2RI6A

Crystal structure of s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
283
structure length
283
Chain Sequence
LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNAMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The tautomeric half-reaction of BphD, a C-C bond hydrolase. Kinetic and structural evidence supporting a key role for histidine 265 of the catalytic triad.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
total genus 104
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ri6A00
2C0PA 4MEBA 2X5XA 1BROA 3WKAA 3WKEA 3D4LA 2HM7A 3QITA 4C89A 4AX4A 2WLSA 4EY8A 5EGNA 1G5FA 2Z8ZA 4MWSA 4H7IA 3TRDA 2AJ8A 3STVA 1QFSA 2VJCA 1CPYA 1H2WA 4OD0A 5K5EA 4GDMA 3DKRA 3IA2A 2OGTA 1ZICA 1THTA 5D6OA 5AP9A 1F8UA 4HXGA 5EHQA 4L0CA 5ALOA 3AFIA 1VOTA 5ALSA 2XMRA 5CH5A 4HRXA 3UUFA 3D5EA 1QJ4A 2Z3WA 3WJ1A 3PE6A 5K3FA 4NZZA 2HA4A 5JZSA 2QJRA 1LPPA 3I2GA 3IDAA 3QMWA 5FKJA 3IBTA 2WU4A 1GPNA 1BE0A 4U2GA 1CFJA 2JF0A 3VVMA 5AM4A 2WIKA 3AJAA 1XRRA 2QS9A 2ROQA 3SWWA 5FP0A 1HBJA 3C6ZA 1XQVA 1TCBA 5AJHA 3DDUA 2Z3ZA 3WK5A 1JU4A 1ZI6A 4KAJA 5C8XA 4AN1A 2H7YA 2C7BA 2WIFA 2XB6A 2GZSA 3I6YA 4W63A 5T4HA 2BCEA 2WTMA 2XUDA 1CUHA 5A7HA 4Q3LA 1UK9A 4G4IA 3FVTA 4AMYA 5EHXA 2HIHA 2ZJ6A 1GQSA 3Q8WA 1TK3A 4W1PA 3I2FA 3D3NA 3I6MA 4G9GA 3WIOA 2XUKA 3RLIA 2WG1A 1XZMA 1ACJA 2ZYSA 3R3UA 2Y2UA 5K3AA 1YA4A 3ANTA 1J1IA 4H7KA 1G42A 4FLEA 4HRYA 4A16A 5JAHA 1TIBA 1QIKA 4Q3KA 4TPKA 5KREA 5HCUA 1ZJ5A 3STTA 4PSDA 2JGMA 1G4HA 2VEOA 5AM3A 1VXOA 1BCSA 2QOEA 3BDIA 2YASA 3IVMA 4J0GA 2HA7A 5ALMA 1P0MA 1XLUA 2GBIA 4FWBA 1BU8A 1XZJA 4Q34A 3WA7A 5AOAA 4BRZA 4M0FA 2GBCA 1UOOA 5LKAA 4H7HA 1OCEA 4QWMA 5AKYA 1Y7IA 2XMQA 5E2IA 2RI6A 3WL6A 3ZV7A 4DSAA 3VISA 2EDAA 2JGKA 1W6RA 5CBKA 2PSEA 2DHDA 2RIPA 4D9JA 4UHCA 3KD2A 4CCWA 2JGEA 5HF9A 2HU7A 2ZVDA 3DOHA 3H1BA 3HSSA 1UK6A 4X94A 2RHWA 4KE8A 3G0CA 4XVCA 3T52A 1P0IA 3WK4A 4B0PA 1JT2A 5AKHA 4K6HA 1E8NA 4J0DA 2OCGA 5A7GA 3L1IA 2DHEA 1EDBA 1MNAA 2OXEA 2XQJA 5AICA 2ZYRA 5FOQA 4KAFA 4U2EA 1W76A 2PL5A 1VZ2A 3M83A 2WG0A 2WFZA 2B61A 4ZREA 2JGIA 1VZ3A 4EY5A 2PUJA 1AC5A 2QRUA 5HFAA 4X6UA 1ZOIA 1L7RA 1XFDA 3PF8A 5ALWA 3PF9A 1CUIA 1CV2A 1EH5A 3IB3A 3I6ZA 3IUQA 4WY5A 2AJCA 4BVKA 3DJYA 2B20A 5A2GA 2HHAA 1TAHA 2CB9A 2ZSIA 4JNCA 2WJ3A 3I1YA 3PFCA 4X85A 5HZGA 3WI7A 1IUPA 4H7EA 4HXEB 2AJBA 4FOLA 5ALHA 3AUKA 3A2NA 4I19A 2WTNA 2WU3A 2CZQA 2WFLB 3E4DA 5AI8A 1CUDA 3S2ZA 5DTJA 2XUGA 5FDFA 1RWQA 2VATA 3STUA 5C81A 4BZWA 4N8DA 1H22A 1AUOA 4XWGA 2XDWA 2ECFA 2PSHA 4BAUA 3STYA 1FSSA 1CUBA 4PSUA 1YAHA 1P0QA 4QDTA 3G02A 1CQZA 4AXBA 1YSCA 4KE6A 2YYSA 3DL4A 1P0PA 2GYUA 2FJPA 4I4CA 1MX5A 3G8YA 3KSRA 1CIJA 4J0HA 3R0VA 2AJLI 1K4YA 3ANSA 3QBJA 5KBYA 2JEYA 3WIBA 4BAZA 3JWEA 3G7NA 1HQDA 4ZWNA 3F96A 4G5XA 3OM8A 5K3DA 4E46A 1F0NA 1DU4A 1SCQA 2XQFA 4J0JA 5A71A 1XRQA 4TVKA 2JGLA 2VA9A 4UHFA 2C4HA 2XQGA 4Q1VA 4C01A 3LLCA 2ZJFA 4QLAA 1A8UA 4MWTA 3O9VA 1XZGA 4CCYB 4LHEA 4ETWA 2ORYA 1XLVA 4UHEA 4ZRDA 3N2ZB 5ALGA 2QZPA 4OCZA 4BP8A 1FJ2A 1BN6A 4X7BA 3FBWA 4WCVA 5ALIA 1H2XA 4C88A 2ZSHA 6YASA 4WFKA 1C7JA 2OG1A 3QM1A 1H2ZA 4UBJA 1K8QA 5A6VA 1F6WA 2GBGA 1MU0A 3GELA 3T4UA 3BL8A 3VJMA 2J3DA 4QE3A 3WQHA 3IIIA 1Q83A 4HS9A 2XUHA 5JD5A 1QONA 5CMLA 4ITVA 4KAAA 3NWOA 3FCXA 4BB0A 3B3QA 2I78A 5CURA 3CN7A 1ZD2P 1QE3A 4F60A 3C5WP 3ZPXA 5IVHA 5JALA 1ZD5A 1HDEA 3MVEA 2QMQA 4E15A 4DNPA 4X95A 5K3EA 4Y2RA 4F5ZA 2G63A 1VE6A 1LZLA 1TQHA 1YB6A 1DQYA 3HJUA 4UHDA 3HLKA 5AK5A 4C87A 3WMRA 1QOZA 2HL6A 4AZ3A 4UPDA 4L9AA 4WDQA 2WIGA 4RPCA 