2RI5A

Crystal structure of the 3-mbt repeats from human l3mbtl1 with n358a point mutation
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
314
structure length
312
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMAPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 74
structure length 312
sequence length 314
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri5A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri5A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri5A03
2FHDA 2GFAA 5KE3A 2E6NA 4ZTFA 2RHZA 3OMCA 2D9TA 3DB4A 3NTHA 2BIVA 2MWOA 4Q5WA 3H6ZA 3S6WA 3OY9A 3L2UA 4E7LA 4IUQA 3MEUA 2BUDA 2R5AA 4UC4A 3UWNA 3MEWA 2RHXA 4X34A 1OZ2A 2LRQA 4B9WA 3QBYA 4IUTA 3OS1A 2EKOA 4QQGA 2M1HA 1SSFA 3PNWC 4A4HA 2X4XA 2X4WA 3M9QA 2YRVA 4C5IA 2LVMA 2JTFA 1OI1A 3LLRA 3ME9A 3E9GA 2RJEA 5C0MA 4E7IA 2L8DA 3MP1A 3QIIA 3P8HA 5FROA 1OZ3A 3S3NA 4HCZA 2MWPA 3OS0A 2G3RA 2GFUA 4BE2A 3MP8A 2DAQA 2B8AA 3DLMA 4E7JA 3OQ5A 3L2VA 1WJSA 3F70A 2EQKA 2M16A 3OYCA 3P8DA 5D6XA 2RJFA 5J39A 5KCHA 2NLUA 4C5GA 2R57A 4PLLA 2XDPA 3OMGA 2X4YA 2JZ2A 3LYIA 1WJRA 3OYDA 2EQJA 2GF7A 4C5EA 5CIUA 1RI0A 5KE2A 4NS5A 3DB3A 4A4FA 2HQXA 4N4IA 4BDZA 2P0KA 3MP6A 3MEVA 4LD6A 2L3RA 2RI5A 3S3MA 3KUFA 4PLIA 4BACA 5D6YA 5IAYA 3OYAA 2PQWA 1MHNA 2O4XA 3LH0A 2F5KA 3PMIA 3FEOA 3OYBA 1G5VA 3OYJA 2HQEA 3PFSA 2RI3A 3ZEHA 4BD3A 4BE0A 2RO0A 2RHUA 3OYLA 2CKKA 3MO8A 3OB9A 1OYXA 3UT1A 3O8VA 3C4SA 2WACA 4RG2A 2E5QA 4II1A 4BDYA 4A4EA 3FLGA 4QQ6A 3S3OA 3QJ6A 3LGLA 3MEAA 3FDRA 4QVZA 3META 5KH6A 3OS2A 3L2WA 4B9XA 3OYNA 1WGSA 2LDMA 2R5MA 2RJDA 3NTKA 4IURA 2O4XB 2QQRA 4L59A 3SD4A 3OYEA 4IUUA 3OYGA 4GY5A 4CRIA 5FRNA 3L42A 1H3ZA 5D6WA 5KCOA 4IUVA 2M0OA 4ZTJA 2BKDN 2DIGA 3L2RA 2EQUA 2RI2A 4C5HA 3OYMA 5C6SA 4N4GA 2X35A 3OYHA 4E7KA 2DIQA 4QW2A 3ASKA 3GOXA 2VYTA 4EDUA 3OYIA 1XNIA 3Q1JA 2R58A 4IKFA 3FC3A 3QKJA 2EQMA 4FL6A 3OYFA 2RJCA 2RHIA 5J26A 1N27A 2L89A 3OYKA 2QQSA 3L2QA 3NTIA 4A4GA 3LGFA 4PL6A 5FRMA 3BDLA 2RHYA 3E9FA 3H8ZA 3EAEA 3LX7A 1WJQA 4E7HA 4Z02A 4IUPA 3OA6A 4OVAA 4QQDA 2XK0A 1KHCA 2IG0A 5IN1A 2EFIA 3PMTA 4FU6A 4BE1A 2K3XA 4N4HA 2LTOA 2LCCA 3CEYA 2K3YA 5M9OA
chains in the Genus database with same CATH superfamily
2D0NA 1VQ9T 3S6WA 3INZA 1WA7A 2XHCA 4C8QD 4FSSA 2CS7A 5LJ5h 2JJ9A 2GCXA 3M5AA 3OYYA 4ME7A 3CC7T 3VUZA 3QIIA 2I2LA 5GAMf 2QASA 5GANe 1OZ3A 1K73R 1YP5A 3JB9H 4J7IA 3PTAA 2HDAA 3HRSA 3QZ9B 1D0XA 2RJFA 1KQSS 2VVKA 4C8QA 2BZYA 5KYYA 4OMNA 3MP6A 3QYGB 7AT1B 3DLLA 1UFFA 2CSQA 3CCUQ 2JNGA 3RKWA 4FM4B 2KI7A 5HK0A 2HQEA 2RI3A 5J3BA 2CKKA 1OYXA 1JQQA 4N0AA 1JB0E 1XJWB 2WACA 1VA7A 3UF4A 3QJ6A 2E10A 3FDRA 5KYUB 2A7YA 1YI2T 2OTJT 4FCYA 3ER0A 4ZGDB 3REAB 1RI9A 3OW2S 4GY5A 1UTIA 1WHJA 5KCOA 3A98A 4LDWA 1I1JA 4CC4B 1GXIE 4EPCA 2XDDA 2RK2A 5CCAA 1YJ9A 1S72Q 1IGUA 2IVWA 3QHSA 4PL6A 3TCJA 4MMKA 1VYVA 4RTVA 4PNOA 1YHQQ 4ANJA 2XK0A 1ZSZA 4PJLA 1WIEA 4JZ4A 2ZPGB 1PSEA 1UJ0A 1VQ5Q 1G3SA 4J9GA 2RHZA 4E7LA 4UC4A 1KFZA 3PIOA 1BBZA 5GMKj 2KT8A 1NLPC 3CCSQ 3CCET 3JB9G 1ZSGA 3GBQA 3CPFA 3CBPA 4LDXA 3MP1A 1N5ZA 2MPXC 1SKUB 2MWPA 3JCMQ 3DKMA 2H3EB 3V7RA 3L2VA 1TOVA 5J39A 1N8RR 2SEMA 3CC7A 1SRMA 5GAMe 2F5TX 2RA2A 4J9EA 2YRCA 3KXTA 1D1BA 2EQJA 3VRYA 1RI0A 1Q82U 4OMOA 1TUDA 4O6JA 4RKUE 4RMOA 3CMEQ 1VIEA 1K9MR 4E2FB 4PJOE 4M7DG 1AHJB 2EYXA 2LT1A 2C0OA 4IIMA 3QWXX 3RKXA 3MO8A 3OB9A 2DTHA 4J6XA 4C92D 2XMFA 2GTJA 3JCMc 1M1KC 1ZUKA 4LUEA 3META 1VQ7T 2MOXA 2QGFB 5CQXA 5DLQE 2HAXA 1JO8A 2JMCA 3L2RA 2C0TA 2RI2A 1YI2A 2OTJA 3EG1A 5CKDA 1TU0B 1Y07A 2LCSA 2K5IA 2MIOA 2H8HA 2RJCA 4DBQA 3OYKA 2YXYA 4VUBA 2RHYA 5CR2A 1M8MA 3VYGA 1NE8A 4A53A 1R0BG 3NPFA 1Y71A 2P4RA 2CGHA 2EGAA 1BU1A 2MWOA 1K0XA 3JB9I 2RB6A 1WX6A 1VOMA 3G71T 2LNVA 4X34A 2X4XA 1B7TA 1UGRB 4D8KA 3M0PA 3CMAQ 1OI1A 3E9GA 3CC4T 3E19A 5GAOp 1BI0A 2G3RA 5GAOl 3A1PA 5HY6A 3CCEA 1K76A 2KRSA 4LUDA 1CKBA 5A0GA 1M3CA 1LPLA 1TXQA 1UEBA 1H92A 2F69A 2V8JA 3VS2A 4XU3A 4DBRA 1M90R 3OMGA 1V76A 3EFOA 1B3QA 4M7AD 4M78C 1QLYA 2KXCA 3DB3A 4QVDA 3URGA 1YWOA 2HQXA 2LMJA 1B34B 5GAN8 4AFZC 2QAZA 2ESWA 3VS5A 4L6V5 3BFMA 2DMOA 4PLIA 1MHNA 3CCLQ 3GLXA 3CCQQ 3AT1B 4M78B 3CCUA 4LD9K 1RAEB 2YUQA 2D6FA 3JCMV 4M75C 4M7AA 3EGDB 4DBHA 4BDYA 1ZA2B 4J9DA 3RDVA 4HVWA 5GAN4 4C92C 4F7UF 3CCJT 2V1QA 2CP5A 4DOVA 3I35A 4IUUA 1VYTA 1YJNT 1YITQ 3RUXA 4M75B 5D6WA 1VQ6T 4IUVA 2NYSA 4C92B 3BW1A 2WSFE 1KD1C 1ZLMA 1OU8A 2QDYB 2YDLA 2JS2A 2F1LA 1MV0B 4C8QE 2LP5A 1RAIB 1VQKQ 4DQ2A 5GMKl 2XDBA 1MNDA 2EW3A 4IUPA 3EH2A 4QQDA 1JXMA 3JCMh 1YHQA 2DL3A 2FHDA 9ATCB 5CK9A 3ZL7C 4ZTFA 3EHRA 2FPEA 1MNEA 4B6MA 2AKKA 4LN2A 3QBYA 2E3HA 4FT4A 5GANd 2JTFA 3SDZA 1N9SA 1UB4A 2L8DA 1WXUA 1M9SA 2GGRA 3OQ5A 1V29B 1ZX6A 2DL8A 2YUNA 4OMLA 3ZFJA 3OYCA 2HZYA 2J6FA 2KK4A 4XU2A 2EYZA 1WJRA 5IHNA 1NJIU 3RMQA 2EKHA 2YSQA 3UDCA 2H3JA 2RNAA 2QQAA 2ZCFB 5FU7C 5KYWB 4NL2A 4JRQA 2A08A 3CCLT 3MEVA 2ZZDA 4M4ZA 4GBQA 3CMEA 4RTZA 3WXMB 2DL7A 2MAMA 2O4XA 4DEYA 3MKDA 2FRWA 5FU7B 3QUIA 2JTMA 3UT1A 2ATCB 2LX7A 1TG0A 3TREA 1Y0MA 3QXEB 4DOWA 1IHWA 1AT1B 3HRTA 4QVZA 2RD1A 3OS2A 2FL7A 2LDMA 2RJDA 2QQRA 2W0ZA 4R0KA 2FPFA 4KGZB 1FXXA 1IREB 3HPWA 2EAYA 1C1AA 1BI1A 4DBFA 4LXCA 1I8FA 2HSEB 4XTZA 1E7OA 3CC2Q 2EQMA 4MZPA 1KC8U 1AEYA 4PJOD 2JN0A 3LGFA 1H3HA 5IH2A 1K1ZA 2CP0A 3LX7A 1E6GA 2YUOA 5I2MA 4IIOA 2A3LA 5IN1A 3EGXB 1NPPA 3M4GA 1I81A 1OV3A 2DERA 1O75A 1K9AA 4B9WA 2C0IA 1ZHIA 2CT4A 2EGEA 2J7IA 3V7CA 4BI4A 4PJOA 1JBMA 3LLRA 2CYZB 2LJ0A 2EPDA 2M9UA 2ECZA 3S3NA 2DK3A 1QKWA 2JXBA 3CCRT 2E12A 2GQVA 2X51A 3A8OB 1I5LA 1SG5A 5IXFA 2R57A 2DBKA 4Y91A 2KRMA 3MPUB 2A0FB 2P4TA 1WQ7A 5GANf 2ZAEA 4F7UG 1VQ9Q 2KXDA 2K79A 1PM3A 5CIUA 1WHLA 1ZBJA 2WSEE 4AMCA 1UHFA 4N4IA 1TUCA 3ZBDA 2RH2A 2D1XA 2Y4YA 2RI5A 1RAGB 4RTTA 1J3TA 3AHUA 1X6GA 2F5KA 2HBPA 4J6YA 2DD4A 1YJWT 4P5NA 2OTLT 3CCLA 3G7ZA 3CCQA 4M77C 2AHJB 1C0MA 3OYLA 4J6WA 2D0QB 4II1A 3MJXA 3FLGA 4MDXA 5HKCA 2EIFA 1NM7A 2FZKB 1WHHA 4WCIA 1D3BB 1PCXA 1EX4A 2FEIA 2CH4A 1TUGB 3CPWA 3IQLA 3EG2A 1D0ZA 5CKBA 5FRNA 4X9CA 1ABOA 3OYMA 3CC2T 1K8AU 1YITA 3RNJA 4OB1B 3N5BB 3SHWA 2JW4A 1PRLC 2FPDA 2K2VA 3G6EQ 1KQ1A 5GAOm 4X9DA 1M1KR 4OMFB 2KEAA 1IO6A 1I07A 4PJOC 2EQIA 5GAN3 4V2SA 2KR3A 3TEEA 3VU3C 1YN8A 4J5YA 4RCCA 4JRPA 2NUTA 2GFAA 1B07A 1XTDA 3A5ZB 1H641 2FO0A 1WDXA 2YUPA 3NTHA 2BIVA 2DNUA 3LWIA 4M7DF 2QI2A 2SRCA 2DJZA 2J6OA 2RHXA 4PJOB 1TS9A 1NYFA 4HT9A 1T3SA 1SRLA 1RAAB 3QSUA 3UATA 4M7AE 4KT0E 4JRKA 2CZ7B 4CC7A 2HMAA 1BIAA 2CH4W 5D7UA 4A4KA 2DZCA 1FMVA 1ZA1B 3JCMg 1AWOA 1OULA 1KHIA 2XDPA 4MDWA 4FYWB 2E41A 3QDRB 2MCNA 3M59A 3JCMX 2LNHB 3QWYA 3KUFA 3CCEQ 5L8RE 5GAN7 2O01E 3JB9D 3GF5A 3CPWP 1M30A 3M54A 2BTTA 2RO0A 5GMKm 2OAUA 2LJ1A 3H0IA 3O8VA 1VQMT 4RG2A 1YJWA 3MHXA 2DA9A 2QTVA 2RQVA 2CUBA 