1K73 C;  5A0D A;  2V8K A;  5GAN e;  1Y71 A;  1UGQ B;  4OVA A;  1HXD A;  2VGN A;  4FSX A;  2OTL T;  3JCM h;  3CME T;  2WAC A;  4BAC A;  2B8A A;  2EQM A;  2JNG A;  4A4F A;  1WJS A;  3A8O B;  5HK0 A;  1BI2 A;  2MMP A;  2L89 A;  2YLC A;  4M78 B;  1LOJ A;  5GMK i;  3O8V A;  4C0D B;  1YIJ A;  3CCQ A;  2P4T A;  3MP8 A;  1VQP A;  3RER A;  4PLL A;  3J80 E;  3CPF A;  5I2S A;  3BY7 A;  2ZPB B;  2VYT A;  3NTK A;  4C8Q E;  3S3M A;  1D3B A;  3JCM c;  2QQS A;  2E6Z A;  1M1G A;  2LT1 A;  3JSC A;  2DXU A;  3OYD A;  2RHU A;  4ELZ C;  5HKC A;  2MAM A;  4JRP A;  5LJ5 g;  5GAO m;  2CKK A;  2AHJ B;  3TU4 K;  1G3W A;  1YCY A;  1WJR A;  3GOX A;  4OF1 A;  3OYH A;  3CCQ T;  5J26 A;  2OTJ T;  4M7A E;  5D6W A;  4MZT A;  5GAN d;  4OMF B;  5AYF A;  3GP8 A;  3I56 T;  4QQD A;  4IUP A;  3VV0 A;  3CCE T;  1BYM A;  2XI9 A;  2CZ6 B;  4E7J A;  4NL3 A;  2EJG A;  2DPP B;  2RHY A;  3FRN A;  3OMC A;  1QW1 A;  1WGS A;  4XTZ A;  1D3B B;  2RI2 A;  5LJ3 d;  5M9O A;  3LX7 A;  2RB6 A;  1VQM T;  1WNL A;  1N6A A;  4M75 G;  5GAO n;  3L2U A;  2OTJ A;  2QQ9 A;  2KY9 A;  2VC8 A;  3PIP A;  1ZHI A;  2M0O A;  3OYM A;  4FM4 B;  3PMI A;  4J6Y A;  3TCJ A;  2G3R A;  1VIF A;  3QKJ A;  4QVD A;  3OYI A;  3HHT B;  4J5Y A;  3JCM P;  3CXC A;  5I2M A;  2XHC A;  4RG2 A;  4C5I A;  2JTF A;  4BE2 A;  2JOY A;  2ZGW A;  4N0A A;  3JAM E;  3P8D A;  3HP9 A;  1R8O B;  4M78 A;  4C92 D;  3OYL A;  2RI3 A;  1N27 A;  3X20 B;  2LCL A;  4JS5 A;  4C8Q F;  1RI0 A;  4XTV A;  4L6V 5;  3L2Q A;  3VYG A;  2VXF A;  3MEV A;  4FT2 A;  4JRI A;  4ZN3 A;  2C06 A;  4PJO A;  3CXC S;  3A8M B;  3UWN A;  3BDU A;  3CD6 T;  2RM4 A;  2WSC E;  4M7A B;  4E7L A;  1VQ6 A;  2E65 A;  1WPY A;  2P0P A;  3CBM A;  5KCO A;  5KH6 A;  3FDR A;  1X01 A;  3LH0 A;  4M78 C;  3VU3 C;  2YLB A;  5CO7 A;  4BY6 C;  2RA2 A;  4C8Q D;  1JRI A;  1VQO A;  5CIU A;  5GAO l;  4LDW A;  2M9U A;  3FJP A;  3HRU A;  4BUG A;  4C8Q B;  3LGL A;  2GF7 A;  3V8J A;  2XD0 A;  3QYH B;  1VQ9 T;  4IKF A;  4M75 D;  2A7Y A;  1OZ2 A;  2V8J A;  5GAN 2;  1YI2 A;  3HFO A;  4PJO G;  1WQW A;  3CBO A;  4L5G A;  1VUB A;  2GFU A;  4XU0 A;  2QEX T;  1GXI E;  4BB7 A;  2R58 A;  3G4S A;  1OI1 A;  2CS7 A;  2RJD A;  4C92 E;  3CC2 T;  4J8O A;  4EMK C;  2RHX A;  3ER0 A;  1VQO T;  1N8R C;  2E1H A;  4M75 A;  3VJP A;  1Q81 C;  3CCU A;  2K3Y A;  2XDB A;  3QII A;  2OAU A;  4QQG A;  3G6E T;  5GAM h;  3DLM A;  4BE1 A;  3QSU A;  1M4Z A;  2PUK B;  3BDL A;  3QZ5 B;  1W4S A;  2Y90 A;  2CGH A;  3GIB A;  4GLK A;  3DKM A;  5GAM j;  5CQX A;  1K73 U;  4EMK A;  3CCE A;  1W2B S;  4JRK A;  4M77 F;  4XTX A;  3J81 E;  4JS4 A;  4M7A A;  2XDD A;  4II1 A;  4PJO C;  5LJ5 d;  4DOW A;  2LNV A;  3JB9 F;  4NS5 A;  2Y4Y A;  1RL2 A;  3HKS A;  2PQW A;  3M5A A;  4LDU A;  2D0Q B;  3CC7 T;  4KUI A;  4KUD K;  3M59 A;  3Q1J A;  5GAN g;  3CCS T;  2FL7 A;  4C92 A;  3JB9 I;  4M7D A;  3JCM J;  5L8R E;  5GAM f;  3CC4 A;  2QI2 A;  5C6S A;  2HQE A;  3NTH A;  3SWN B;  3JCM f;  4C5G A;  2E5Q A;  3G4S T;  2GQV A;  1ZBX A;  2XIC A;  3ME9 A;  1U1T A;  3A8L B;  1NE8 A;  2X35 A;  4KBM B;  4MMK A;  2K5F A;  3JCM b;  5FRO A;  3C12 A;  1S72 A;  1U1S A;  1VQ7 A;  4OB1 B;  2ZPE B;  4M77 C;  3V7R A;  1Q81 U;  2ZPF B;  1VQK T;  4MDW A;  3PT9 A;  3PFS A;  3RKW A;  1WJQ A;  3E9F A;  2RK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...