3RKSA 4C4XA 2GBFA 5AKZA 3W9BA 1X2EA 1ZI9A 1G66A 3K9BA 4BCCA 2XUAA 1GGVA 4GWLA 4W9RA 4H7DA 4KR0A 1BRTA 2H9YA 4U2BA 2GYWA 3JW8A 3O0DA 3STWA 1CVLA 3FYUC 4EHBA 1EVQA 3PFBA 4X3CA 1LNSA 4BZZA 4INZA 4B80A 3ZLUA 1CEXA 1U65A 1S8OA 1ISPA 3DOIA 1CUEA 2OGSA 3H0CA 2VQ6A 3LIPA 3R3YA 5AM5A 5AKXA 3H2IA 5DNWA 2DQZA 4I3FA 5ALEA 3KXPA 3UMJA 5ALFA 3BIXA 4QDOA 2RAUA 4KE9A 3W05A 4FFVA 4OYLA 1QIJA 3EBLA 3A2MA 3G9ZA 4U2DA 3FYUA 4C4YA 4WDRA 5A62A 3F9CA 4GHWA 5ALXA 4Y2TA 4KEAA 2XMGA 5LKRA 1QIHA 4H77A 2O2IA 5JANA 1FFEA 5JAPA 2FX5A 1EX9A 5D3ZA 4IH1A 4MJ3A 2WFMA 5FRDA 2ZJ7A 5CW2A 2ACKA 2B9VA 5I8PA 1LPNA 5DLPA 1MPXA 1U2EA 4OU4A 3ZLVA 3VXKA 4H7JA 2XUIA 1PFQA 3OG9A 1UOPA 4U2FA 4WY8A 3YASA 4X00A 2JEZA 1MO2A 3DS8A 2R11A 1ZGCA 3OOSA 1WPRA 3D2CA 3WWPA 3HZOA 1Q84A 5AM1A 1N5MA 2JGFA 3VDXA 3OTQA 2HFJA 3V48A 4AB1A 1FFBA 4FLFA 5IH7A 2HDWA 1XRLA 4PSCA 1QGED 3WL7A 5ALZA 1O6GA 3BIWA 5AK3A 2LIPA 3PUHA 2C58A 4BC0A 3V1LA 2PUHA 4UFNA 3D7RA 1CUCA 4EB0A 1DT3A 4DYHA 4KJXA 1XLWA 3TGLA 1LZKA 1JJBA 2CMFA 3AZOA 1JU3A 3AIKA 5AM0A 3X3HA 4B81A 5JIBA 4EBBA 1E8DA 1WB5A 2XLBA 4B9AA 3LS2A 1QIEA 1GQRA 4C6HA 3ESCA 4CG1A 4IHAA 2BJHA 3ZLTA 4V2IA 1OILA 2O7VA 5IKXA 3H19A 3F67A 5KWIA 4UBNA 5CT5A 1TRHA 3B12A 3R3VA 2NW6A 5LZ8A 3CCBA 3I2IA 1DTEA 3BDVA 1AX9A 1W75A 1WM1A 4G4GA 3FVRA 3CN9A 2QT9A 2C5FA 3I1IA 3WWDA 5JARA 4RE5A 3EQ7A 2WUDA 5CH3A 4BBZA 4G4JA 1T4MA 1QIFA 4A23A 2DCMA 3G0IA 3C8HA 3NUZA 3H17A 4OPMA 1LPAB 3FSGA 5EHZA 1IUNA 1TCAA 1JJFA 2QJWA 5K3CA 3DEAA 2PPLA 3PICA 5DWDA 4QDXA 1JI3A 4BCDA 2HA0A 5AKEA 5CT4A 5AHXA 1Z68A 5FPPA 5E4YA 1CR6A 4GXNA 2QM0A 4JH0A 1BS9A 4GLBA 4ZI5A 1ODCA 4BVLA 1QIMA 4UHHA 5AKGA 5CT6A 4Z49A 3WZMA 3VVLA 4AQDA 1N1MA 1EK1A 3RM3A 4HAIA 3C45A 1EA5A 1KU0A 2XMDA 2D5LA 5DYTA 4P9NA 2OCIA 5I9IA 4KRXA 1VE7A 4G9EA 3KDAA 1ZIXA 1CUAA 1RP1A 1CUXA 4GI1A 5LZ4A 2OAGA 3F97A 1WB6A 2WJ6A 1IVYA 1CUFA 2PKYX 2OGZA 3E3AA 3FSGD 3RARA 1E8MA 2XMZA 4AO7A 1QO7A 4FMPA 1C4XA 1EB8A 3BWXA 3G0GA 3HC7A 1UFOA 2Q0XA 5ALNA 1CUJA 5AK6A 1WCYA 4UBOA 3I2KA 3G9TA 1XQYA 4UBIA 4MEAA 3H2HA 1XKLA 5SYNA 5HQ3A 1QIIA 7YASA 1WPXA 4QNNA 5ALYA 3ESAA 2OPHA 3H2KA 4AO8A 1DWPA 2HU8A 2XUFA 1UZAA 3DLTA 1J07A 1ZI8A 4K6GA 2ACEA 4N8SA 2XQKA 1XRNA 4ROTA 1UXOA 2XUQA 1SC9A 2V96A 4B7ZA 3M3DA 4MQLA 4BE9A 4J7AA 4ARAA 3E0XA 4LXGA 4B84A 3F98A 3I2JA 5EI5A 2YH2A 5EHNA 2XLCA 1NX9A 4EUSA 3IURA 4KRYA 4YK7A 2WHPA 4PO3X 5LYYA 1E89A 1QFMA 4Y9SA 4TGLA 1R9MA 1CLEA 3K6KA 5ALLA 1QTRA 3WWCA 4J0CA 4BP9A 2VTVA 4DM7A 1UKCA 1EK2A 1ODTC 1O6FA 4WFJA 1JMYA 1CUYA 1ORWA 4UFPA 2PM8A 2BUBA 4FLMA 3R41A 1N8SA 4EY7A 5C8VA 2CBGA 2BGRA 4Y2SA 4W1QA 3EF3A 5ALKA 2VJAA 4XJVA 1GT6A 5D3KA 1THGA 3QMMA 3M82A 4N5IX 2O2HA 5HK9A 5HF8A 2WHPB 3D0KA 3WK6A 3GA7A 3KWFA 3ZI7A 2WUGA 3SX4A 1CUVA 4FNGA 2EEPA 2HA3A 4QZVA 1QIDA 1K5PA 1XZBA 1XZKA 2WM2A 2PSDA 1XZEA 5D7BA 4XX1A 2OQVA 3W9UA 3BXPA 3OC0A 4PQEA 3WK7A 1XQXA 2DFPA 4DMKA 2V97A 1QTIA 3WL5A 3H1AA 1E3QA 3QH4A 1A88A 5CH8A 3SK0A 4LYEA 4FNMA 3H04A 2JIDA 3AILA 2CKMA 3FOBA 5YASA 3A6ZA 3V9AA 3C6XA 3HI4A 1Y37A 4X6YA 5ALRA 4GEGA 3KWJA 2ONCA 5DYYA 1UK8A 3LIIA 5C8ZA 2PSJA 2BUCA 1IMJA 4KACA 1GXSA 1QO9A 2B4KA 3KOOA 3TEJA 4ZGBA 5FUMA 4DGQA 2RHTA 5CT8A 4ZV9A 4X90A 1I6WA 5EIHA 4CIAA 1JMKC 3FAKA 1JJIA 2I3DA 1LBSA 4X93A 4J3JA 4YX9A 1CQWA 2UZ0A 4MQMA 2WUEA 4J0KA 4LXHA 3HABA 4X97A 2I3ZA 5E4JA 2H1IA 1BEZA 1UK7A 1J06A 5DJ5A 1XZHA 1VA5A 1UWCA 2RGUA 2VAXA 3BJRA 4FDMA 3H2GA 5CXUA 1XZDA 3PDCA 1MX9A 2G4LA 4Y2YA 3VKFA 2HFKA 1LPBB 1XZFA 4G8CA 5ESRA 1AKNA 2QXUA 3FCYA 1ZD4A 1H2YA 4S0XA 4CG3A 4EA6A 