1WZOA 3FB9A 2CP2A 4Y92A 4CI0C 2V8IA 4AFSC 4XU0A 2ZPEB 5DLOA 3GP8A 1WNLA 3CPWS 2KDSA 1LNXA 3G6ET 3VYHB 3VS1A 4KBMB 4M7DD 1JJ2A 2VKNA 1KSWA 4O5VA 2M02A 5GAOn 5AYFA 2DM1A 3PGGA 2JMAA 3EFRA 3CC2A 2RQTA 1WI7A 3EAEA 2HKQB 1WJQA 1QP2A 3EG9A 2IG0A 1R77A 1BYMA 1Q7YR 1VQ7Q 1RLPC 3R6OA 1ZUYA 1YWPA 4ATOA 4XTUA 5LJ3h 4M7DA 3UWNA 4JJCA 5GAOq 1K73U 1SPKA 2YRVA 3UA6A 2RJEA 2M0YA 1BI3A 2A36A 2VWFA 1I0CA 4Z88A 2C06A 1SHFA 2B8AA 2LQWA 4F7UE 4M75F 4JJDA 2DPPB 1Q81C 5AT1B 3J7AF 3WVEB 5A0DA 4C8QC 3GNFB 3G71Q 1VQ9A 1PD0A 2E65A 2WSCE 1GCQA 1WXBA 3FRNA 1AZGB 4OMQA 1NG2A 3PMIA 3CC4Q 4C8QB 2RQRA 4LDVA 3TVTA 1GCPA 1H8KA 5KYYB 2DO3A 2JOYA 2FZGB 3A8MB 2MYSA 2IPOB 4JS5A 2O9VA 2F2VA 3V8LA 1JJ2P 1OPLA 3RMSA 4N0AC 4BB7A 1S1NA 3HHTB 2R5MA 3SB2A 3TSZA 2FRYA 4JLGA 1VQMA 1UGQB 2J6KA 4HCCA 3H0FA 4PJJA 4JUVA 3VS3A 2OX7A 1AOJA 3OYHA 4E7KA 2KT1A 2AZVA 5GANh 3CXCA 5FW9A 1PD1A 1N27A 5A2QE 3G6EA 2QA4T 2VUBA 1BCMA 3L2QA 5FRMA 4CC2A 1FMWA 3PMTA 3REBB 3CCJQ 4FU6A 4DA4A 3CEYA 4AFQC 1ZSZC 2Y90A 1JU5C 5DY9A 1YJNQ 1GL5A 1VQ6Q 1R0CB 2L3PA 1RUWA 2LRQA 4IUTA 4KGXB 4QKUA 1P92A 3OS1A 2P84A 2M1HA 1K0SA 1W70A 2NUPA 3A8HB 1RABB 4C5IA 5LJ5d 3ME9A 1ZSZB 3QPHA 1M2OA 1Y57A 1YBYA 1N8RU 2KYBA 2KNBB 4XTXA 1JEGA 1N9RA 2YRDA 2DAQA 4JRIA 3RIRA 2K3BA 2DF6A 2EJGA 5GMKe 2DD5A 3ULRB 5IHIA 1OU9A 2CZ6B 2HD0A 1BKBA 4C5EA 1K9MU 2DRMA 3HSBA 1M8VA 4X1VA 4A4FA 3UA7A 4BDZA 4EMKA 2DKGA 1O9SA 4HVVA 3NHNA 1YFNA 1KQ2A 2YLBA 2VGNA 3J80E 2YT6A 4RUGA 1UGPB 2PU9B 2DXUA 1YIJT 5CKFA 2RHUA 3GPLA 2L5QA 4E47A 2VB6A 2CP7A 3CXCP 1PC0A 4LDYA 2PUKB 2CP3A 1M2VA 3OYNA 4MZMA 1Q95G 2CSIA 5CAIA 2E5KA 5LJ5g 1VQNT 1LCKA 1X6OA 4M78G 1SSHA 2DIGA 3OSSC 4XTVA 4QW2A 1NLOC 2X9HA 3QKJA 3OYFA 1ZQ1A 1X01A 2CP6A 1VQ8T 3CXCS 2DRKA 3TQ7P 3RERA 3M53A 2DVEA 1FMKA 1HSQA 2KSSA 2HQHA 4J9CA 4M75G 5A0LA 5GAMh 3EG0A 4L5GA 2AIRB 1T0JA 2PVGB 4NL3A 2QA4A 1QVGA 2E6NA 2K57A 4FYVB 2D9TA 1VQ7A 3H6ZA 3GIBA 3C94A 2KVQG 4QQGA 2EGCA 1UECA 2KRNA 1X27A 3M9QA 1SEMA 1Q86R 1G3WA 3OS5A 1U8RA 1PHTA 3EHQA 1UHCA 3I5RA 5HK3A 3GNGA 1M90U 4M77F 3CCVT 1UGVA 1PWTA 2FZCB 1Q82C 1BK2A 1PNJA 3F70A 5CKEA 3LW5E 1VQLT 2V8KA 3M4YA 5I11A 3EH1A 4C5GA 2X4YA 1X2KA 2BZ8A 5LJ5f 2GF7A 5KE2A 1JXOA 1WLPB 4AG1C 2OAWA 5GAN6 3G71A 1TH7A 4BACA 2K5FA 1AWWA 2L2PA 1XQHA 2DXBA 2GQIA 3EFOB 2LCLA 5LJ5j 3CC4A 2NWMA 3CCRQ 1QKXA 4PJNA 3S3OA 2QDLA 4M7AC 4M7DE 5GMKh 2V1RA 3SD4A 4QVCA 5DM7R 3VJPA 1G8XA 1Q86U 1QVGP 4M7AB 1PKTA 3E2UA 2DXCA 1UE9A 1YJWQ 3SWNA 2OTLQ 2Z0WA 4FL6A 3CD6T 1FYNA 1HXDA 4XTWA 3H9NA 3U23A 1TWBA 3I56Q 1WHGA 4RTXA 4F7UA 4E7HA 2EFIA 4OGCA 4RTWA 2K6DA 1AD5A 3CCJA 4J83A 2DL5A 2F2WA 3L2UA 1T0HA 1QVGS 1PRMC 2E4HA 4E6RA 1OZ2A 2FYKA 8AT1B 1UJYA 4J9HA 1YJNA 3RR6A 3VV0A 1VQ6A 2YHTA 2LVMA 2OI3A 2O88A 2BE9B 2QK0A 4BI3A 2M51A 1WPYA 3THKA 2CZ1B 3V8KA 5KCHA 3BY7A 2B86A 4ORZA 2XG8D 1UG1A 1VQLA 4JPBW 1DJ7B 1CSKA 2CREA 2X3WD 3FJPA 3S3MA 5LJ5e 5GAN5 3I9QA 3FEOA 3OYBA 1NZ9A 4JJBA 1U1TA 1Q81R 2EJFA 2RM4A 1AVZC 2PVOB 3C4SA 5GMKi 1QVFA 2P0PA 1W6XA 4KUDK 3OBYA 1Y96A 4Y28E 2QEXT 3M0TA 4Z89A 4ZGJB 3NGPA 2O4XB 1WYXA 1A0NB 3L42A 4HCKA 1PSFA 2DLPA 4TVRA 2EQUA 1M5Q1 4DEXA 1AZEA 1OPKA 4RTUA 3GOXA 1MMDA 2VYTA 3I56T 3CBMA 1MV3A 4M75E 2RHIA 1N6AA 3JSCA 4LNPA 5KYNA 1VQMQ 4M77G 2ABLA 3JCMJ 1KHCA 4D8DA 1KQSA 3CD6A 2E1HA 1D0YA 4ELYC 1F1BB 2KBTA 3JCMd 4C8QF 2Y4XA 3OY9A 4OGEA 2COZA 4IUQA 4AFUC 2X3XD 2E70A 1IZ6A 3JCMb 2EVRA 3HTRA 4MMLA 3PT9A 2VXEA 3HFNA 1NJIC 2JUFA 4ZN1A 4E7JA 3HL8A 1GFCA 1WJSA 3HFOA 5GAMg 3JAME 4PLLA 1LJOA 2MI6A 3VUBA 2HSPA 1FWZA 1QVFP 3X24B 3OW2A 1RLQC 4LD6A 3CCMT 2QXFA 4LDUA 1YJ9T 1VYUA 2O2OA 2YWWA 1ARKA 1MMNA 2DTIA 4PK4A 2DVJA 2LX9A 3G1JA 2E5QA 4A4EA 4QQ6A 2J05A 1IHVA 3R6NA 1MGQA 1RADB 3VS7A 3CCRA 3KBGA 1QVFS 5KH6A 3L2WA 6AT1B 3H41A 3FJ5A 2K9GA 1WHKA 1WXTA 4OP0A 1W4SA 1Y7XA 1ACMB 1KC8C 1M1GA 1KQSP 1M1KU 1G3TA 2QEXA 1MMAA 2O9SA 4N4GA 2X35A 3SFMA 3ASKA 2HL5C 3QDFA 3G4ST 2DL4A 2EWNA 2LC4A 1SHGA 2OTLA 2K4YA 3E9FA 3I56A 2MMPA 4XTYA 3M0RA 1SF9A 1QVPA 2GBQA 2GTOA 2LT4A 1IB8A 4AT1B 4EMGA 1EZZB 2ED1A 1M3BA 1GBRA 3VS4A 2HKNA 2JM9A 1GBQA 3MEUA 2R5AA 2L3QA 4QT7A 2A28A 5GAMj 1RAFB 2MK5A 5GAN2 3A8LB 3V7SA 4E7IA 3OW2P 3JCMf 4RCBA 1G3YA 2QA4Q 4C0ZA 1GRIA 2NUTB 5IT9E 4PFOA 4BE2A 2K2MA 2XICA 2COYA 4OMPA 4M78F 1NYGA 1KD1R 4OMMA 1X43A 3OYDA 4J9IA 1W1FA 2RQUA 4FYXB 3PVLA 4PKCC 4D6WA 1Q82R 1VQ4T 2D8HA 3NFCA 3OYAA 2GNCA 2HBWA 2ROTA 1G2BA 2KY9A 1HK9A 4C92F 4OB3B 1HJDA 4FW1A 2E64A 3CCMA 2NUZA 2JTEA 4AG2C 5FU6C 1UDLA 1VIFA 2HNIA 3MEAA 2DFUA 1K8AC 4J9BA 1QWEA 1WGSA 3M0SA 3QJYA 2EYQA 2ENMA 1X75C 1X6BA 2BZXA 4C8QG 4FW2A 2DEQA 3CBOA 3SEMA 5FU6B 4FSXA 1X69A 5C6SA 2D8JA 5HCKA 4M77E 4EDUA 1BIBA 1AWXA 1UUEA 2AT1B 1YCSB 1WFWA 1YIJQ 1Q7YU 1V1CA 1QMCA 2LZ6B 3BDLA 1RL2A 1KD1U 2K3XA 3G4SA 4N4HA 2LTOA 1PG5B 1MMGA 1VQNQ 1MUZA 4M78D 2BUDA 2QGGA 3MEWA 3VKIA 4M7DC 3PNWC 3QZ5B 1G83A 3EG9B 3CCUT 1JJ2S 4MZTA 3E1SA 2RF0A 2ROLA 5FROA 1B34A 1VQ8Q 1VUBA 3DLMA 2JS0A 4JJNK 2P0QA 2HEQA 2EYYA 2EQKA 2YLCA 4M7DB 1C6VX 2COWA 4M75D 4M78A 4M7AF 2JZ2A 4WF2A 3JCMe 3VRZA 1RACB 4EIKA 3JB9J 3EGDA 1VQOQ 1BI2A 1OQKA 4C0FA 1ABQA 3OBWA 5D6YA 5IAYA 3LWHA 1GCQC 4OB0B 3PFSA 3ZEHA 4BD3A 4PJMA 4M75A 3CCVQ 1S72T 4PFPA 3UPUA 4C92A 2KE9A 2VGMA 4R56A 1VQ4A 1VQLQ 3BE3A 1YHQT 4XQ3A 2K5LA 2KYMA 3BDUA 1Z9ZA 2A37A 2DILA 2AK5A 1VQ5T 3OYEA 4HXJA 3M58A 4CRIA 2EJ9A 3WVDB 2BKDN 2PVDB 1E6HA 3EGUA 2I0NA 3CCST 1QW1A 2DIQA 4E7ZA 2ZPBB 2DETA 2ZPFB 3C0CA 4JS4A 3X28B 5CVIA 4KULA 1XOVA 2L89A 1OEBA 2ZPHB 4A4GA 3NMZC 1EIFA 2K7AA 2XIDA 5KYXA 1K73C 1HYOA 2FVUA 4ZN3A 4KH1B 1UGSB 2PZ1A 1WHMA 1VQPQ 3QYHB 4FYYB 3CMET 2RK1A 5LJ3d 1QQJA 4XAXB 2EKOA 4RG8A 1SSFA 5LL6S 5KYWA 1I5OB 5C0MA 3X25B 3CD6Q 3P8HA 1D09B 4YTLA 2GFUA 2J06A 2LQKA 3MP8A 1QCOA 2RN8A 2FB7A 3L2ZA 2M16A 3L1AA 3RESA 3P8DA 4BY6C 4C92G 3QG1A 2NLUA 4JZ3A 4HT8A 1NPRA 1VQOT 4PFZA 3LYIA 1M4ZA 2NUPB 3I55Q 2P0KA 3I5SA 1KG1A 4BY6B 1NJIR 4EMKC 1Q7YC 1IXDA 2ZPIB 4BI8B 2V26A 4LE9A 2O31A 2DYBA 4F17A 4KGVB 3LH5A 1KJWA 4EMKB 4C0DC 3LGLA 2LJ3A 5LJ3g 2PNIA 2XU8A 2ZGWA 5FWCA 3PIPA 3NTKA 1KK7A 1S72A 5I22A 1LOJA 4L59A 2EBPA 2DJQA 3OYGA 2QTXA 2M0OA 3EGXA 4C0DB 4C5HA 3HP9A 1VQ5A 1X2QA 4OB2B 3CMAT 1QCFA 1M3AA 2BE7D 3Q1JA 3VS6A 4PJOF 2RPNA 1M2VB 2RMOA 5KYXB 4KH0B 3CCSA 1YIJA 2RQWA 1OX9A 3OA6A 2KAFA 3O5ZA 4OF1A 3X26B 4NS5A 2QEXQ 1KC8R 1R8OB 2K3YA 3M0QA 5FLXE 1VQPT 3D7SB 2DEUA 4M7AG 5KE3A 3OMCA 3DB4A 2X4JA 3M0UA 1N8RC 3H0HA 1HD3A 1VQNA 2OJ2A 4C0GA 5EC7A 5GJVB 1EFNA 3CCQT 1NEGA 4HKEA 1W2BA 4HCZA 1ZBXA 1K9MC 4FIBA 3C95A 3VS0A 5I2SA 4M77D 1VQ8A 3PE0A 5LJ3f 3I55T 1D1CA 4F14A 3JRZA 2DYIA 2QYZA 1IGQA 1FX7A 3RBBB 2DX1A 2QG9B 1RAHB 3PVQA 1YITT 5GANg 4KRTA 1D3BA 2L3RA 1VQOA 2HL3A 1TSFA 2DBMA 3C12A 3M55A 4HCBA 1D1AA 4F04B 1PKSA 2PQWA 8ATCB 2XD0A 3KFVA 2QQBA 2VASA 3LH0A 2DXTA 3OSVA 5LJ3j 2CDTA 4M77A 2AZSA 4E7SA 3OYJA 1G5VA 1YCYA 4BE0A 3JCMW 2EYWA 3HKSA 3V8JA 1K4US 2E6ZA 1VQKT 3CCVA 1OX8A 4J9FA 4GLMA 3EG3A 3X20B 4WTOB 4B9XA 2W10A 4IURA 1NBEB 2VXFA 5IXBA 2KMTA 3QO3A 2CUDA 1M27C 4ZTJA 4FT2A 1YNZA 1M1FA 1LVKA 3CCMQ 3JCMP 2L0AA 1YJ9Q 4XK8E 4IKFA 2FG0A 3FC3A 1AWJA 5L23A 5ECAA 2HCKA 3SWNC 1K8AR 4M78E 5GJWB 3NTIA 3H8ZA 4Z02A 3EFSA 4BUGA 2LQ8A 3CMAA 2IIMA 4BE1A 1W2BP 3M57A 2LCCA 5FWBA 5GAMd 4RTYA 3JV3A 1I4K1 4A54A 1U5SA 2KROA 4Q5WA 3SWNB 2ED0A 4ZGEB 1M90C 4R55A 4KUIA 2PTKA 3HRUA 1VQPA 2JT4A 4A4HA 4F7UB 4K11A 2DE0X 2X4WA 4C92E 3G4SQ 4GLKA 5CKHA 4Z8AA 4HA8A 3OS0A 4ELZC 1W2BS 3RKYA 3CC7Q 1T3LA 2JM8A 2KGTA 3P8BB 3J81E 5D6XA 5GAOr 4XU1A 4HVUA 5GANj 4J7FA 2AKLA 2F2XA 2QQ9A 1GFDA 3TU4K 1CKAA 2XI9A 3CQTA 3M56A 2VC8A 2PUOB 1QP3A 4JLIA 1QWFA 5CO7A 3I55A 5LJ3e 3JB9F 3MCAB 4F16A 1Q81U 4M77B 3FIFA 4JDSA 3T9NA 2JVVA 1IRXA 4CC3A 5I21A 2DTOA 2XKOC 4PJOG 1BB9A 4ESRA 1OOTA 1JRIA 1WQWA 1Q86C 1ZUUA 5KYUA 1VQKA 1TTHB 2CZ0B 1YI2Q 2OTJQ 1H3ZA 2MF2A 1U3OA 2L3SA 3TSWA 4NOYA 1BCOA 4A63B 1VQ4Q 1QCNA 4J8OA 4EMHA 1Z9QA 2KQWA 3OYIA 1XNIA 2E3IA 2R58A 5EG2A 5IHKA 1Y96B 1U1SA 3A8GB 2VV5A 5J26A 4ZNXA 2QQSA 1KIKA 1NEBA 2DZ9A 4OVAA 2LQNA 5CQYA 2CT3A 2G6FX 1U06A 5M9OA
chains in the Genus database with same CATH topology
2PVGB 4NL3A 2QA4A 1QVGA 1VQ9T 2E6NA 2K57A 2D9TA 3S6WA 1VQ7A 3H6ZA 3INZA 3GIBA 2XHCA 3C94A 4M78D 2KVQG 4C8QD 2BUDA 3MEWA 1O75A 3VKIA 4B9WA 1ZHIA 2CS7A 5LJ5h 4QQGA 4M7DC 3PNWC 3V7CA 3M9QA 3QZ5B 2GCXA 4BI4A 3CCUT 1JBMA 1JJ2S 3M5AA 3OYYA 1G3WA 4ME7A 3LLRA 2CYZB 4MZTA 3OS5A 1U8RA 3CC7T 3E1SA 3VUZA 3QIIA 2I2LA 5GAMf 2M9UA 5FROA 5GANe 1OZ3A 5HK3A 3S3NA 1B34A 2DK3A 3GNGA 1M90U 4M77F 3CCVT 1VUBA 1Q82C 3DLMA 4JJNK 3JB9H 4J7IA 2P0QA 3CCRT 2E12A 2GQVA 3PTAA 3F70A 5CKEA 2EQKA 2YLCA 2V8KA 3HRSA 3A8OB 2RJFA 3LW5E 3M4YA 3QZ9B 1KQSS 1I5LA 4M7DB 4M75D 4C5GA 2R57A 4M78A 4C8QA 4M7AF 4Y91A 2X4YA 2P4TA 1WQ7A 2JZ2A 4WF2A 5LJ5f 3JCMe 5GANf 4F7UG 2GF7A 5CIUA 5KE2A 2WSEE 3JB9J 4N4IA 3MP6A 3ZBDA 2RH2A 1BI2A 2Y4YA 4C0FA 3QYGB 2RI5A 3DLLA 5GAN6 3G71A 3OBWA 1TH7A 4BACA 2K5FA 5D6YA 5IAYA 2JNGA 3RKWA 1XQHA 3LWHA 3AHUA 4FM4B 2F5KA 2HBPA 4J6YA 5HK0A 2DD4A 2DXBA 1YJWT 2HQEA 4OB0B 4P5NA 3PFSA 2RI3A 3ZEHA 4BD3A 2OTLT 2LCLA 4M75A 3CCLA 5LJ5j 3G7ZA 3CCQA 3CC4A 4M77C 2AHJB 3OYLA 1S72T 4J6WA 5J3BA 2CKKA 2D0QB 3UPUA 4C92A 1OYXA 2VGMA 4R56A 4N0AA 1JB0E 2WACA 1VQ4A 4II1A 1YHQT 3FLGA 4MDXA 3S3OA 5HKCA 2EIFA 3QJ6A 2E10A 1D3BB 3FDRA 4XQ3A 4M7AC 2K5LA 4M7DE 2A7YA 3BDUA 1YI2T 2OTJT 5GMKh 3ER0A 1VQ5T 4ZGDB 3SD4A 3CPWA 3OYEA 3M58A 3OW2S 4GY5A 5CKBA 4QVCA 4CRIA 5FRNA 2EJ9A 5DM7R 3VJPA 4X9CA 3WVDB 5KCOA 4LDWA 2BKDN 2PVDB 3OYMA 1Q86U 3CC2T 1K8AU 1YITA 3CCST 4OB1B 3N5BB 4M7AB 1QW1A 2DIQA 2DXCA 2K2VA 2ZPBB 1KQ1A 4EPCA 1GXIE 5GAOm 3SWNA 2ZPFB 2XDDA 4X9DA 3X28B 4JS4A 4FL6A 5CVIA 3CD6T 1HXDA 2RK2A 4KULA 1XOVA 4XTWA 5CCAA 4OMFB 2L89A 1YJ9A 2ZPHB 4A4GA 2IVWA 3QHSA 4PL6A 3TCJA 1EIFA 4MMKA 4F7UA 4PNOA 4E7HA 4PJOC 2XIDA 2XK0A 5GAN3 4V2SA 2EFIA 4OGCA 3TEEA 1K73C 3VU3C 2FVUA 2ZPGB 4J5YA 4RCCA 1PSEA 4ZN3A 4JRPA 3CCJA 1G3SA 2GFAA 4J83A 1UGSB 3A5ZB 1XTDA 2RHZA 1H641 3L2UA 3NTHA 3LWIA 2BIVA 4E7LA 4M7DF 1QVGS 3QYHB 2QI2A 4UC4A 3PIOA 2DJZA 2RHXA 3CMET 4PJOB 2RK1A 1OZ2A 2FYKA 5GMKj 5LJ3d 4HT9A 4XAXB 2EKOA 4RG8A 1YJNA 1SSFA 3VV0A 3CCET 1VQ6A 2YHTA 5LL6S 3JB9G 3CPFA 2LVMA 3CBPA 4LDXA 5C0MA 3QSUA 3X25B 3MP1A 4M7AE 4BI3A 3P8HA 4KT0E 4JRKA 2CZ7B 2MWPA 4YTLA 3JCMQ 3DKMA 1BIAA 2GFUA 1WPYA 2LQKA 3MP8A 3V7RA 2CZ1B 2FB7A 3L2ZA 3V8KA 4A4KA 3L2VA 2M16A 3L1AA 2DZCA 3P8DA 3RESA 4BY6C 4C92G 3QG1A 5J39A 5KCHA 3CC7A 2NLUA 3BY7A 3JCMg 4HT8A 1KHIA 1NPRA 2F5TX 2XDPA 4MDWA 5GAMe 2RA2A 1VQOT 3LYIA 3KXTA 2XG8D 2EQJA 1M4ZA 2E41A 1RI0A 3QDRB 1Q82U 3M59A 1VQLA 4O6JA 2P0KA 1DJ7B 4RKUE 3JCMX 4RMOA 1KG1A 4BY6B 1VIEA 3FJPA 3S3MA 3KUFA 4EMKC 5L8RE 5GAN7 2O01E 5LJ5e 3JB9D 4PJOE 5GAN5 1Q7YC 3GF5A 2ZPIB 3FEOA 4M7DG 1AHJB 3OYBA 1NZ9A 3M54A 2LT1A 1U1TA 4BI8B 2RO0A 5GMKm 2EJFA 2RM4A 3RKXA 2OAUA 3MO8A 3OB9A 2PVOB 3O8VA 3C4SA 4RG2A 2DTHA 4J6XA 1VQMT 4C92D 5GMKi 4EMKB 1QVFA 2P0PA 4C0DC 3LGLA 3JCMc 1YJWA 4KUDK 1M1KC 3MHXA 3OBYA 1Y96A 5LJ3g 3META 4Y28E 2QEXT 1VQ7T 2XU8A 2ZGWA 3PIPA 3NTKA 1S72A 3FB9A 5CQXA 4ZGJB 1LOJA 2O4XB 4L59A 4CI0C 2V8IA 4XU0A 2ZPEB 5DLQE 3OYGA 5DLOA 3GP8A 3L42A 2HAXA 1WNLA 3CPWS 1PSFA 1LNXA 2KDSA 2M0OA 2QTXA 3L2RA 3G6ET 3VYHB 4TVRA 2EQUA 1M5Q1 2RI2A 4C0DB 4C5HA 1YI2A 3HP9A 2OTJA 5CKDA 4KBMB 1VQ5A 1Y07A 4OB2B 3GOXA 2VYTA 3CMAT 4M7DD 1JJ2A 3Q1JA 3I56T 3CBMA 4PJOF 2K5IA 4O5VA 4M75E 5GAOn 2RJCA 2RHIA 5AYFA 3OYKA 1N6AA 3JSCA 3PGGA 3EFRA 3CC2A 4VUBA 2RHYA 3CCSA 5CR2A 3EAEA 1WJQA 1QP2A 4M77G 3VYGA 1YIJA 3OA6A 3JCMJ 1KHCA 2IG0A 1BYMA 2KAFA 1NE8A 4A53A 4OF1A 3X26B 1KQSA 1Y71A 3CD6A 2E1HA 4NS5A 4ELYC 2K3YA 1R8OB 5FLXE 1VQPT 3R6OA 2CGHA 3JCMd 4C8QF 4M7AG 5KE3A 2Y4XA 3OMCA 3DB4A 2MWOA 2X4JA 3OY9A 3JB9I 2RB6A 1N8RC 4ATOA 4OGEA 4XTUA 5LJ3h 4IUQA 3UWNA 4M7DA 3G71T 1VQNA 2LNVA 4X34A 5GAOq 1K73U 4C0GA 2E70A 1IZ6A 3JCMb 2X4XA 1UGRB 2YRVA 1OI1A 4MMLA 3E9GA 2RJEA 2VXEA 3PT9A 3CC4T 3HFNA 3CCQT 1BI3A 4HKEA 1W2BA 3E19A 4HCZA 5GAOp 1BI0A 1NJIC 1ZBXA 2G3RA 5GAOl 1K9MC 2C06A 4FIBA 5HY6A 2JUFA 2B8AA 4ZN1A 4F7UE 3C95A 3CCEA 4E7JA 4M75F 3HL8A 5I2SA 1WJSA 4M77D 5A0GA 1VQ8A 3HFOA 1UEBA 5GAMg 3JAME 5LJ3f 2F69A 2V8JA 3I55T 4XU3A 2DPPB 3JRZA 4PLLA 3OMGA 1Q81C 3J7AF 3WVEB 1FX7A 4M7AD 5A0DA 4M78C 4C8QC 1LJOA 3DB3A 2MI6A 3VUBA 3URGA 4QVDA 2HQXA 3GNFB 1FWZA 1VQ9A 1YITT 3X24B 3OW2A 1B34B 2E65A 2WSCE 5GAN8 5GANg 4LD6A 3FRNA 1D3BA 2L3RA 4L6V5 1VQOA 3BFMA 3C12A 4PLIA 3CCMT 3M55A 4HCBA 2XD0A 2PQWA 1MHNA 2QXFA 3LH0A 2QQBA 3PMIA 4LDUA 3GLXA 2DXTA 3OSVA 5LJ3j 4M77A 3OYJA 1YJ9T 1G5VA 4M78B 4C8QB 1YCYA 4LDVA 3CCUA 4BE0A 3JCMW 4LD9K 2DO3A 3HKSA 3V8JA 3JCMV 2JOYA 3A8MB 2D6FA 2DTIA 2E6ZA 2LX9A 4M75C 1VQKT 4M7AA 2E5QA 3CCVA 4BDYA 4A4EA 4JS5A 4QQ6A 3V8LA 1MGQA 5GAN4 3RMSA 4C92C 4F7UF 3CCRA 3KBGA 4N0AC 3CCJT 3X20B 1QVFS 4BB7A 5KH6A 3L2WA 4B9XA 3HHTB 4IURA 2R5MA 3SB2A 2VXFA 4JLGA 2KMTA 1VQMA 4DOVA 1UGQB 4HCCA 3QO3A 4IUUA 4OP0A 1W4SA 1YJNT 3RUXA 1Y7XA 4M75B 5D6WA 1M1GA 4IUVA 4ZTJA 1KC8C 1VQ6T 4JUVA 4FT2A 1M1KU 1G3TA 1M1FA 2QEXA 4C92B 3BW1A 3JCMP 4N4GA 2X35A 3OYHA 4E7KA 2WSFE 1KD1C 3SFMA 3ASKA 4XK8E 4PJOA 5GANh 3CXCA 2QDYB 3FC3A 4IKFA 3G4ST 2EWNA 1N27A 5A2QE 3G6EA 2LC4A 3SWNC 2QA4T 2VUBA 4M78E 4C8QE 3NTIA 3L2QA 5FRMA 2OTLA 2K4YA 3E9FA 3H8ZA 4DQ2A 5GMKl 2XDBA 4Z02A 4IUPA 3EFSA 4QQDA 2LQ8A 4BUGA 3CMAA 3PMTA 3I56A 2MMPA 4FU6A 4BE1A 4DA4A 4XTYA 1QVPA 3M57A 2LCCA 3JCMh 3CEYA 1YHQA 2LT4A 5GAMd 2FHDA 2Y90A 5CK9A 1I4K1 4EMGA 4A54A 4ZTFA 4Q5WA 3SWNB 5DY9A 4ZGEB 3MEUA 1M90C 2R5AA 4R55A 4KUIA 2LRQA 3HRUA 