1H23A 4EY6A 1QIGA 4YPVA 5ALJA 1YASA 4P92A 2I03A 3O4GA 1HKHA 1XRPA 1SOMA 5HQ3B 4UFOA 3QPCA 1YR2A 1EB9A 2K2QB 5AH0A 2O7RA 4KYVA 1AMNA 4OB8A 3CCCA 4DSZA 2QXTA 4OU5A 4F0JA 1MAAA 4DNQA 2JBWA 2VT7A 3SC2A 1A8SA 1EINA 1J2EA 5LIPA 1GZ7A 1CUZA 1XRMA 1BCRA 4G1FA 4X6XA 2ES4A 1QZ3A 4QEKA 4XIIA 5SYMA 3EQ8A 4HZGA 4Y2XA 3O9MA 3B5EA 3C8DA 4UBMA 1AZWA 3HRHA 3WLAA 4AO6A 1W4LA 1MNQA 3U0VA 2BAGA 5AIAA 3FLEA 4OUKX 5EFZA 1HLGA 4Q05A 1OXMA 2BKLA 3HYSA 2P8SA 2XI4A 1R1DA 3HACA 2H7XA 2VSQA 2WQZA 4QLOA 5AI4A 4HVTA 1R50A 2DR0A 4G8DA 2BUAA 4H18A 1UT6A 4RGYA 5DNUA 4PF1A 5ALVA 4Y2QA 2WSLA 3O4HA 1GPLA 4FBLA 3PUIA 1PJAA 1YB7A 4BCBA 4BATA 4B9EA 3A70A 4Q82A 5AKIA 2CEKA 4L72A 3D59A 4Y2VA 3GBSA 5JYCA 4IQ4A 3MUOA 4UBLA 3V1NA 5K3BA 5ALPA 1ODSA 1XQWA 3V1MA 4BTVA 1NU6A 4LKOA 3L1HA 4CG2A 1C7IA 5DNVA 2EDCA 3D2AA 1LGYA 2VJDA 3EIOA 3WK9A 1BN7A 1WHSA 3PI6A 3BJMA 1E66A 4OB6A 2OLEA 4LIPD 1IZ7A 3IUMA 2W6CX 3WL8A 5BWCA 2HRQA 4EZIA 2QUBA 4BE4A 1VJ5A 4PW0A 2DSNA 3BE8A 5AO9A 4M0EA 1VXRA 1N5RA 1R4ZA 4UUQA 2BFNA 4K2AA 4BDTA 2XT0A 5T4EA 2BGNA 3GROA 4K5QA 3IULA 4F21A 1ZIYA 1ZJ4A 5KWJA 2ZYHA 1K6EA 4Y7DA 3NGMA 5AIBA 3F8SA 3I28A 3K2IA 3H2JA 1SCIA 1CUSA 4GW3A 2FJ0A 4K6KA 1U8EA 4NMWA 3HXKA 4O08A 4B6GA 4Q3OA 5LP1A 1LLFA 5T4FA 1B6GA 4AMZA 4B83A 2D0DA 1FFDA 4DMFA 4BRSA 4E11A 4GBGA 4QWWA 5JAOA 3AIOA 2IIVA 3DQZA 5AKKA 1ZGBA 2WG2A 1GPKA 1TKRA 5FLKA 3NOXA 1XZAA 3ZWQA 4ARBA 3G0DA 1MN6A 3EQ9A 5ALQA 2QTBA 1EHYA 3ED1A 3R3XA 1Q0RA 1WB4A 5IVIA 2QR5A 4B85A 3W06A 3WWEA 2HADA 3DD5A 4DMHA 3C70A 4DNFA 5JD4A 1R9NA 5IVDA 1USWA 1YS2X 5I7UA 3Q0TA 5AM2A 2GZRA 5E4TA 2VT6A 2XE4A 4H7FA 4BVJA 1KU6A 5DYWA 1R88A 3VJKA 5JZBA 5HK8A 1DX4A 1MJ5A 2J4CA 3ESBA 2WIDA 2Z5GA 4FBMA 4Y2PA 3FLBA 3MUNA 1FFAA 4NS4A 3ESDA 1ZD3A 1MX1A 3UUEA 4GECA 5HKAA 3AIMA 5JZ9A 3C43A 3A2LA 2DHCA 2VF2A 5LZ5A 1GKLA 1TCCA 3QZUA 4MYSA 2PX6A 1Y7HA 4FTWA 4QDZA 4BAGA 3C6BA 3STXA 3FLAA 3G9UA 1WHTA 1B41A 4QDUA 1ETHA 1MT3A 2WHQA 4QA9A 2VJBA 1X2BA 3CXUA 5HF6A 5AI9A 1X70A 2WKWA 3LP5A 5ALDA 2R8BA 5BWBA 5BV7A 3DYVA 5JD6A 3WZLA 3DKKA 4CI9A 5HKBA 4X92A 4LXIA 3S8YA 5LZ7A 2Y1KA 3WK8A 2XMSA 2H7CA 3WKCA 1GKKA 2ZYIA 4HXFB 3H18A 3QPAA 3W2TA 1CUGA 1LPMA 5BOVA 3D2BA 2WHRA 2HRRA 1EDEA 4AN0A 2HA6A 4OB7A 5CRIA 1EDDA 3WJ2A 1XROA 2WIJA 3OURA 2XMCA 2C5GA 3O95A 1DINA 1HL7A 3VJLA 1EI9A 5AK4A 4EY4A 2OCKA 3G9XA 4W1RA 5AI6A 4J03A 2AJDA 4MYDA 3WYDA 3DCNA 2WFLA 1WOMA 1HPLA 1K63A 4P08A 3I2HA 3C87A 2HA5A 2JGJA 2Y2VA 1FFCA 1YS1X 4FHZA 5EIEA 4OSEA 1W1IA 4L3WA 4H35A 2WUFA 3R3ZA 4DNOA 1JKMA 1W52X 3QYJA 1QLWA 4YASA 2V9ZA 1KEZA 1D07A 3OPMA 3BF7A 5CT9A 4DTCA 1R3DA 2WILA 2PSFA 4NVRA 5CTAA 2DQYA 3O4IA 1VA4A 3JYHA 5FV4A 2OCLA 1BEEA 1YA8A 1VKHA 2X8BA 2WJ4A 4BTLA 1VLQA 3FYUB 3C6YA 3QVMA 4CCYA 2XUOA 1L7QA 4AZ0A 2HU5A 2PVSA 3GFFA 4X91A 3FWHA 3R3WA 2VAVA 4RNCA 3G0BA 1CUUA 2PBLA 3V1KA 1MTZA 2OQIA 5IVKA 3TJMA 3QPDA 1F0PA 4HTAA 2PU7A 5AOCA 2J3QA 3WYNA 4Y2UA 5EIAA 3R40A 4Y2JA 3WKBA 1Q0ZA 1AGYA 4UHBA 5AKJA 2XQIA 1L7AA 2FUKA 3L1JA 5JADA 2QUAA 4FKBA 3HEAA 4N8EA 2YXPX 5HF5A 1DWOA 4UBKA 1MAHA 3N0TA 4DLNA 5JASA 3C5VA 2CJPA 4PNZA 1SCKA 2G5PA 2Z8XA 4ZV7A 4JEIA 4U2CA 4PV7A 3AZQA 4IH4A 3M81A 4BYMA 2XUJA 5AI5A 1LPSA 5AI0A 2G5TA 3E1GA 3FYTA 1A7UA 4N5HX 5ISMA 4CFSA 3MGAA 3BF8A 4BC1A 1XZCA 3P2MA 5T4BA 4LYDA 2IITA 4JUIA 1ORVA 4H0CA 1M33A 4M0MA 5ALUA 3FNBA 5FXMA 2XUPA 4ZXFA 3AINA 2C0QA 4FFWA 5A7FA 1LPOA 4X71A 2QVBA 4A5SA 5LZ9A 2W22A 2AXEA 1E5TA 5J3JA 5DTIA 1XKTA 2IX9A 4B82A 4E14A 3W04A 5F4ZA 2Y6VA 5LZ2A 3LCRA 3WKDA 5H3HA 4DIUA 1CUWA 5C7YA 3O4JA 5AOBA 4WJLA 1CRLA 3QMVA 3IUNA 1DQZA 2GYVA 2E3JA 2Y6UA 2HA2A 4G8BA 4IO0A 1PV1A 1YAJA 1EVEA 2J4FA 2X76A 4IH9A 1ACLA 1A8QA 1RYYA 5HFNA 2O2GA 3DYIA 4DMCA 2OAEA 1AURA 3IUJA 1UKBA 4RE6A 4JYPA 1DWQA 3RK4A 5ALTA 4OYYA 3ICVA 3U1TA 1T2NA 2RONA 3AZPA 2PU5A 5FPQA 1IUOA 1XZLA 1DX6A 4MXDA 4KE7A 3ICWA 4P93A 4B0OA 5AKLA 5JAUA 4JYMA 3DL7A 5LLSA 1LBTA 4BDSA 1AQLA 2XMBA 4W1SA 2V98A 1EXWA 3GZJA 1NU8A 3WA6A 5K3FB 3WWOA 1YCDA 1SFRA 3GUUA 1U4NA 1DT5A 5CXXA 2CUTA 1JFRA 1IZ8A 1UKAA 4WFIA 3ILSA 4C4ZA 4J0IA 4CIBA 3DNMA 1UOQA 1XZIA 5JATA 2QKYA
chains in the Genus database with same CATH superfamily
5KJFA 4YAUA 2ONKA 5B2EA 2IEGA 2FEKA 3D8NA 2X15A 4PGAA 2R6HA 4MEBA 4N0PA 1BROA 1USIA 4RW0A 2OOSA 2PT9A 4BX8A 4ENWA 1NP7A 2HM7A 4D3SA 3QITA 3JAMA 3GRCA 1S89A 3ZUPA 4YO7A 5CW1A 4EMUA 4Y2HA 2JB9A 4MS1B 1NMXA 1FTYA 4MPJA 5CDHA 2VHTA 3CT4A 3ESYA 4FOPA 2FR1A 1EP3B 1RBZA 2W11A 3R20A 5A04A 2YIDA 2RHDA 5EGNA 1VYUA 1ZGJA 2VTEA 5D8DA 3ZHZA 3ZCVA 1HORA 1SBNE 1W5TA 2E6UX 1XPUA 1FMTA 3PPIA 4PY2A 4PIPA 2E89A 4HN9A 1U3DA 2WVAA 3KAJA 3NH6A 1QFSA 3AETB 1H2WA 5JO0A 2PJUA 2Z08A 4OGWA 3ANNA 3E9QA 3NGLA 2VAWA 2W4QA 3IUSA 4PAOA 5DN6A 5DBOA 1JG7A 2WQ6A 2BBOA 3F4KA 1DIHA 3ZJUA 3JQEA 2QWXA 2O7NA 1THTA 1U2TA 1EFRD 1NVVQ 1I14A 2H8KA 3OEED 4YQEA 5BNFA 4BLPA 4BLSA 1FX0A 3J81k 3GAMA 3SSAA 3RWOA 4CMKA 3FF1A 1APBA 4QGSA 5BWOA 1PE0A 4GLOA 4WN9A 4GPBA 4LFCB 4IQFA 4JD5A 5SV2A 1EPUA 5AUQA 2O8FA 2FWRA 5KWEA 3MFQA 2N75A 3W8EA 1N77A 1ZWLA 1PL7A 4CT0A 3H9JA 5ESXA 2HR1A 4EYOA 3UUFA 3E82A 4MW5A 4X1IB 2ZP1A 1QJ4A 3TQIA 1N34B 1P31A 3IAM1 3WJ1A 3CBQA 2O50A 3AR8A 3PE6A 5A4FS 1VYVA 1D2AA 3BJIC 4HNAA 2HA4A 2PIDA 4XB1A 2IYEA 1AMUA 2QJRA 3UJ8A 2ZRDA 3QMWA 5FKJA 2MHCA 1LXCA 2BEUB 2WT9A 3IBTA 3QX9A 1GPNA 3CG4A 3F46A 4IM7A 2OORC 4QPZA 1T6BY 5EXXA 1ISFA 5F73A 2Q3MA 4Q00A 2BFDB 1ORRA 1YDEA 1CQIB 4KR3A 1QKIA 3TLEA 2QLJA 2WIKA 4OXIA 3K96A 4DDUA 1XN4A 3BMQA 3EA4A 2ZR7A 4QQ8A 4B4UA 3M6WA 2CBXA 5BN3B 4ZODA 1E6EA 1V7ZA 1XRRA 2ZT7A 3EXFA 3HHPA 1WA5A 4Q9NA 3E03A 4AWBA 2EQAA 3EDQA 4JU8A 2IS1A 1RFGE 3C5EA 2QS9A 3JTEA 1A1VA 1F8GA 3FOFC 2ROQA 2JCYA 2VTDA 5B12A 4RULA 4KPEC 3SWWA 2I8CA 3VKGA 5A3RA 4DN6A 4IGKA 4LJ7A 3HVRA 3LY9A 4JOCA 1Y1KE 5AJHA 1X1SA 4EFDA 1XDWA 4AW9A 2FV8A 5JR3A 1C5KA 4BVAA 1CQXA 1DKPA 2XXAA 1P6XA 4A6DA 1SUCA 4TSFD 3GJ8A 1YU9A 3MOGA 1CQIA 1RQ7A 4UAVA 2Z5VA 3NHFA 4NNPA 4PSKA 3BMCB 3I9V6 4L78A 3BGWA 1PFVA 5K8UA 2N1MA 3X1YA 2JJ1D 3AEQA 3ZQJA 3JRXA 1G21B 1IQRA 4J43A 5A9TA 4JLKA 4HMPA 2CJXA 2FZLA 3KZVA 3LA6A 3HFJA 1UPAA 2ISQA 3K8OE 3R9XA 1V43A 2BCEA 3RRYA 1MOSA 1OD6A 2WTMA 3EGOA 1DC6A 5F78A 2H52A 4O29A 2JFQA 5IBRA 1QG0A 3N6VA 3L4EA 1E1MA 5EA2A 2FHSA 4D02A 2QP9X 2ZBVA 4Q3LA 1OWOA 5DI3A 2Y71A 3FBGA 2IEZA 3E7XA 1IU9A 1LCIA 2R8RA 2QRNA 3FVTA 3Q3GE 4AMYA 5JNWA 1IZYA 1BOFA 3R77A 4OSPA 3CEPB 3Q8WA 4NCNA 2H5IA 2XE7A 3JVUA 2GEFA 4JELA 1ECPA 2E5FA 3WLMA 1PD1A 3I2FA 4ZMRA 2YFYA 4JQYA 3RLIA 4XDHA 1XZMA 4TKZA 2OKGA 3K09C 3H3XA 4J7XA 4XTRA 2V6FA 2ZJAA 2ZYSA 2G0NA 1VMEA 1QUEA 2O5VA 1Y89A 1R8YA 2Y27A 1P75A 5JSKA 1YA4A 1Z17A 3OZEA 1E9EA 2IQ5A 4CKBA 3ANTA 4MUEA 3O2JA 1LQ2A 5JNRA 3D0OA 1NV9A 3B78A 1XTIA 4GOMD 1IM2A 4PC6A 4BKOA 1VKOA 4KIWA 3E61A 5KHOC 3IP6A 1DUSA 4HX5A 1W36C 1W4CA 4FLEA 3W4KA 2NTVA 5JAHA 5FTMA 1V95A 2RGNC 4HGOA 4RC9A 4RSGA 4HSEA 5KNCD 2ZPTX 1MC8A 5AUNB 2F90A 1U2PA 4HMQA 4JKYA 3RS7A 4HWKA 4P82A 3RJMA 2PRIA 4HTFA 5EKTA 2F7SA 5HCUA 1ZHHA 2GN8A 3JWIA 2Y4NA 3ZDAA 3QEMA 1IN1A 2C07A 4Q24A 3IT1A 4MSUA 1BIFA 3RYHA 1C30B 1LTKA 2OCAA 3QPVA 1F0YA 3OJCA 4EF4A 1YR7A 