3QBYA 4IUTA 1P92A 4FT4A 3OS1A 1VQPA 2M1HA 4A4HA 4F7UB 5GAMj 2X4WA 3A8HB 5GANd 4C5IA 5LJ5d 2JTFA 3ME9A 3QPHA 3SDZA 4C92E 1N9SA 3A8LB 3V7SA 1UB4A 2L8DA 5GAN2 4E7IA 1N8RU 1YBYA 4GLKA 5CKHA 4XTXA 3JCMf 4RCBA 1G3YA 1M9SA 4HA8A 3OS0A 4C0ZA 5IT9E 1N9RA 4ELZC 4BE2A 3RKYA 1W2BS 2DAQA 4JRIA 2XICA 3OQ5A 1V29B 3RIRA 3ZFJA 3P8BB 3OYCA 3J81E 5D6XA 5GAOr 4XU1A 5GANj 4M78F 4J7FA 2EJGA 5GMKe 2DD5A 2KK4A 2CZ6B 2QQ9A 4XU2A 2HD0A 3TU4K 1WJRA 3OYDA 1BKBA 2XI9A 3M56A 3RMQA 2VC8A 4C5EA 1NJIU 3UDCA 2PUOB 1QP3A 1K9MU 2H3JA 3HSBA 1M8VA 5FU7C 2QQAA 2ZCFB 4A4FA 4JLIA 4NL2A 4BDZA 5CO7A 4EMKA 4JRQA 4PKCC 4D6WA 3I55A 3MEVA 5LJ3e 3CCLT 3MCAB 3JB9F 2ZZDA 2DKGA 1Q81U 4M77B 1O9SA 3FIFA 4JDSA 1KQ2A 3T9NA 3CMEA 2JVVA 2YLBA 3NFCA 3OYAA 3WXMB 1VQ4T 2MAMA 2O4XA 2VGNA 3J80E 1UGPB 2PU9B 5FU7B 5I21A 2DTOA 2DXUA 2KY9A 3QUIA 1YIJT 1HK9A 4C92F 5CKFA 2RHUA 2XKOC 4OB3B 3GPLA 4PJOG 2JTMA 2E64A 2L5QA 3CCMA 3UT1A 4E47A 5FU6C 3TREA 1VIFA 2HNIA 1VQLT 3QXEB 4DOWA 1JRIA 3MEAA 4LDYA 1WQWA 3HRTA 4QVZA 2PUKB 2RD1A 3OS2A 1Q86C 1K8AC 3OYNA 4MZMA 1WGSA 2FL7A 2LDMA 2RJDA 5CAIA 5LJ5g 2QQRA 1VQNT 3QJYA 2EYQA 1VQKA 1X75C 1FXXA 2CZ0B 1X6OA 1IREB 4M78G 4C8QG 1H3ZA 3HPWA 2EAYA 2DEQA 2MF2A 3CBOA 2DIGA 3OSSC 4FSXA 5FU6B 4NOYA 1BI1A 5C6SA 4XTVA 4QW2A 4J8OA 4EMHA 4M77E 1I8FA 2KQWA 4EDUA 1XNIA 4XTZA 1BIBA 3OYIA 2R58A 5EG2A 3QKJA 1Y96B 1U1SA 2EQMA 3OYFA 1ZQ1A 4MZPA 1X01A 3A8GB 2VV5A 5J26A 1Q7YU 1KC8U 3CXCS 1VQ8T 2QQSA 4PJOD 2JN0A 3LGFA 3BDLA 3LX7A 1RL2A 5I2MA 3RERA 3M53A 2DZ9A 2DVEA 1KD1U 4OVAA 2A3LA 2KSSA 5CQYA 5IN1A 5A0LA 4M75G 5GAMh 2K3XA 3G4SA 4N4HA 1NPPA 2LTOA 3M4GA 1I81A 5M9OA 4L5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHD A;  2GFA A;  5KE3 A;  2E6N A;  4ZTF A;  2RHZ A;  3OMC A;  2D9T A;  3DB4 A;  3NTH A;  2BIV A;  2MWO A;  4Q5W A;  3H6Z A;  3S6W A;  3OY9 A;  3L2U A;  4E7L A;  4IUQ A;  3MEU A;  2BUD A;  2R5A A;  4UC4 A;  3UWN A;  3MEW A;  2RHX A;  4X34 A;  1OZ2 A;  2LRQ A;  4B9W A;  3QBY A;  4IUT A;  3OS1 A;  2EKO A;  4QQG A;  2M1H A;  1SSF A;  3PNW C;  4A4H A;  2X4X A;  2X4W A;  3M9Q A;  2YRV A;  4C5I A;  2LVM A;  2JTF A;  1OI1 A;  3LLR A;  3ME9 A;  3E9G A;  2RJE A;  5C0M A;  4E7I A;  2L8D A;  3MP1 A;  3QII A;  3P8H A;  5FRO A;  1OZ3 A;  3S3N A;  4HCZ A;  2MWP A;  3OS0 A;  2G3R A;  2GFU A;  4BE2 A;  3MP8 A;  2DAQ A;  2B8A A;  3DLM A;  4E7J A;  3OQ5 A;  3L2V A;  1WJS A;  3F70 A;  2EQK A;  2M16 A;  3OYC A;  3P8D A;  5D6X A;  2RJF A;  5J39 A;  5KCH A;  2NLU A;  4C5G A;  2R57 A;  4PLL A;  2XDP A;  3OMG A;  2X4Y A;  2JZ2 A;  3LYI A;  1WJR A;  3OYD A;  2EQJ A;  2GF7 A;  4C5E A;  5CIU A;  1RI0 A;  5KE2 A;  4NS5 A;  3DB3 A;  4A4F A;  2HQX A;  4N4I A;  4BDZ A;  2P0K A;  3MP6 A;  3MEV A;  4LD6 A;  2L3R A;  2RI5 A;  3S3M A;  3KUF A;  4PLI A;  4BAC A;  5D6Y A;  5IAY A;  3OYA A;  2PQW A;  1MHN A;  2O4X A;  3LH0 A;  2F5K A;  3PMI A;  3FEO A;  3OYB A;  1G5V A;  3OYJ A;  2HQE A;  3PFS A;  2RI3 A;  3ZEH A;  4BD3 A;  4BE0 A;  2RO0 A;  2RHU A;  3OYL A;  2CKK A;  3MO8 A;  3OB9 A;  1OYX A;  3UT1 A;  3O8V A;  3C4S A;  2WAC A;  4RG2 A;  2E5Q A;  4II1 A;  4BDY A;  4A4E A;  3FLG A;  4QQ6 A;  3S3O A;  3QJ6 A;  3LGL A;  3MEA A;  3FDR A;  4QVZ A;  3MET A;  5KH6 A;  3OS2 A;  3L2W A;  4B9X A;  3OYN A;  1WGS A;  2LDM A;  2R5M A;  2RJD A;  3NTK A;  4IUR A;  2O4X B;  2QQR A;  4L59 A;  3SD4 A;  3OYE A;  4IUU A;  3OYG A;  4GY5 A;  4CRI A;  5FRN A;  3L42 A;  1H3Z A;  5D6W A;  5KCO A;  4IUV A;  2M0O A;  4ZTJ A;  2BKD N;  2DIG A;  3L2R A;  2EQU A;  2RI2 A;  4C5H A;  3OYM A;  5C6S A;  4N4G A;  2X35 A;  3OYH A;  4E7K A;  2DIQ A;  4QW2 A;  3ASK A;  3GOX A;  2VYT A;  4EDU A;  3OYI A;  1XNI A;  3Q1J A;  2R58 A;  4IKF A;  3FC3 A;  3QKJ A;  2EQM A;  4FL6 A;  3OYF A;  2RJC A;  2RHI A;  5J26 A;  1N27 A;  2L89 A;  3OYK A;  2QQS A;  3L2Q A;  3NTI A;  4A4G A;  3LGF A;  4PL6 A;  5FRM A;  3BDL A;  2RHY A;  3E9F A;  3H8Z A;  3EAE A;  3LX7 A;  1WJQ A;  4E7H A;  4Z02 A;  4IUP A;  3OA6 A;  4OVA A;  4QQD A;  2XK0 A;  1KHC A;  2IG0 A;  5IN1 A;  2EFI A;  3PMT A;  4FU6 A;  4BE1 A;  2K3X A;  4N4H A;  2LTO A;  2LCC A;  3CEY A;  2K3Y A;  5M9O A; 
#chains in the Genus database with same CATH topology
 2D0N A;  1VQ9 T;  3S6W A;  3INZ A;  1WA7 A;  2XHC A;  4C8Q D;  4FSS A;  2CS7 A;  5LJ5 h;  2JJ9 A;  2GCX A;  3M5A A;  3OYY A;  4ME7 A;  3CC7 T;  3VUZ A;  3QII A;  2I2L A;  5GAM f;  2QAS A;  5GAN e;  1OZ3 A;  1K73 R;  1YP5 A;  3JB9 H;  4J7I A;  3PTA A;  2HDA A;  3HRS A;  3QZ9 B;  1D0X A;  2RJF A;  1KQS S;  2VVK A;  4C8Q A;  2BZY A;  5KYY A;  4OMN A;  3MP6 A;  3QYG B;  7AT1 B;  3DLL A;  1UFF A;  2CSQ A;  3CCU Q;  2JNG A;  3RKW A;  4FM4 B;  2KI7 A;  5HK0 A;  2HQE A;  2RI3 A;  5J3B A;  2CKK A;  1OYX A;  1JQQ A;  4N0A A;  1JB0 E;  1XJW B;  2WAC A;  1VA7 A;  3UF4 A;  3QJ6 A;  2E10 A;  3FDR A;  5KYU B;  2A7Y A;  1YI2 T;  2OTJ T;  4FCY A;  3ER0 A;  4ZGD B;  3REA B;  1RI9 A;  3OW2 S;  4GY5 A;  1UTI A;  1WHJ A;  5KCO A;  3A98 A;  4LDW A;  1I1J A;  4CC4 B;  1GXI E;  4EPC A;  2XDD A;  2RK2 A;  5CCA A;  1YJ9 A;  1S72 Q;  1IGU A;  2IVW A;  3QHS A;  4PL6 A;  3TCJ A;  4MMK A;  1VYV A;  4RTV A;  4PNO A;  1YHQ Q;  4ANJ A;  2XK0 A;  1ZSZ A;  4PJL A;  1WIE A;  4JZ4 A;  2ZPG B;  1PSE A;  1UJ0 A;  1VQ5 Q;  1G3S A;  4J9G A;  2RHZ A;  4E7L A;  4UC4 A;  1KFZ A;  3PIO A;  1BBZ A;  5GMK j;  2KT8 A;  1NLP C;  3CCS Q;  3CCE T;  3JB9 G;  1ZSG A;  3GBQ A;  3CPF A;  3CBP A;  4LDX A;  3MP1 A;  1N5Z A;  2MPX C;  1SKU B;  2MWP A;  3JCM Q;  3DKM A;  2H3E B;  3V7R A;  3L2V A;  1TOV A;  5J39 A;  1N8R R;  2SEM A;  3CC7 A;  1SRM A;  5GAM e;  2F5T X;  2RA2 A;  4J9E A;  2YRC A;  3KXT A;  1D1B A;  2EQJ A;  3VRY A;  1RI0 A;  1Q82 U;  4OMO A;  1TUD A;  4O6J A;  4RKU E;  4RMO A;  3CME Q;  1VIE A;  1K9M R;  4E2F B;  4PJO E;  4M7D G;  1AHJ B;  2EYX A;  2LT1 A;  2C0O A;  4IIM A;  3QWX X;  3RKX A;  3MO8 A;  3OB9 A;  2DTH A;  4J6X A;  4C92 D;  2XMF A;  2GTJ A;  3JCM c;  1M1K C;  1ZUK A;  4LUE A;  3MET A;  1VQ7 T;  2MOX A;  2QGF B;  5CQX A;  5DLQ E;  2HAX A;  1JO8 A;  2JMC A;  3L2R A;  2C0T A;  2RI2 A;  1YI2 A;  2OTJ A;  3EG1 A;  5CKD A;  1TU0 B;  1Y07 A;  2LCS A;  2K5I A;  2MIO A;  2H8H A;  2RJC A;  4DBQ A;  3OYK A;  2YXY A;  4VUB A;  2RHY A;  5CR2 A;  1M8M A;  3VYG A;  1NE8 A;  4A53 A;  1R0B G;  3NPF A;  1Y71 A;  2P4R A;  2CGH A;  2EGA A;  1BU1 A;  2MWO A;  1K0X A;  3JB9 I;  2RB6 A;  1WX6 A;  1VOM A;  3G71 T;  2LNV A;  4X34 A;  2X4X A;  1B7T A;  1UGR B;  4D8K A;  3M0P A;  3CMA Q;  1OI1 A;  3E9G A;  3CC4 T;  3E19 A;  5GAO p;  1BI0 A;  2G3R A;  5GAO l;  3A1P A;  5HY6 A;  3CCE A;  1K76 A;  2KRS A;  4LUD A;  1CKB A;  5A0G A;  1M3C A;  1LPL A;  1TXQ A;  1UEB