2YASA 2FPKA 4J0GA 4JA2A 4XLLA 1KVUA 1WHSB 1QU3A 4KDEA 3RVRA 3D3EA 2CVHA 2JJMA 4GWKA 4ZCLA 1K7YA 3SJ7A 3L7BA 2OFXA 4FIZA 4LSWA 4V1CI 3KKQA 4P53A 1XZJA 3LDGA 4RVGA 1X3LA 4CXMA 4OP3A 4KBFA 5DCLA 3RC2A 5CB8A 4URVR 1HDIA 2HK8A 4JVLA 1YK0A 2O8DB 4M0FA 5FJIA 1U4OA 3DO5A 1EGHA 1RTTA 1OCEA 1S01A 3PD7A 1PT8A 4MR9B 5BQOA 1NI5A 1ZH6A 2C2ZA 2JNWA 4PU0A 1TKCA 1BMFA 1J24A 2Q99A 1HH4A 3LPNA 3MINB 4EG7A 2QORA 4EGQA 3OD1A 2EDAA 2JGNA 2AMLA 3OX2A 1GZVA 5KKNB 4EB8A 1YT5A 5CBKA 1N1GA 1A5SB 4HWSA 2F9LA 1DMSA 3L93A 4ZHQA 5IK2D 3EEQA 4TYYA 5B7QA 2HTEA 1SK9A 4IQ0A 4ESOA 2BGLA 2RIPA 3TIXB 4UHCA 4D9JA 3KQHA 2W8BB 3OLZA 4A8TA 1QPZA 4W6ZA 3Q85A 4AYTA 2I1WA 3L4BC 4MVWA 3NT2A 4NBSA 4INAA 3KSMA 2R86A 4KNVA 5L8VA 1ZNQO 5HF9A 4AXXA 1GPWB 1DEXA 3O84A 4LXYA 1T9KA 4BNKA 1HRKA 2ORVA 3DOHA 3QUSA 4Z7OB 3A26A 1N36B 5L45A 3RT9A 1R8SA 3NHZA 1Z5PA 1N7JA 4ZYZA 3H1BA 5KYWB 1F38A 3O93A 3O8CA 5A05A 2A9JA 3GDFA 3OIDA 4DUPA 4N5DA 2O2ZA 2FW6A 1G5QA 1UQTA 1R5OA 1W0JA 2AN5A 3QW4B 4XVHA 5C1PA 1W59A 3DTYA 5LM3A 4KFUA 4W9NC 3WK4A 1OWMA 1V9SA 2WZCA 4HYTA 1DG1G 2GFHA 5COQA 1SC1A 2W8BA 3F6EX 4TV9B 4DIEA 1JT2A 3SEAA 1JG6A 1W34A 1X15A 4UOZA 3L7NA 1TYCA 2ZBQA 1GGNA 2NZYA 5AKHA 3FPLA 3KOZA 4J0DA 3OZ7A 5EZSA 3RQIA 3DVSX 1RQNA 1DUVG 2OCGA 2W2XA 5G3YA 1XELA 4EAQA 1XTSA 3KQYA 3FAZA 5CVEA 3KOXA 1QR2A 1R0KA 1MHPA 2B98A 1QAQA 5CYPA 1RLTA 3K31A 4L4UA 1RM0A 2RAPA 1C8BA 1VE9A 2J07A 2JFBA 3A36A 3CIFA 1B6RA 1XMXA 2DFVA 2JHAA 3NHRA 4KAFA 1ACMA 1QQ5A 2X7JA 3K1AB 3M83A 3N6XA 4BP1A 4RPKA 4RWEA 1BQEA 2WFZA 3RC1A 1SKYB 2I33A 4IG9A 4IP0A 4KQFA 4PVCA 3WLQA 4LBVA 2PUJA 1YV9A 3LQ4A 3OTWA 5KNBD 2ASEA 5GONF 4MKXA 2FW0A 4RMGA 4AKEA 1XFDA 5BVHB 5ALWA 1N9ZA 3ND5A 4GZ6A 3VU9A 4E2XA 1A82A 2D2XA 3LKDA 5CX1A 1EH5A 1FXSA 4QO8A 4CKZA 1Q1QA 4H15A 2X9VA 3W2FA 3JAKB 2X42A 2H0QA 1TE2A 1PEYA 1OFGA 3JVIA 3D02A 4XWAA 1GKIA 2GMWA 3MS4A 4AQYB 2RG1A 3QVSA 4RTJA 3BKXA 1E6UA 1K3FA 2HCFA 3KUDA 3IT2A 1NNSA 4FMDB 2Z83A 4WY5A 5IMBA 4C4AA 3AVWA 4CM1A 1TCVA 2B20A 2O3JA 2HHAA 3OX3A 4JNCA 2WF7A 3QUBA 2IWRA 1DEKA 2WJ3A 3DEJA 3L9WA 5JTTA 2PLRA 3IIMA 1X7HA 3IVRA 4ND4A 4WVLA 4DLZA 4BQNA 4YMGA 1GTRA 1NVVR 5DXAA 2W2NA 2AJBA 3AJ8A 3AM3A 5EQJB 3I9NA 4FOLA 2Q28A 4M87A 2YCLA 1HSOA 3GQVA 4DOMA 2RD2A 1DELA 4RD0A 4A10A 2XB4A 2JLXA 1HE4A 1ZK3A 3EASA 3V2IA 5JQWA 3NDIA 4A0FA 1M0WA 2WU3A 3LBFA 5G1NA 2FN3A 3R7DA 3FMFA 2NV6A 3CX7A 2XWQA 1LQTA 4NYMR 3FIUA 3I4CA 3E4DA 5AI8A 5AJZA 4QXQA 3IAUA 1LJLA 2BSAA 1R6UA 5L3SB 2ZUFA 5CDUA 1QQ7A 1R6AA 3GEMA 1NQAO 3JYLA 2K5UA 4PZAA 4X0EA 2GEBA 4NK4A 4CIDA 2J5KA 4N8DA 2QROA 4HYEA 3VOAA 4Y67A 4HQRA 2ZSAA 2CBZA 3OX1A 2HF9A 4FYXA 1Z4PX 2VSFA 4MWBA 4QTZA 2OFFA 4DLKA 5LDHA 3QJGA 1W46A 2XDWA 5IAOA 3DGFC 4E5NA 1P1CA 4FE7A 2ECFA 1Z2NX 2W98A 3AJDA 3CX6A 3OFVA 4CKEB 2W2KA 4YT4A 4IGFA 4P31A 1Z2OX 5JH7B 5FWDA 3BN3A 1OZFA 4J9VA 5H0IA 5BSWA 1EK6A 1YAHA 1L4MA 3GGDA 5A9SB 3ZCQA 1JE1A 1YR8A 4QDTA 2O54A 3BMXA 5J63A 4F5DA 1CQZA 3NGXA 1KJJA 2TSYB 2UUOA 2YVQA 2YN4A 1KS9A 2O6HA 3G8CA 3PFGA 1JIKA 2ZRIA 3HYCA 1GNRA 4K86A 4A0GA 3D1LA 1ESCA 5BW5A 1RMYA 2HBZA 4AM8A 2GTIA 3OCVA 1PGJA 2YRFA 1FB5A 3FZGA 4HEJA 3TPCA 5B4TA 4P6VF 5DIZA 1POXA 3G6WA 1Z6YA 4NZOA 1PR5A 4JT9A 4N6OA 1G2QA 2XEDA 1MX5A 3G8YA 1YRBA 3NTOA 5FPHA 2V74B 3KSRA 4UTXA 1GGJA 2WA2A 2ZW9A 1UMDA 2PMWB 1I2DA 2EARA 3A4TA 4Q1CA 1GG8A 2JLQA 3UBMA 3SY8A 2VPZA 2CVPA 3NW9A 2GSWA 4MUHA 3BZUA 4YUXA 2HJWA 3EIFA 3VU3A 3IQFA 4G56A 3LNTA 1WY7A 4FBGA 4TKMA 3TW4A 2O19A 2DBVO 3JWEA 1L4GA 2CFIA 1BFKA 2QAJA 1OT3A 1F48A 1M1XB 1VMKA 3GT7A 4LDRA 2JH9A 1HQDA 4Q4AB 5L3RA 5ITZB 1BNCA 3F96A 3O8LA 1KKLA 3PG5A 3D2LA 3ROKA 2DU8A 2WJZB 3BMOA 1Z3CA 3OM8A 1EEXB 3QVWA 2NQ2C 1XTRA 5IKEA 1F0NA 1XXHE 2PBRA 5AW8A 1T9CA 1XRQA 3OESA 4I1IA 4WOKA 1QRUA 3KCQA 3M49A 2JGLA 2YXEA 2H1OA 4RORA 2PH5A 3GPBA 4XPZA 1E20A 3PB3A 4C2TA 4ZCMA 2BR5A 4AKIA 4Q1VA 1BE1A 3EPKA 5A1JA 4QLAA 5GZ3A 1A8UA 4E22A 1RXIA 3GLFB 1G18A 1US8A 1WQ3A 2JLBA 3ODPA 1XZGA 1ZVQA 4KVGA 5ILOA 3R23A 4J75A 4CCYB 4D80A 4YAIA 1IDN1 4TMKA 3IJEB 3ADBA 1GY8A 1LLQA 4JJ4A 4YC7A 3FHTA 1VKRA 4UTRA 4Z99A 4ZRDA 1Z28A 2Y77A 3N2ZB 1JN0A 4WY2A 1JQAA 5AXDA 1JNXX 3C16C 4RH3A 2WWGA 2VK8A 2Y9PB 1GSHA 1A27A 1XPJA 4X7BA 1DADA 4BLUA 2NV2B 4I9UA 1GG5A 4US2R 5SY6A 3UF0A 1E3WA 4DDHA 3UPDA 2V59A 1S1CA 1H3NA 5AVUA 1L5RA 4LOLA 4M8IA 2VNKA 4LRWA 5ALIA 5GQSA 1X7YB 1XL1A 3M6IA 3NPAA 4C88A 4HAWA 1IEVA 1KL7A 2ZSHA 3G13A 3CO5A 3VO1A 4NJMB 3ZHYA 1C1YA 3WP1B 4ECEA 4EYEA 5CFMA 3WSVA 2QVXX 4DSOA 4I55A 5ULLA 1T3LA 3N3BC 1PYDA 2VUUA 3VU1A 3U7GA 2XRYA 3QM1A 1ML3A 1FP4A 4PICA 2VQDA 3QVKA 2HIMA 1Z4LA 4QGAA 3GJSA 1NR5A 3P2EA 1XXHB 2ZSFA 3RHTA 5TQVA 1VKNA 3ZC3A 4BS9A 4D41A 4YRBA 5IG2A 2LDXA 2NPFA 3PYMA 2QD3A 4QREA 3VZDA 1E32A 3PHLA 1Z47A 3PWTA 3GJ0A 2ZJ8A 2AD5A 4A2PA 2GT1A 4JP1A 4I1SA 2J5BA 4KI7A 1BMFD 3GELA 4Y9RA 5GGXA 3T4UA 4AURA 4JV5B 2WJHA 3VJMA 2J9GA 4YY3B 3N0RA 2CLLB 2X14A 5JI3E 4NC9A 1G0OA 3MB5A 3OEHD 4HS9A 1FSZA 4YPFA 3RIYA 1K2VN 3CX8A 5BPHA 2WWVD 2Z2KA 4XEUA 2XZTA 4WINA 3UK1A 1DAOA 4QX6A 5BNIA 1RZ3A 4DDKA 5JD5A 1S2GA 2AFHB 4ZAFA 1C9KA 3QU2A 4KAAA 4LZZA 2PUBA 3NWOA 2RHOA 3VC2A 3KKKA 3C41J 1OGIA 1I4LD 1GTSA 4RGVA 4LOHA 3V8BA 5INTA 1A2KC 3R7NA 4ATNA 2XZOA 2OZLA 7REQA 4A8HA 4PGHA 3KXKA 2AYZA 2Q41A 3A04A 3FCXA 1SCNE 1VBFA 2J85A 4BB0A 2RKWA 3G23A 1ORDA 1RQGA 6NULA 5IJ9B 6ABPA 3KQKA 1QE3A 3FHJA 1GU1A 3F2IA 1PI3A 1NBME 1TZKA 2FMFA 3IMGA 4PQYA 5E6SB 2Q5FA 4DPKA 5IVHA 4WQMA 2C3MA 4MB6A 3ROTA 1LTQA 4MS4B 2VRCA 4TKUA 5E6RB 3RBAA 4CLRB 2EERA 5IJWA 1RWNA 1UXIA 4IYRA 4I9GA 4AECA 1E5LA 3MVEA 1S0UA 3KB6A 4E15A 1IJBA 3EVTA 4X95A 1MRSA 2X4DA 3D9QX 4NAVA 1IEXA 4TTPA 1FK8A 4Y1FA 4KPYA 1TC2A 1ISMA 5FI0B 1VE6A 3CWCA 5E6UA 4C08A 1Q11A 4DCPA 1LZLA 1TQHA 2PO7A 3KAQA 3RG8A 4HV4A 1JIUA 3HLKA 5AK5A 3UFXA 2BF4A 1QOZA 2JGDA 2RBEA 4US1R 2HL6A 4KGDA 4UPDA 4L9AA 4CJXA 5ELXA 4BE7B 3MRXA 4WDQA 4LGMA 3Q8KA 2DFDA 4NARA 4RPCA 1CULC 1JYSA 1TF7A 1RPAA 3U48A 4CLHA 5AKZA 4UZFA 2C98A 1X2EA 1W36B 3AKZA 3OU6A 4RM3A 4J1TC 4PHTA 3O82A 3IQGX 2Q3CA 2F62A 4ZEOA 1XYVA 1G66A 2CE7A 5C32A 3ZXYA 4BRUA 1KP2A 2A9OA 4PC1A 2QA5A 5LWQA 2PWBA 4D9BA 5IXSA 5JZOA 5CM9C 3PFWO 4TRNA 1SPBS 3WIDA 1NVGA 4NBTA 1C41A 4CM4A 1E1RA 3ZY6A 2A0YA 1MBZA 2YUIA 3KZOA 1M6NA 4JGIA 1UBEA 4H9GA 1RD4A 1KFBB 4FS8A 3JW8A 3K0CA 5KTSA 3TH5A 3HU1A 5HFJA 3PLAE 2SECE 3DDCA 2C59A 3OUZA 3V4LA 2JPDA 5FL7D 5TT0A 4F2DA 3SYKA 5EIXA 4X3CA 1I0ZA 1LNSA 4A9AA 3ZG6A 3B89A 4LDQA 4OQPA 1OXUA 4CBVA 1IQPA 2TS1A 2HV8A 1KZYC 3O8OA 3TM4A 3GFOA 1N3YA 2ZVQX 3Q72A 3QF4A 4PYLA 3IE1A 1ZVMA 4MP3A 4O8CA 2A57A 2JVKA 3DOIA 4KBYA 3H0CA 1N6HA 2PANA 3L4BA 4NMHA 4PPQA 2GHIA 1K4KA 2Z1NA 1GVHA 4OFWA 4TVBA 5LLTA 3C2QA 2ZB3A 3NATA 1Y8QA 2OXRA 2O48X 1Q0UA 3PQ4A 3Q9NA 4Z0TA 1YVRA 2E7ZA 3H2IA 5DNWA 2C2MA 1HFEL 2ZIXA 4Y6LA 5KJ1A 1NVBA 4I3FA 4MW1A 2CLHB 1HE8B 5JVDA 1QVAA 3UMJA 2YBDA 2XWBF 4OUDB 5ALFA 3B3AA 2CHGA 2EF1A 4QDOA 4X6LA 3BXXA 3W05A 4FFVA 2Q62A 1D2EA 3G2PA 3WICA 3BT7A 3DG9A 3QNMA 2FTKE 1UM9A 1XYYA 4IGIA 4OYLA 4P4SA 5EJIA 1BYIA 3A2MA 4ESEA 4YI5A 5DNCA 3LFTA 4FR0A 4CR8A 2JIRA 1XT6A 3NHAA 4BNJA 3I9LA 2COEA 1LDEA 3M1LA 