A;  1H92 A;  2F69 A;  2V8J A;  3VS2 A;  4XU3 A;  4DBR A;  1M90 R;  3OMG A;  1V76 A;  3EFO A;  1B3Q A;  4M7A D;  4M78 C;  1QLY A;  2KXC A;  3DB3 A;  4QVD A;  3URG A;  1YWO A;  2HQX A;  2LMJ A;  1B34 B;  5GAN 8;  4AFZ C;  2QAZ A;  2ESW A;  3VS5 A;  4L6V 5;  3BFM A;  2DMO A;  4PLI A;  1MHN A;  3CCL Q;  3GLX A;  3CCQ Q;  3AT1 B;  4M78 B;  3CCU A;  4LD9 K;  1RAE B;  2YUQ A;  2D6F A;  3JCM V;  4M75 C;  4M7A A;  3EGD B;  4DBH A;  4BDY A;  1ZA2 B;  4J9D A;  3RDV A;  4HVW A;  5GAN 4;  4C92 C;  4F7U F;  3CCJ T;  2V1Q A;  2CP5 A;  4DOV A;  3I35 A;  4IUU A;  1VYT A;  1YJN T;  1YIT Q;  3RUX A;  4M75 B;  5D6W A;  1VQ6 T;  4IUV A;  2NYS A;  4C92 B;  3BW1 A;  2WSF E;  1KD1 C;  1ZLM A;  1OU8 A;  2QDY B;  2YDL A;  2JS2 A;  2F1L A;  1MV0 B;  4C8Q E;  2LP5 A;  1RAI B;  1VQK Q;  4DQ2 A;  5GMK l;  2XDB A;  1MND A;  2EW3 A;  4IUP A;  3EH2 A;  4QQD A;  1JXM A;  3JCM h;  1YHQ A;  2DL3 A;  2FHD A;  9ATC B;  5CK9 A;  3ZL7 C;  4ZTF A;  3EHR A;  2FPE A;  1MNE A;  4B6M A;  2AKK A;  4LN2 A;  3QBY A;  2E3H A;  4FT4 A;  5GAN d;  2JTF A;  3SDZ A;  1N9S A;  1UB4 A;  2L8D A;  1WXU A;  1M9S A;  2GGR A;  3OQ5 A;  1V29 B;  1ZX6 A;  2DL8 A;  2YUN A;  4OML A;  3ZFJ A;  3OYC A;  2HZY A;  2J6F A;  2KK4 A;  4XU2 A;  2EYZ A;  1WJR A;  5IHN A;  1NJI U;  3RMQ A;  2EKH A;  2YSQ A;  3UDC A;  2H3J A;  2RNA A;  2QQA A;  2ZCF B;  5FU7 C;  5KYW B;  4NL2 A;  4JRQ A;  2A08 A;  3CCL T;  3MEV A;  2ZZD A;  4M4Z A;  4GBQ A;  3CME A;  4RTZ A;  3WXM B;  2DL7 A;  2MAM A;  2O4X A;  4DEY A;  3MKD A;  2FRW A;  5FU7 B;  3QUI A;  2JTM A;  3UT1 A;  2ATC B;  2LX7 A;  1TG0 A;  3TRE A;  1Y0M A;  3QXE B;  4DOW A;  1IHW A;  1AT1 B;  3HRT A;  4QVZ A;  2RD1 A;  3OS2 A;  2FL7 A;  2LDM A;  2RJD A;  2QQR A;  2W0Z A;  4R0K A;  2FPF A;  4KGZ B;  1FXX A;  1IRE B;  3HPW A;  2EAY A;  1C1A A;  1BI1 A;  4DBF A;  4LXC A;  1I8F A;  2HSE B;  4XTZ A;  1E7O A;  3CC2 Q;  2EQM A;  4MZP A;  1KC8 U;  1AEY A;  4PJO D;  2JN0 A;  3LGF A;  1H3H A;  5IH2 A;  1K1Z A;  2CP0 A;  3LX7 A;  1E6G A;  2YUO A;  5I2M A;  4IIO A;  2A3L A;  5IN1 A;  3EGX B;  1NPP A;  3M4G A;  1I81 A;  1OV3 A;  2DER A;  1O75 A;  1K9A A;  4B9W A;  2C0I A;  1ZHI A;  2CT4 A;  2EGE A;  2J7I A;  3V7C A;  4BI4 A;  4PJO A;  1JBM A;  3LLR A;  2CYZ B;  2LJ0 A;  2EPD A;  2M9U A;  2ECZ A;  3S3N A;  2DK3 A;  1QKW A;  2JXB A;  3CCR T;  2E12 A;  2GQV A;  2X51 A;  3A8O B;  1I5L A;  1SG5 A;  5IXF A;  2R57 A;  2DBK A;  4Y91 A;  2KRM A;  3MPU B;  2A0F B;  2P4T A;  1WQ7 A;  5GAN f;  2ZAE A;  4F7U G;  1VQ9 Q;  2KXD A;  2K79 A;  1PM3 A;  5CIU A;  1WHL A;  1ZBJ A;  2WSE E;  4AMC A;  1UHF A;  4N4I A;  1TUC A;  3ZBD A;  2RH2 A;  2D1X A;  2Y4Y A;  2RI5 A;  1RAG B;  4RTT A;  1J3T A;  3AHU A;  1X6G A;  2F5K A;  2HBP A;  4J6Y A;  2DD4 A;  1YJW T;  4P5N A;  2OTL T;  3CCL A;  3G7Z A;  3CCQ A;  4M77 C;  2AHJ B;  1C0M A;  3OYL A;  4J6W A;  2D0Q B;  4II1 A;  3MJX A;  3FLG A;  4MDX A;  5HKC A;  2EIF A;  1NM7 A;  2FZK B;  1WHH A;  4WCI A;  1D3B B;  1PCX A;  1EX4 A;  2FEI A;  2CH4 A;  1TUG B;  3CPW A;  3IQL A;  3EG2 A;  1D0Z A;  5CKB A;  5FRN A;  4X9C A;  1ABO A;  3OYM A;  3CC2 T;  1K8A U;  1YIT A;  3RNJ A;  4OB1 B;  3N5B B;  3SHW A;  2JW4 A;  1PRL C;  2FPD A;  2K2V A;  3G6E Q;  1KQ1 A;  5GAO m;  4X9D A;  1M1K R;  4OMF B;  2KEA A;  1IO6 A;  1I07 A;  4PJO C;  2EQI A;  5GAN 3;  4V2S A;  2KR3 A;  3TEE A;  3VU3 C;  1YN8 A;  4J5Y A;  4RCC A;  4JRP A;  2NUT A;  2GFA A;  1B07 A;  1XTD A;  3A5Z B;  1H64 1;  2FO0 A;  1WDX A;  2YUP A;  3NTH A;  2BIV A;  2DNU A;  3LWI A;  4M7D F;  2QI2 A;  2SRC A;  2DJZ A;  2J6O A;  2RHX A;  4PJO B;  1TS9 A;  1NYF A;  4HT9 A;  1T3S A;  1SRL A;  1RAA B;  3QSU A;  3UAT A;  4M7A E;  4KT0 E;  4JRK A;  2CZ7 B;  4CC7 A;  2HMA A;  1BIA A;  2CH4 W;  5D7U A;  4A4K A;  2DZC A;  1FMV A;  1ZA1 B;  3JCM g;  1AWO A;  1OUL A;  1KHI A;  2XDP A;  4MDW A;  4FYW B;  2E41 A;  3QDR B;  2MCN A;  3M59 A;  3JCM X;  2LNH B;  3QWY A;  3KUF A;  3CCE Q;  5L8R E;  5GAN 7;  2O01 E;  3JB9 D;  3GF5 A;  3CPW P;  1M30 A;  3M54 A;  2BTT A;  2RO0 A;  5GMK m;  2OAU A;  2LJ1 A;  3H0I A;  3O8V A;  1VQM T;  4RG2 A;  1YJW A;  3MHX A;  2DA9 A;  2QTV A;  2RQV A;  2CUB A;  1WZO A;  3FB9 A;  2CP2 A;  4Y92 A;  4CI0 C;  2V8I A;  4AFS C;  4XU0 A;  2ZPE B;  5DLO A;  3GP8 A;  1WNL A;  3CPW S;  2KDS A;  1LNX A;  3G6E T;  3VYH B;  3VS1 A;  4KBM B;  4M7D D;  1JJ2 A;  2VKN A;  1KSW A;  4O5V A;  2M02 A;  5GAO n;  5AYF A;  2DM1 A;  3PGG A;  2JMA A;  3EFR A;  3CC2 A;  2RQT A;  1WI7 A;  3EAE A;  2HKQ B;  1WJQ A;  1QP2 A;  3EG9 A;  2IG0 A;  1R77 A;  1BYM A;  1Q7Y R;  1VQ7 Q;  1RLP C;  3R6O A;  1ZUY A;  1YWP A;  4ATO A;  4XTU A;  5LJ3 h;  4M7D A;  3UWN A;  4JJC A;  5GAO q;  1K73 U;  1SPK A;  2YRV A;  3UA6 A;  2RJE A;  2M0Y A;  1BI3 A;  2A36 A;  2VWF A;  1I0C A;  4Z88 A;  2C06 A;  1SHF A;  2B8A A;  2LQW A;  4F7U E;  4M75 F;  4JJD A;  2DPP B;  1Q81 C;  5AT1 B;  3J7A F;  3WVE B;  5A0D A;  4C8Q C;  3GNF B;  3G71 Q;  1VQ9 A;  1PD0 A;  2E65 A;  2WSC E;  1GCQ A;  1WXB A;  3FRN A;  1AZG B;  4OMQ A;  1NG2 A;  3PMI A;  3CC4 Q;  4C8Q B;  2RQR A;  4LDV A;  3TVT A;  1GCP A;  1H8K A;  5KYY B;  2DO3 A;  2JOY A;  2FZG B;  3A8M B;  2MYS A;  2IPO B;  4JS5 A;  2O9V A;  2F2V A;  3V8L A;  1JJ2 P;  1OPL A;  3RMS A;  4N0A C;  4BB7 A;  1S1N A;  3HHT B;  2R5M A;  3SB2 A;  3TSZ A;  2FRY A;  4JLG A;  1VQM A;  1UGQ B;  2J6K A;  4HCC A;  3H0F A;  4PJJ A;  4JUV A;  3VS3 A;  2OX7 A;  1AOJ A;  3OYH A;  4E7K A;  2KT1 A;  2AZV A;  5GAN h;  3CXC A;  5FW9 A;  1PD1 A;  1N27 A;  5A2Q E;  3G6E A;  2QA4 T;  2VUB A;  1BCM A;  3L2Q A;  5FRM A;  4CC2 A;  1FMW A;  3PMT A;  3REB B;  3CCJ Q;  4FU6 A;  4DA4 A;  3CEY A;  4AFQ C;  1ZSZ C;  2Y90 A;  1JU5 C;  5DY9 A;  1YJN Q;  1GL5 A;  1VQ6 Q;  1R0C B;  2L3P A;  1RUW A;  2LRQ A;  4IUT A;  4KGX B;  4QKU A;  1P92 A;  3OS1 A;  2P84 A;  2M1H A;  1K0S A;  1W70 A;  2NUP A;  3A8H B;  1RAB B;  4C5I A;  5LJ5 d;  3ME9 A;  1ZSZ B;  3QPH A;  1M2O A;  1Y57 A;  1YBY A;  1N8R U;  2KYB A;  2KNB B;  4XTX A;  1JEG A;  1N9R A;  2YRD A;  2DAQ A;  4JRI A;  3RIR A;  2K3B A;  2DF6 A;  2EJG A;  5GMK e;  2DD5 A;  3ULR B;  5IHI A;  1OU9 A;  2CZ6 B;  2HD0 A;  1BKB A;  4C5E A;  1K9M U;  2DRM A;  3HSB A;  1M8V A;  4X1V A;  4A4F A;  3UA7 A;  4BDZ A;  4EMK A;  2DKG A;  1O9S A;  4HVV A;  3NHN A;  1YFN A;  1KQ2 A;  2YLB A;  2VGN A;  3J80 E;  2YT6 A;  4RUG A;  1UGP B;  2PU9 B;  2DXU A;  1YIJ T;  5CKF A;  2RHU A;  3GPL A;  2L5Q A;  4E47 A;  2VB6 A;  2CP7 A;  3CXC P;  1PC0 A;  4LDY A;  2PUK B;  2CP3 A;  1M2V A;  3OYN A;  4MZM A;  1Q95 G;  2CSI A;  5CAI A;  2E5K A;  5LJ5 g;  1VQN T;  1LCK A;  1X6O A;  4M78 G;  1SSH A;  2DIG A;  3OSS C;  4XTV A;  4QW2 A;  1NLO C;  2X9H A;  3QKJ A;  3OYF A;  1ZQ1 A;  1X01 A;  2CP6 A;  1VQ8 T;  3CXC S;  2DRK A;  3TQ7 P;  3RER A;  3M53 A;  2DVE A;  1FMK A;  1HSQ A;  2KSS A;  2HQH A;  4J9C A;  4M75 G;  5A0L A;  5GAM h;  3EG0 A;  4L5G A;  2AIR B;  1T0J A;  2PVG B;  4NL3 A;  2QA4 A;  1QVG A;  2E6N A;  2K57 A;  4FYV B;  2D9T A;  1VQ7 A;  3H6Z A;  3GIB A;  3C94 A;  2KVQ G;  4QQG A;  2EGC A;  1UEC A;  2KRN A;  1X27 A;  3M9Q A;  1SEM A;  1Q86 R;  1G3W A;  3OS5 A;  1U8R A;  1PHT A;  3EHQ A;  1UHC A;  3I5R A;  5HK3 A;  3GNG A;  1M90 U;  4M77 F;  3CCV T;  1UGV A;  1PWT A;  2FZC B;  1Q82 C;  1BK2 A;  1PNJ A;  3F70 A;  5CKE A;  3LW5 E;  1VQL T;  2V8K A;  3M4Y A;  5I11 A;  3EH1 A;  4C5G A;  2X4Y A;  1X2K A;  2BZ8 A;  5LJ5 f;  2GF7 A;  5KE2 A;  1JXO A;  1WLP B;  4AG1 C;  2OAW A;  5GAN 6;  3G71 A;  1TH7 A;  4BAC A;  2K5F A;  1AWW A;  2L2P A;  1XQH A;  2DXB A;  2GQI A;  3EFO B;  2LCL A;  5LJ5 j;  3CC4 A;  2NWM A;  3CCR Q;  1QKX A;  4PJN A;  3S3O A;  2QDL A;  4M7A C;  4M7D E;  5GMK h;  2V1R A;  3SD4 A;  4QVC A;  5DM7 R;  3VJP A;  1G8X A;  1Q86 U;  1QVG P;  4M7A B;  1PKT A;  3E2U A;  2DXC A;  1UE9 A;  1YJW Q;  3SWN A;  2OTL Q;  2Z0W A;  4FL6 A;  3CD6 T;  1FYN A;  1HXD A;  4XTW A;  3H9N A;  3U23 A;  1TWB A;  3I56 Q;  1WHG A;  4RTX A;  4F7U A;  4E7H A;  2EFI A;  4OGC A;  4RTW A;  2K6D A;  1AD5 A;  3CCJ A;  4J83 A;  2DL5 A;  2F2W A;  3L2U A;  1T0H A;  1QVG S;  1PRM C;  2E4H A;  4E6R A;  1OZ2 A;  2FYK A;  8AT1 B;  1UJY A;  4J9H A;  1YJN A;  3RR6 A;  3VV0 A;  1VQ6 A;  2YHT A;  2LVM A;  2OI3 A;  2O88 A;  2BE9 B;  2QK0 A;  4BI3 A;  2M51 A;  1WPY A;  3THK A;  2CZ1 B;  3V8K A;  5KCH A;  3BY7 A;  2B86 A;  4ORZ A;  2XG8 D;  1UG1 A;  1VQL A;  4JPB W;  1DJ7 B;  1CSK A;  2CRE A;  2X3W D;  3FJP A;  3S3M A;  5LJ5 e;  5GAN 5;  3I9Q A;  3FEO A;  3OYB A;  1NZ9 A;  4JJB A;  1U1T A;  1Q81 R;  2EJF A;  2RM4 A;  1AVZ C;  2PVO B;  3C4S A;  5GMK i;  1QVF A;  2P0P A;  1W6X A;  4KUD K;  3OBY A;  1Y96 A;  4Y28 E;  2QEX T;  3M0T A;  4Z89 A;  4ZGJ B;  3NGP A;  2O4X B;  1WYX A;  1A0N B;  3L42 A;  4HCK A;  1PSF A;  2DLP A;  4TVR A;  2EQU A;  1M5Q 1;  4DEX A;  1AZE A;  1OPK A;  4RTU A;  3GOX A;  1MMD A;  2VYT A;  3I56 T;  3CBM A;  1MV3 A;  4M75 E;  2RHI A;  1N6A A;  3JSC A;  4LNP A;  5KYN A;  1VQM Q;  4M77 G;  2ABL A;  3JCM J;  1KHC A;  4D8D A;  1KQS A;  3CD6 A;  2E1H A;  1D0Y A;  4ELY C;  1F1B B;  2KBT A;  3JCM d;  4C8Q F;  2Y4X A;  3OY9 A;  4OGE A;  2COZ A;  4IUQ A;  4AFU C;  2X3X D;  2E70 A;  1IZ6 A;  3JCM b;  2EVR A;  3HTR A;  4MML A;  3PT9 A;  2VXE A;  3HFN A;  1NJI C;  2JUF A;  4ZN1 A;  4E7J A;  3HL8 A;  1GFC A;  1WJS A;  3HFO A;  5GAM g;  3JAM E;  4PLL A;  1LJO A;  2MI6 A;  3VUB A;  2HSP A;  1FWZ A;  1QVF P;  3X24 B;  3OW2 A;  1RLQ C;  4LD6 A;  3CCM T;  2QXF A;  4LDU A;  1YJ9 T;  1VYU A;  2O2O A;  2YWW A;  1ARK A;  1MMN A;  2DTI A;  4PK4 A;  2DVJ A;  2LX9 A;  3G1J A;  2E5Q A;  4A4E A;  4QQ6 A;  2J05 A;  1IHV A;  3R6N A;  1MGQ A;  1RAD B;  3VS7 A;  3CCR A;  3KBG A;  1QVF S;  5KH6 A;  3L2W A;  6AT1 B;  3H41 A;  3FJ5 A;  2K9G A;  1WHK A;  1WXT A;  4OP0 A;  1W4S A;  1Y7X A;  1ACM B;  1KC8 C;  1M1G A;  1KQS P;  1M1K U;  1G3T A;  2QEX A;  1MMA A;  2O9S A;  4N4G A;  2X35 A;  3SFM A;  3ASK A;  2HL5 C;  3QDF A;  3G4S T;  2DL4 A;  2EWN A;  2LC4 A;  1SHG A;  2OTL A;  2K4Y A;  3E9F A;  3I56 A;  2MMP A;  4XTY A;  3M0R A;  1SF9 A;  1QVP A;  2GBQ A;  2GTO A;  2LT4 A;  1IB8 A;  4AT1 B;  4EMG A;  1EZZ B;  2ED1 A;  1M3B A;  1GBR A;  3VS4 A;  2HKN A;  2JM9 A;  1GBQ A;  3MEU A;  2R5A A;  2L3Q A;  4QT7 A;  2A28 A;  5GAM j;  1RAF B;  2MK5 A;  5GAN 2;  3A8L B;  3V7S A;  4E7I A;  3OW2 P;  3JCM f;  4RCB A;  1G3Y A;  2QA4 Q;  4C0Z A;  1GRI A;  2NUT B;  5IT9 E;  4PFO A;  4BE2 A;  2K2M A;  2XIC A;  2COY A;  4OMP A;  4M78 F;  1NYG A;  1KD1 R;  4OMM A;  1X43 A;  3OYD A;  4J9I A;  1W1F A;  2RQU A;  4FYX B;  3PVL A;  4PKC C;  4D6W A;  1Q82 R;  1VQ4 T;  2D8H A;  3NFC A;  3OYA A;  2GNC A;  2HBW A;  2ROT A;  1G2B A;  2KY9 A;  1HK9 A;  4C92 F;  4OB3 B;  1HJD A;  4FW1 A;  2E64 A;  3CCM A;  2NUZ A;  2JTE A;  4AG2 C;  5FU6 C;  1UDL A;  1VIF A;  2HNI A;  3MEA A;  2DFU A;  1K8A C;  4J9B A;  1QWE A;  1WGS A;  3M0S A;  3QJY A;  2EYQ A;  2ENM A;  1X75 C;  1X6B A;  2BZX A;  4C8Q G;  4FW2 A;  2DEQ A;  3CBO A;  3SEM A;  5FU6 B;  4FSX A;  1X69 A;  5C6S A;  2D8J A;  5HCK A;  4M77 E;  4EDU A;  1BIB A;  1AWX A;  1UUE A;  2AT1 B;  1YCS B;  1WFW A;  1YIJ Q;  1Q7Y U;  1V1C A;  1QMC A;  2LZ6 B;  3BDL A;  1RL2 A;  1KD1 U;  2K3X A;  3G4S A;  4N4H A;  2LTO A;  1PG5 B;  1MMG A;  1VQN Q;  1MUZ A;  4M78 D;  2BUD A;  2QGG A;  3MEW A;  3VKI A;  4M7D C;  3PNW C;  3QZ5 B;  1G83 A;  3EG9 B;  3CCU T;  1JJ2 S;  4MZT A;  3E1S A;  2RF0 A;  2ROL A;  5FRO A;  1B34 A;  1VQ8 Q;  1VUB A;  3DLM A;  2JS0 A;  4JJN K;  2P0Q A;  2HEQ A;  2EYY A;  2EQK A;  2YLC A;  4M7D B;  1C6V X;  2COW A;  4M75 D;  4M78 A;  4M7A F;  2JZ2 A;  4WF2 A;  3JCM e;  3VRZ A;  1RAC B;  4EIK A;  3JB9 J;  3EGD A;  1VQO Q;  1BI2 A;  1OQK A;  4C0F A;  1ABQ A;  3OBW A;  5D6Y A;  5IAY A;  3LWH A;  1GCQ C;  4OB0 B;  3PFS A;  3ZEH A;  4BD3 A;  4PJM A;  4M75 A;  3CCV Q;  1S72 T;  4PFP A;  3UPU A;  4C92 A;  2KE9 A;  2VGM A;  4R56 A;  1VQ4 A;  1VQL Q;  3BE3 A;  1YHQ T;  4XQ3 A;  2K5L A;  2KYM A;  3BDU A;  1Z9Z A;  2A37 A;  2DIL A;  2AK5 A;  1VQ5 T;  3OYE A;  4HXJ A;  3M58 A;  4CRI A;  2EJ9 A;  3WVD B;  2BKD N;  2PVD B;  1E6H A;  3EGU A;  2I0N A;  3CCS T;  1QW1 A;  2DIQ A;  4E7Z A;  2ZPB B;  2DET A;  2ZPF B;  3C0C A;  4JS4 A;  3X28 B;  5CVI A;  4KUL A;  1XOV A;  2L89 A;  1OEB A;  2ZPH B;  4A4G A;  3NMZ C;  1EIF A;  2K7A A;  2XID A;  5KYX A;  1K73 C;  1HYO A;  2FVU A;  4ZN3 A;  4KH1 B;  1UGS B;  2PZ1 A;  1WHM A;  1VQP Q;  3QYH B;  4FYY B;  3CME T;  2RK1 A;  5LJ3 d;  1QQJ A;  4XAX B;  2EKO A;  4RG8 A;  1SSF A;  5LL6 S;  5KYW A;  1I5O B;  5C0M A;  3X25 B;  3CD6 Q;  3P8H A;  1D09 B;  4YTL A;  2GFU A;  2J06 A;  2LQK A;  3MP8 A;  1QCO A;  2RN8 A;  2FB7 A;  3L2Z A;  2M16 A;  3L1A A;  3RES A;  3P8D A;  4BY6 C;  4C92 G;  3QG1 A;  2NLU A;  4JZ3 A;  4HT8 A;  1NPR A;  1VQO T;  4PFZ A;  3LYI A;  1M4Z A;  2NUP B;  3I55 Q;  2P0K A;  3I5S A;  1KG1 A;  4BY6 B;  1NJI R;  4EMK C;  1Q7Y C;  1IXD A;  2ZPI B;  4BI8 B;  2V26 A;  4LE9 A;  2O31 A;  2DYB A;  4F17 A;  4KGV B;  3LH5 A;  1KJW A;  4EMK B;  4C0D C;  3LGL A;  2LJ3 A;  5LJ3 g;  2PNI A;  2XU8 A;  2ZGW A;  5FWC A;  3PIP A;  3NTK A;  1KK7 A;  1S72 A;  5I22 A;  1LOJ A;  4L59 A;  2EBP A;  2DJQ A;  3OYG A;  2QTX A;  2M0O A;  3EGX A;  4C0D B;  4C5H A;  3HP9 A;  1VQ5 A;  1X2Q A;  4OB2 B;  3CMA