1V2GA 4U2DA 5EMNA 5SY4A 4A8PA 4CL3A 5K7SA 3S8EA 5KO2A 1NPDA 1F3OA 2IKSA 4C4YA 2W42A 2QNIA 2R7MA 3TL3A 4ZCPA 1HR0B 1LSSA 4HB3A 3OZUA 3M9WA 1TO2E 4HUQA 3ONFA 4IJKA 4R8KA 5CFZA 1PFYA 2EKZA 3ZBPA 3GFQA 1QU2A 3L8ZA 1GAWA 4CR7A 4IZIA 3WB2A 4CTJA 5DXJA 3OZSA 4ARVA 2VDQB 2XMGA 2OGUA 5JWRA 4ASUA 2D5BA 2UXBB 1UANA 1OYYA 1DZ3A 5CG2A 2E5WA 4R01A 1RYFA 3Q2IA 4CT4B 2IGBA 3VZPA 4P7KA 2P4EA 2PXCA 5L7WA 2CV0A 4QU9A 4B6PA 1FY2A 1JDSA 2ZUDA 2D3WA 2ZJ7A 4D1YA 5CW2A 2IXGA 3ZDFA 1U0OC 1B16A 1FXWA 2ACKA 4XX0A 1BQ3A 2IHJA 4GI2A 3PD0A 1LPNA 3UH1A 4B4OA 1P7PA 5DFAA 3L4KA 1GARA 1VSTA 3ITDA 4RM2A 3SXUB 3ZYZA 5BNZA 3ZLVA 4UHKA 3WLJA 1C0EA 3RIEA 4K9NA 2HF7A 2IXEA 5HIIA 1YCFA 4PSVA 4RQBA 1VLMA 4U2FA 3TGWA 6CHYA 1QH0A 4WY8A 3QFFA 3HO8A 2GPAA 1XPOA 2C9DA 4RHFA 1A9YA 1GNTA 5EWMA 1ODFA 3DEFA 1C3LA 1E3JA 1QR6A 4G0MA 5AT1A 3MGGA 1G6OA 5G41A 2FSGA 3LDHA 4UC0A 5BNTA 1AQNA 3OOSA 4Z4CA 3D2CA 3WWPA 4IKPA 3UA4A 4MS3B 2O8FB 4K9SA 1VJTA 1N5MA 2OB1A 4QYTA 4M89A 1V1RB 2XCTB 5BT9A 4MQFA 2EX4A 1KBZA 4KH0A 4L5AA 3UJ9A 3FOZA 1XRLA 4C4RA 2YUTA 3OCJA 4B3GA 3E7FA 5CYGA 3CEJA 3IDQA 5LMUB 5SICE 4G0WA 1O6GA 1K5HA 4GD3Q 5AK3A 1EFKA 1KI2A 1HK7A 3TE7A 2C58A 1XVLA 4BC0A 2B92A 5DCYA 3ZOZA 3GWGA 1ZK2A 2QPTA 2PUHA 3AGQA 4R2LA 2IPXA 4IIUA 4BO6A 4C6SA 4HR7A 2PV0A 3HCDA 1ZZGA 4WERA 1DT3A 4N7JA 2I2AA 4REQB 5DULA 3UOWA 5K20A 4AP9A 1T2DA 1VCHA 1F0KA 3RROA 1X19A 4PLWA 4Q12A 1XLWA 2CMFA 3M33A 3OETA 1U1GA 1X8LA 2BSQA 4BNDB 4CGYA 3MQ2A 1SVLA 2DCUA 5AOCA 3AIKA 3EWSA 1CIVA 1OROA 2WWRA 1WBDA 2MSKA 1IM5A 4M98A 4IOMA 2GAJA 5I5GA 4A1FA 4D3DA 1KH1A 2Q4RA 4G07A 4UE2A 3MNFA 2I8AA 5FBVB 1P74A 4JLJA 1TM5E 1VL0A 2I0FA 3I5AA 4O4JB 1JB1A 4UU8A 5ECDA 4CHTA 2OBXA 4R83A 2DPGA 5H70A 3IUEA 1AQIA 4IHAA 3A1EA 3GRVA 3TSZA 5I5EA 4IDDA 4YTEA 4AS3A 4M3NA 3LK7A 4UREA 4V2IA 3S4YA 1UBLS 1Q7BA 4JZYA 2O7VA 1KXZA 3IYLW 1DOAA 2IHUA 2PRJA 1YOVA 4FFPA 1PZHA 2CLOB 4L4RA 1QQAA 2XV1A 5KWIA 3Q7PA 4UBNA 5K03A 4WA7A 3KEMA 5CT5A 2C31A 3B12A 3OQ1A 1VJCA 2NW6A 2V5VA 2V9CA 4RVFA 3UQZA 5ADUS 4TQ9A 5KSWB 1P1RA 1VL2A 4S12A 3BDVA 4OQ4A 5F52A 3LYHA 3ORQA 5MN6A 1H94A 4PLGA 5I4IA 2YZ7A 4D8XA 3NC1C 3PC3A 5BSVA 1ONSA 2OBMA 2OCXA 3CN9A 1AGPA 3R24A 3I9V1 3ST7A 3USZA 3NV7A 3K6SB 4IVQA 2JFNA 4LZPA 3RNLA 4PO8A 3RSGA 4F9TA 3KZ1E 1QDLB 2YXDA 4QUGA 1NI4B 5JARA 4E5UA 1J56A 2FUG1 3RSOA 4EDHA 3AYZB 4B76A 4BBZA 3EZ7A 1Y8QB 2ABWA 5ICFA 2MYUA 1E1QD 1T5IA 2CDAA 1O2DA 3CUTA 5A3SA 4B3CA 4BX2A 1Z5GA 2ZYAA 3ETCA 4H17A 3VBEA 2BGIA 4A23A 1L5OA 2K4MA 1Z6PA 2DCMA 1PQYA 2GAAA 4KWCA 1CJKC 1YVEI 4ZAGA 5C0OE 4OLBA 3DBLA 3R0JA 3TZKA 1P81A 2FSHA 3TWOA 2W6ZA 1H2BA 3CRRA 3G0IA 1GAXA 2AG5A 1Y7PA 1OWPA 2GUGA 4E4YA 3NUZA 1GA4A 1Q2XA 1WVIA 3A6KA 2EFGA 3DFKA 3JQCA 1V7QA 4KV7A 1QK3A 4R3WA 3CF0A 4L51A 1Z4NA 3W8RA 1IUNA 1RMTA 2E87A 4XSGA 4AZ0B 3WHIA 3EGEA 2XSZA 3FDZB 1ILWA 1RU3A 3ZK7A 1KAEA 3KUKA 5K3CA 1GFWA 5CB0A 3JATA 3BQNB 4HP8A 4X63A 3THWA 4IJUA 4WNAB 5ILQA 4I3HA 3KOUA 3PICA 3S1AA 4C6TA 4HUJA 1IYZA 3RFFA 4HDOB 3B7WA 4B1FA 3F6BX 3KX2A 3KQPA 3M70A 5IYZB 3QU4A 4NQRA 5AHXA 2VR1A 4ZVTA 5B53A 4IL5A 3BRCA 3A4VA 3PDIA 4M6WA 3UG7A 4URYR 2JAWA 1CR6A 2Q0HA 3PT5A 1Y7TA 1EUDB 1G0NA 2YV2A 3Q5EA 4YH1A 2PUGA 4DDMA 4ZZIA 4IDGA 4JLUA 4L02A 1XPRA 1JB9A 3AVVA 4KITB 4C4OA 4P84A 1QFXA 4UHHA 5H80A 1O4WA 4HDRB 3I0ZA 3ZN2A 4UJ5A 2Q1XA 2WTEA 1GGKA 3E8SA 5M3BA 1XZQA 4KXFB 1T0PA 3FKSD 4NU6A 1SC4A 4MYTA 3JVDA 5A3QA 1HNZB 4WX2B 4BKPA 2JLYA 2IUSA 3K0KA 4KN9S 5EMMA 5TPWA 4EI8A 4D4KA 1DKQA 3NYIA 3WP0A 1GTG1 3ZCXA 4CN9A 1EA5A 2HCJB 2A1UA 2RHMA 4J7CA 