T;  1QCF A;  1M3A A;  2BE7 D;  3Q1J A;  3VS6 A;  4PJO F;  2RPN A;  1M2V B;  2RMO A;  5KYX B;  4KH0 B;  3CCS A;  1YIJ A;  2RQW A;  1OX9 A;  3OA6 A;  2KAF A;  3O5Z A;  4OF1 A;  3X26 B;  4NS5 A;  2QEX Q;  1KC8 R;  1R8O B;  2K3Y A;  3M0Q A;  5FLX E;  1VQP T;  3D7S B;  2DEU A;  4M7A G;  5KE3 A;  3OMC A;  3DB4 A;  2X4J A;  3M0U A;  1N8R C;  3H0H A;  1HD3 A;  1VQN A;  2OJ2 A;  4C0G A;  5EC7 A;  5GJV B;  1EFN A;  3CCQ T;  1NEG A;  4HKE A;  1W2B A;  4HCZ A;  1ZBX A;  1K9M C;  4FIB A;  3C95 A;  3VS0 A;  5I2S A;  4M77 D;  1VQ8 A;  3PE0 A;  5LJ3 f;  3I55 T;  1D1C A;  4F14 A;  3JRZ A;  2DYI A;  2QYZ A;  1IGQ A;  1FX7 A;  3RBB B;  2DX1 A;  2QG9 B;  1RAH B;  3PVQ A;  1YIT T;  5GAN g;  4KRT A;  1D3B A;  2L3R A;  1VQO A;  2HL3 A;  1TSF A;  2DBM A;  3C12 A;  3M55 A;  4HCB A;  1D1A A;  4F04 B;  1PKS A;  2PQW A;  8ATC B;  2XD0 A;  3KFV A;  2QQB A;  2VAS A;  3LH0 A;  2DXT A;  3OSV A;  5LJ3 j;  2CDT A;  4M77 A;  2AZS A;  4E7S A;  3OYJ A;  1G5V A;  1YCY A;  4BE0 A;  3JCM W;  2EYW A;  3HKS A;  3V8J A;  1K4U S;  2E6Z A;  1VQK T;  3CCV A;  1OX8 A;  4J9F A;  4GLM A;  3EG3 A;  3X20 B;  4WTO B;  4B9X A;  2W10 A;  4IUR A;  1NBE B;  2VXF A;  5IXB A;  2KMT A;  3QO3 A;  2CUD A;  1M27 C;  4ZTJ A;  4FT2 A;  1YNZ A;  1M1F A;  1LVK A;  3CCM Q;  3JCM P;  2L0A A;  1YJ9 Q;  4XK8 E;  4IKF A;  2FG0 A;  3FC3 A;  1AWJ A;  5L23 A;  5ECA A;  2HCK A;  3SWN C;  1K8A R;  4M78 E;  5GJW B;  3NTI A;  3H8Z A;  4Z02 A;  3EFS A;  4BUG A;  2LQ8 A;  3CMA A;  2IIM A;  4BE1 A;  1W2B P;  3M57 A;  2LCC A;  5FWB A;  5GAM d;  4RTY A;  3JV3 A;  1I4K 1;  4A54 A;  1U5S A;  2KRO A;  4Q5W A;  3SWN B;  2ED0 A;  4ZGE B;  1M90 C;  4R55 A;  4KUI A;  2PTK A;  3HRU A;  1VQP A;  2JT4 A;  4A4H A;  4F7U B;  4K11 A;  2DE0 X;  2X4W A;  4C92 E;  3G4S Q;  4GLK A;  5CKH A;  4Z8A A;  4HA8 A;  3OS0 A;  4ELZ C;  1W2B S;  3RKY A;  3CC7 Q;  1T3L A;  2JM8 A;  2KGT A;  3P8B B;  3J81 E;  5D6X A;  5GAO r;  4XU1 A;  4HVU A;  5GAN j;  4J7F A;  2AKL A;  2F2X A;  2QQ9 A;  1GFD A;  3TU4 K;  1CKA A;  2XI9 A;  3CQT A;  3M56 A;  2VC8 A;  2PUO B;  1QP3 A;  4JLI A;  1QWF A;  5CO7 A;  3I55 A;  5LJ3 e;  3JB9 F;  3MCA B;  4F16 A;  1Q81 U;  4M77 B;  3FIF A;  4JDS A;  3T9N A;  2JVV A;  1IRX A;  4CC3 A;  5I21 A;  2DTO A;  2XKO C;  4PJO G;  1BB9 A;  4ESR A;  1OOT A;  1JRI A;  1WQW A;  1Q86 C;  1ZUU A;  5KYU A;  1VQK A;  1TTH B;  2CZ0 B;  1YI2 Q;  2OTJ Q;  1H3Z A;  2MF2 A;  1U3O A;  2L3S A;  3TSW A;  4NOY A;  1BCO A;  4A63 B;  1VQ4 Q;  1QCN A;  4J8O A;  4EMH A;  1Z9Q A;  2KQW A;  3OYI A;  1XNI A;  2E3I A;  2R58 A;  5EG2 A;  5IHK A;  1Y96 B;  1U1S A;  3A8G B;  2VV5 A;  5J26 A;  4ZNX A;  2QQS A;  1KIK A;  1NEB A;  2DZ9 A;  4OVA A;  2LQN A;  5CQY A;  2CT3 A;  2G6F X;  1U06 A;  5M9O A; 
#chains in the Genus database with same CATH homology
 2PVG B;  4NL3 A;  2QA4 A;  1QVG A;  1VQ9 T;  2E6N A;  2K57 A;  2D9T A;  3S6W A;  1VQ7 A;  3H6Z A;  3INZ A;  3GIB A;  2XHC A;  3C94 A;  4M78 D;  2KVQ G;  4C8Q D;  2BUD A;  3MEW A;  1O75 A;  3VKI A;  4B9W A;  1ZHI A;  2CS7 A;  5LJ5 h;  4QQG A;  4M7D C;  3PNW C;  3V7C A;  3M9Q A;  3QZ5 B;  2GCX A;  4BI4 A;  3CCU T;  1JBM A;  1JJ2 S;  3M5A A;  3OYY A;  1G3W A;  4ME7 A;  3LLR A;  2CYZ B;  4MZT A;  3OS5 A;  1U8R A;  3CC7 T;  3E1S A;  3VUZ A;  3QII A;  2I2L A;  5GAM f;  2M9U A;  5FRO A;  5GAN e;  1OZ3 A;  5HK3 A;  3S3N A;  1B34 A;  2DK3 A;  3GNG A;  1M90 U;  4M77 F;  3CCV T;  1VUB A;  1Q82 C;  3DLM A;  4JJN K;  3JB9 H;  4J7I A;  2P0Q A;  3CCR T;  2E12 A;  2GQV A;  3PTA A;  3F70 A;  5CKE A;  2EQK A;  2YLC A;  2V8K A;  3HRS A;  3A8O B;  2RJF A;  3LW5 E;  3M4Y A;  3QZ9 B;  1KQS S;  1I5L A;  4M7D B;  4M75 D;  4C5G A;  2R57 A;  4M78 A;  4C8Q A;  4M7A F;  4Y91 A;  2X4Y A;  2P4T A;  1WQ7 A;  2JZ2 A;  4WF2 A;  5LJ5 f;  3JCM e;  5GAN f;  4F7U G;  2GF7 A;  5CIU A;  5KE2 A;  2WSE E;  3JB9 J;  4N4I A;  3MP6 A;  3ZBD A;  2RH2 A;  1BI2 A;  2Y4Y A;  4C0F A;  3QYG B;  2RI5 A;  3DLL A;  5GAN 6;  3G71 A;  3OBW A;  1TH7 A;  4BAC A;  2K5F A;  5D6Y A;  5IAY A;  2JNG A;  3RKW A;  1XQH A;  3LWH A;  3AHU A;  4FM4 B;  2F5K A;  2HBP A;  4J6Y A;  5HK0 A;  2DD4 A;  2DXB A;  1YJW T;  2HQE A;  4OB0 B;  4P5N A;  3PFS A;  2RI3 A;  3ZEH A;  4BD3 A;  2OTL T;  2LCL A;  4M75 A;  3CCL A;  5LJ5 j;  3G7Z A;  3CCQ A;  3CC4 A;  4M77 C;  2AHJ B;  3OYL A;  1S72 T;  4J6W A;  5J3B A;  2CKK A;  2D0Q B;  3UPU A;  4C92 A;  1OYX A;  2VGM A;  4R56 A;  4N0A A;  1JB0 E;  2WAC A;  1VQ4 A;  4II1 A;  1YHQ T;  3FLG A;  4MDX A;  3S3O A;  5HKC A;  2EIF A;  3QJ6 A;  2E10 A;  1D3B B;  3FDR A;  4XQ3 A;  4M7A C;  2K5L A;  4M7D E;  2A7Y A;  3BDU A;  1YI2 T;  2OTJ T;  5GMK h;  3ER0 A;  1VQ5 T;  4ZGD B;  3SD4 A;  3CPW A;  3OYE A;  3M58 A;  3OW2 S;  4GY5 A;  5CKB A;  4QVC A;  4CRI A;  5FRN A;  2EJ9 A;  5DM7 R;  3VJP A;  4X9C A;  3WVD B;  5KCO A;  4LDW A;  2BKD N;  2PVD B;  3OYM A;  1Q86 U;  3CC2 T;  1K8A U;  1YIT A;  3CCS T;  4OB1 B;  3N5B B;  4M7A B;  1QW1 A;  2DIQ A;  2DXC A;  2K2V A;  2ZPB B;  1KQ1 A;  4EPC A;  1GXI E;  5GAO m;  3SWN A;  2ZPF B;  2XDD A;  4X9D A;  3X28 B;  4JS4 A;  4FL6 A;  5CVI A;  3CD6 T;  1HXD A;  2RK2 A;  4KUL A;  1XOV A;  4XTW A;  5CCA A;  4OMF B;  2L89 A;  1YJ9 A;  2ZPH B;  4A4G A;  2IVW A;  3QHS A;  4PL6 A;  3TCJ A;  1EIF A;  4MMK A;  4F7U A;  4PNO A;  4E7H A;  4PJO C;  2XID A;  2XK0 A;  5GAN 3;  4V2S A;  2EFI A;  4OGC A;  3TEE A;  1K73 C;  3VU3 C;  2FVU A;  2ZPG B;  4J5Y A;  4RCC A;  1PSE A;  4ZN3 A;  4JRP A;  3CCJ A;  1G3S A;  2GFA A;  4J83 A;  1UGS B;  3A5Z B;  1XTD A;  2RHZ A;  1H64 1;  3L2U A;  3NTH A;  3LWI A;  2BIV A;  4E7L A;  4M7D F;  1QVG S;  3QYH B;  2QI2 A;  4UC4 A;  3PIO A;  2DJZ A;  2RHX A;  3CME T;  4PJO B;  2RK1 A;  1OZ2 A;  2FYK A;  5GMK j;  5LJ3 d;  4HT9 A;  4XAX B;  2EKO A;  4RG8 A;  1YJN A;  1SSF A;  3VV0 A;  3CCE T;  1VQ6 A;  2YHT A;  5LL6 S;  3JB9 G;  3CPF A;  2LVM A;  3CBP A;  4LDX A;  5C0M A;  3QSU A;  3X25 B;  3MP1 A;  4M7A E;  4BI3 A;  3P8H A;  4KT0 E;  4JRK A;  2CZ7 B;  2MWP A;  4YTL A;  3JCM Q;  3DKM A;  1BIA A;  2GFU A;  1WPY A;  2LQK A;  3MP8 A;  3V7R A;  2CZ1 B;  2FB7 A;  3L2Z A;  3V8K A;  4A4K A;  3L2V A;  2M16 A;  3L1A A;  2DZC A;  3P8D A;  3RES A;  4BY6 C;  4C92 G;  3QG1 A;  5J39 A;  5KCH A;  3CC7 A;  2NLU A;  3BY7 A;  3JCM g;  4HT8 A;  1KHI A;  1NPR A;  2F5T X;  2XDP A;  4MDW A;  5GAM e;  2RA2 A;  1VQO T;  3LYI A;  3KXT A;  2XG8 D;  2EQJ A;  1M4Z A;  2E41 A;  1RI0 A;  3QDR B;  1Q82 U;  3M59 A;  1VQL A;  4O6J A;  2P0K A;  1DJ7 B;  4RKU E;  3JCM X;  4RMO A;  1KG1 A;  4BY6 B;  1VIE A;  3FJP A;  3S3M A;  3KUF A;  4EMK C;  5L8R E;  5GAN 7;  2O01 E;  5LJ5 e;  3JB9 D;  4PJO E;  5GAN 5;  1Q7Y C;  3GF5 A;  2ZPI B;  3FEO A;  4M7D G;  1AHJ B;  3OYB A;  1NZ9 A;  3M54 A;  2LT1 A;  1U1T A;  4BI8 B;  2RO0 A;  5GMK m;  2EJF A;  2RM4 A;  3RKX A;  2OAU A;  3MO8 A;  3OB9 A;  2PVO B;  3O8V A;  3C4S A;  4RG2 A;  2DTH A;  4J6X A;  1VQM T;  4C92 D;  5GMK i;  4EMK B;  1QVF A;  2P0P A;  4C0D C;  3LGL A;  3JCM c;  1YJW A;  4KUD K;  1M1K C;  3MHX A;  3OBY A;  1Y96 A;  5LJ3 g;  3MET A;  4Y28 E;  2QEX T;  1VQ7 T;  2XU8 A;  2ZGW A;  3PIP A;  3NTK A;  1S72 A;  3FB9 A;  5CQX A;  4ZGJ B;  1LOJ A;  2O4X B;  4L59 A;  4CI0 C;  2V8I A;  4XU0 A;  2ZPE B;  5DLQ E;  3OYG A;  5DLO A;  3GP8 A;  3L42 A;  2HAX A;  1WNL A;  3CPW S;  1PSF A;  1LNX A;  2KDS A;  2M0O A;  2QTX A;  3L2R A;  3G6E T;  3VYH B;  4TVR A;  2EQU A;  1M5Q 1;  2RI2 A;  4C0D B;  4C5H A;  1YI2 A;  3HP9 A;  2OTJ A;  5CKD A;  4KBM B;  1VQ5 A;  1Y07 A;  4OB2 B;  3GOX A;  2VYT A;  3CMA T;  4M7D D;  1JJ2 A;  3Q1J A;  3I56 T;  3CBM A;  4PJO F;  2K5I A;  4O5V A;  4M75 E;  5GAO n;  2RJC A;  2RHI A;  5AYF A;  3OYK A;  1N6A A;  3JSC A;  3PGG A;  3EFR A;  3CC2 A;  4VUB A;  2RHY A;  3CCS A;  5CR2 A;  3EAE A;  1WJQ A;  1QP2 A;  4M77 G;  3VYG A;  1YIJ A;  3OA6 A;  3JCM J;  1KHC A;  2IG0 A;  1BYM A;  2KAF A;  1NE8 A;  4A53 A;  4OF1 A;  3X26 B;  1KQS A;  1Y71 A;  3CD6 A;  2E1H A;  4NS5 A;  4ELY C;  2K3Y A;  1R8O B;  5FLX E;  1VQP T;  3R6O A;  2CGH A;  3JCM d;  4C8Q F;  4M7A G;  5KE3 A;  2Y4X A;  3OMC A;  3DB4 A;  2MWO A;  2X4J A;  3OY9 A;  3JB9 I;  2RB6 A;  1N8R C;  4ATO A;  4OGE A;  4XTU A;  5LJ3 h;  4IUQ A;  3UWN A;  4M7D A;  3G71 T;  1VQN A;  2LNV A;  4X34 A;  5GAO q;  1K73 U;  4C0G A;  2E70 A;  1IZ6 A;  3JCM b;  2X4X A;  1UGR B;  2YRV A;  1OI1 A;  4MML A;  3E9G A;  2RJE A;  2VXE A;  3PT9 A;  3CC4 T;  3HFN A;  3CCQ T;  1BI3 A;  4HKE A;  1W2B A;  3E19 A;  4HCZ A;  5GAO p;  1BI0 A;  1NJI C;  1ZBX A;  2G3R A;  5GAO l;  1K9M C;  2C06 A;  4FIB A;  5HY6 A;  2JUF A;  2B8A A;  4ZN1 A;  4F7U E;  3C95 A;  3CCE A;  4E7J A;  4M75 F;  3HL8 A;  5I2S A;  1WJS A;  4M77 D;  5A0G A;  1VQ8 A;  3HFO A;  1UEB A;  5GAM g;  3JAM E;  5LJ3 f;  2F69 A;  2V8J A;  3I55 T;  4XU3 A;  2DPP B;  3JRZ A;  4PLL A;  3OMG A;  1Q81 C;  3J7A F;  3WVE B;  1FX7 A;  4M7A D;  5A0D A;  4M78 C;  4C8Q C;  1LJO A;  3DB3 A;  2MI6 A;  3VUB A;  3URG A;  4QVD A;  2HQX A;  3GNF B;  1FWZ A;  1VQ9 A;  1YIT T;  3X24 B;  3OW2 A;  1B34 B;  2E65 A;  2WSC E;  5GAN 8;  5GAN g;  4LD6 A;  3FRN A;  1D3B A;  2L3R A;  4L6V 5;  1VQO A;  3BFM A;  3C12 A;  4PLI A;  3CCM T;  3M55 A;  4HCB A;  2XD0 A;  2PQW A;  1MHN A;  2QXF A;  3LH0 A;  2QQB A;  3PMI A;  4LDU A;  3GLX A;  2DXT A;  3OSV A;  5LJ3 j;  4M77 A;  3OYJ A;  1YJ9 T;  1G5V A;  4M78 B;  4C8Q B;  1YCY A;  4LDV A;  3CCU A;  4BE0 A;  3JCM W;  4LD9 K;  2DO3 A;  3HKS A;  3V8J A;  3JCM V;  2JOY A;  3A8M B;  2D6F A;  2DTI A;  2E6Z A;  2LX9 A;  4M75 C;  1VQK T;  4M7A A;  2E5Q A;  3CCV A;  4BDY A;  4A4E A;  4JS5 A;  4QQ6 A;  3V8L A;  1MGQ A;  5GAN 4;  3RMS A;  4C92 C;  4F7U F;  3CCR A;  3KBG A;  4N0A C;  3CCJ T;  3X20 B;  1QVF S;  4BB7 A;  5KH6 A;  3L2W A;  4B9X A;  3HHT B;  4IUR A;  2R5M A;  3SB2 A;  2VXF A;  4JLG A;  2KMT A;  1VQM A;  4DOV A;  1UGQ B;  4HCC A;  3QO3 A;  4IUU A;  4OP0 A;  1W4S A;  1YJN T;  3RUX A;  1Y7X A;  4M75 B;  5D6W A;  1M1G A;  4IUV A;  4ZTJ A;  1KC8 C;  1VQ6 T;  4JUV A;  4FT2 A;  1M1K U;  1G3T A;  1M1F A;  2QEX A;  4C92 B;  3BW1 A;  3JCM P;  4N4G A;  2X35 A;  3OYH A;  4E7K A;  2WSF E;  1KD1 C;  3SFM A;  3ASK A;  4XK8 E;  4PJO A;  5GAN h;  3CXC A;  2QDY B;  3FC3 A;  4IKF A;  3G4S T;  2EWN A;  1N27 A;  5A2Q E;  3G6E A;  2LC4 A;  3SWN C;  2QA4 T;  2VUB A;  4M78 E;  4C8Q E;  3NTI A;  3L2Q A;  5FRM A;  2OTL A;  2K4Y A;  3E9F A;  3H8Z A;  4DQ2 A;  5GMK l;  2XDB A;  4Z02 A;  4IUP A;  3EFS A;  4QQD A;  2LQ8 A;  4BUG A;  3CMA A;  3PMT A;  3I56 A;  2MMP A;  4FU6 A;  4BE1 A;  4DA4 A;  4XTY A;  1QVP A;  3M57 A;  2LCC A;  3JCM h;  3CEY A;  1YHQ A;  2LT4 A;  5GAM d;  2FHD A;  2Y90 A;  5CK9 A;  1I4K 1;  4EMG A;  4A54 A;  4ZTF A;  4Q5W A;  3SWN B;  5DY9 A;  4ZGE B;  3MEU A;  1M90 C;  2R5A A;  4R55 A;  4KUI A;  2LRQ A;  3HRU A;  3QBY A;  4IUT A;  1P92 A;  4FT4 A;  3OS1 A;  1VQP A;  2M1H A;  4A4H A;  4F7U B;  5GAM j;  2X4W A;  3A8H B;  5GAN d;  4C5I A;  5LJ5 d;  2JTF A;  3ME9 A;  3QPH A;  3SDZ A;  4C92 E;  1N9S A;  3A8L B;  3V7S A;  1UB4 A;  2L8D A;  5GAN 2;  4E7I A;  1N8R U;  1YBY A;  4GLK A;  5CKH A;  4XTX A;  3JCM f;  4RCB A;  1G3Y A;  1M9S A;  4HA8 A;  3OS0 A;  4C0Z A;  5IT9 E;  1N9R A;  4ELZ C;  4BE2 A;  3RKY A;  1W2B S;  2DAQ A;  4JRI A;  2XIC A;  3OQ5 A;  1V29 B;  3RIR A;  3ZFJ A;  3P8B B;  3OYC A;  3J81 E;  5D6X A;  5GAO r;  4XU1 A;  5GAN j;  4M78 F;  4J7F A;  2EJG A;  5GMK e;  2DD5 A;  2KK4 A;  2CZ6 B;  2QQ9 A;  4XU2 A;  2HD0 A;  3TU4 K;  1WJR A;  3OYD A;  1BKB A;  2XI9 A;  3M56 A;  3RMQ A;  2VC8 A;  4C5E A;  1NJI U;  3UDC A;  2PUO B;  1QP3 A;  1K9M U;  2H3J A;  3HSB A;  1M8V A;  5FU7 C;  2QQA A;  2ZCF B;  4A4F A;  4JLI A;  4NL2 A;  4BDZ A;  5CO7 A;  4EMK A;  4JRQ A;  4PKC C;  4D6W A;  3I55 A;  3MEV A;  5LJ3 e;  3CCL T;  3MCA B;  3JB9 F;  2ZZD A;  2DKG A;  1Q81 U;  4M77 B;  1O9S A;  3FIF A;  4JDS A;  1KQ2 A;  3T9N A;  3CME A;  2JVV A;  2YLB A;  3NFC A;  3OYA A;  3WXM B;  1VQ4 T;  2MAM A;  2O4X A;  2VGN A;  3J80 E;  1UGP B;  2PU9 B;  5FU7 B;  5I21 A;  2DTO A;  2DXU A;  2KY9 A;  3QUI A;  1YIJ T;  1HK9 A;  4C92 F;  5CKF A;  2RHU A;  2XKO C;  4OB3 B;  3GPL A;  4PJO G;  2JTM A;  2E64 A;  2L5Q A;  3CCM A;  3UT1 A;  4E47 A;  5FU6 C;  3TRE A;  1VIF A;  2HNI A;  1VQL T;  3QXE B;  4DOW A;  1JRI A;  3MEA A;  4LDY A;  1WQW A;  3HRT A;  4QVZ A;  2PUK B;  2RD1 A;  3OS2 A;  1Q86 C;  1K8A C;  3OYN A;  4MZM A;  1WGS A;  2FL7 A;  2LDM A;  2RJD A;  5CAI A;  5LJ5 g;  2QQR A;  1VQN T;  3QJY A;  2EYQ A;  1VQK A;  1X75 C;  1FXX A;  2CZ0 B;  1X6O A;  1IRE B;  4M78 G;  4C8Q G;  1H3Z A;  3HPW A;  2EAY A;  2DEQ A;  2MF2 A;  3CBO A;  2DIG A;  3OSS C;  4FSX A;  5FU6 B;  4NOY A;  1BI1 A;  5C6S A;  4XTV A;  4QW2 A;  4J8O A;  4EMH A;  4M77 E;  1I8F A;  2KQW A;  4EDU A;  1XNI A;  4XTZ A;  1BIB A;  3OYI A;  2R58 A;  5EG2 A;  3QKJ A;  1Y96 B;  1U1S A;  2EQM A;  3OYF A;  1ZQ1 A;  4MZP A;  1X01 A;  3A8G B;  2VV5 A;  5J26 A;  1Q7Y U;  1KC8 U;  3CXC S;  1VQ8 T;  2QQS A;  4PJO D;  2JN0 A;  3LGF A;  3BDL A;  3LX7 A;  1RL2 A;  5I2M A;  3RER A;  3M53 A;  2DZ9 A;  2DVE A;  1KD1 U;  4OVA A;  2A3L A;  2KSS A;  5CQY A;  5IN1 A;  5A0L A;  4M75 G;  5GAM h;  2K3X A;  3G4S A;  4N4H A;  1NPP A;  2LTO A;  3M4G A;  1I81 A;  5M9O A;  4L5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...