2J45A 3VO2A 2H1VA 5JNVA 3I53A 1UH5A 2D5LA 2Q1WA 2X7XA 3C24A 2CXRA 5E38A 4P9NA 1N1EA 2YVAA 1J2UA 4X20A 2EG5A 3CKKA 2PCJA 1IIRA 2VBFA 4LZJA 2HUNA 3PGVA 2GAFA 2HJHA 4V1CA 3RR2A 3ADPA 3VQTA 1ECCA 1VE7A 4G9EA 3GR6A 1CHDA 4XKJA 3KDAA 5F1OA 2YN0A 1ENPA 2NV0A 3M4NA 3I92A 3C98A 4Y9TA 4GLLA 3QLEA 3JAWA 1E0KA 3EXEB 2W7TA 1DTWB 4N82A 5EPUA 1TM4E 3CSUA 2YV4A 3F97A 1IRIA 1NXOA 1PCXA 1UKYA 2FU5C 2PZLA 3DMTC 3W5JA 4AZWA 4REMA 2JRCA 1GUYA 2BONA 4CTMA 4A2WA 2IODA 2WJ6A 4D97A 1DO0A 3QVTA 4NG5A 2G9RA 2W0MA 2WAYA 2OGZA 5ENZA 2IDMA 4B6EA 2VAPA 4TMXA 5EIOA 4E2ZA 4CETA 1RYZA 4TWAA 3TXAA 4RTKA 3HVKA 1PGNA 1S9DA 1CDDA 3FSRA 3ITKA 3HGTA 1KMIY 3ELDA 4I5DA 4XR4A 4D25A 3SHTA 3A6EA 4FDVA 1MEOA 3WOHA 3A3KA 2E55A 3B9QA 3VAAA 3IGFA 1QP8A 4AO7A 5BQFA 1XTKA 2HT1A 4L8GA 4QUHA 4FB5A 3KQVA 3PNPA 4G26A 5IPFA 3BM5A 4FFBA 3A1FA 3BWXA 2UZ3A 3QWFA 3WQBA 1V0JA 3ACCA 2XRZA 3W6UA 1YS4A 4JR1A 1GCAA 4JT2A 3BSYA 2EW1A 4GNRA 4ARSA 1AS3A 2GCNA 4LX0A 5AK6A 3ER8A 3DV0B 4S1VA 3UUGA 2XVXA 1UJ5A 1LSUA 4CMEA 3ZY3A 1TAUA 1EFRA 3PRKE 3U7FB 2GK3A 2JBHA 4UBOA 4BN0A 4HQOA 1TZJA 1EBUA 1JGTA 1KPHA 2DKFA 3KALA 3OM9A 4U6NA 3R9KA 4EARA 2F1IA 4PZZA 3AESB 1R6VA 1KFJB 4CKYA 3AFNA 1XQYA 4LISA 4UBIA 2N46A 5BWLA 4KQ2A 4R98A 3RVBA 2P5YA 4BNZA 2M6LA 4MVJI 3BK7A 5KEIA 2O8EB 2ZDGA 3NV9A 4F4JA 2OESA 3QY9A 1YK1A 1E7QA 1L4NA 3D5QA 1R6TA 1D6MA 4FSXA 7ABPA 5HQ3A 4BV3A 1N6LA 5FUQA 1WPXA 2VJQA 1IJKA 4DUGA 1KQOA 1U9ZA 4DJFC 4DDTA 4QNNA 2WTXA 4HAXA 3BB3A 4L08A 1UOEA 3FJOA 4G0PA 2IZ7A 4PNPA 2B4TO 3TNLA 3VR0A 1BTOA 5AJXA 4Q4DA 3H2KA 4AO8A 3IMKA 3AWDA 4K26A 1RC8A 1E1CB 3EIXA 4CEIB 2G9ZA 3MERA 4WGGA 1VHQA 4K6GA 2A5JA 1QOPB 2BFOA 2EKQA 4ER5A 4L4ZA 1ANKA 4D3ZA 4Z3OA 1J9EA 1GQFA 1Y33E 2H2HA 4I6GA 2QZJA 4L4XA 2BY4A 3H9QA 3L46A 4MQLA 5BORA 3U6KA 3RRBA 4ARAA 2FPRA 4G5RA 3JARB 4OG2A 3TAUA 3VSAA 5JSQA 4H1VA 1CYDA 3IJRA 3GL9A 4IFTA 2DUWA 2DWPA 2IZ1A 5LMCA 5L3VA 4J3FA 3HKEB 4IIBA 2QRMA 3OT1B 4PAQA 5FJJA 3ZKWB 2NXWA 2A88A 5EI5A 4TS3A 3DFZA 1YUMA 3ZBTA 3ZX5A 3HBFA 2AD1A 3DF7A 2XLCA 2FMXA 4Y9UA 1TW2A 2BFEA 4RIIA 3IURA 4EB3A 4KRYA 4GPD1 3DE3X 5I4BA 2E5LB 2YTZA 3OA2A 4CKWA 1FW6A 3CX4A 3K0HA 3G8DA 2IXTA 2P9YA 2I22A 4BVBA 4ZJYA 1E9FA 3IILA 4PS1A 2VJMA 3ISJA 1ELOA 2G0TA 5F1KA 1G2PA 1R9MA 2NX2A 4LXXA 1JQJC 4YRGA 2BKXA 1CLEA 3RBXA 2IHYA 5ALLA 4ZHQB 5H4HA 1X9HA 5A4JA 3LPDA 2IELA 1W0KA 2CDBA 4WZAB 5BSGA 2PAAA 3EWAA 1HF3A 4DM3A 1VGVA 1UKCA 2FG7C 2EX1A 1D3AA 4G5GA 1XNGA 4EF5A 1EK2A 1ODTC 1EVKA 2VHXA 4PG7A 2BP7A 4R69A 1NSTA 1VSQA 3EODA 1CHNA 1FF9A 1DE0A 3EMVA 1R4NA 2FN9A 3N07A 3IBYA 4I9NA 4K9LA 4NOMA 4UATA 1VYTA 4BFSA 4CFZA 2G1PA 1RI3A 1ZWKA 2QD1A 5KINB 1X94A 2C78A 2WD8A 3KYIB 1AKQA 3A1VA 4RF4A 4YCSA 5TY0A 1YOBA 2QPLA 3LL7A 4GUAA 4OA5A 3DVAB 4XJTA 2XYPA 4OO3A 2XCLA 2CBGA 1CVRA 3SYTA 4CZ2A 3KWLA 4QBFA 3EF3A 4LDZA 1TPZA 2XVMA 4AZSA 3P4XA 5DM2A 2QTAA 2QD2A 2V0CA 1JHVA 4KSYA 5D3KA 2GEJA 3AERB 4FZRA 1PP4A 2ORIA 3QMMA 2P8JA 4RPLA 2Q2WA 2QQGA 4WZBA 4MRNA 3MG9A 3O74A 1H05A 2DBQA 3Q2OA 3T7RA 1F9EA 2WVJA 4Q02A 3DMPA 2O2HA 2C8VA 2QL9A 3PDJA 3FI9A 4JK3A 5M04A 3JAWB 4ENVA 1CNMA 3KWMA 2GD0A 3QNUA 2XQVA 2YHSA 1UDAA 5EXPA 5G02A 1P2DA 2B3TA 3HVUA 4W7IA 5EZYB 4A6PA 2ZIFA 1KYIA 2EEPA 2HA3A 5FR1A 1QIDA 2VYQA 1AS0A 1EJBA 5AHKA 4BX3A 5FLYA 1SY7A 2BV3A 2PGDA 2CY0A 2JD1A 2PSDA 1U7HA 1FFGA 1XZEA 3GPIA 4ZICA 1WB9A 4HO1X 5LBUA 4XX1A 1Y1PA 1EFPB 4URFA 3OJOA 4OYHA 5CX1B 2L19A 2BMWA 2G7MC 5EZQA 5ICGA 4BKMA 2MMCA 1JJAA 1R8QA 2BVNA 2AW3A 1EHIA 1BVYF 2QD4A 3BHNA 1GTL1 3JZFA 4ZOCA 2DFPA 4FQ5A 4GAEA 4M0PA 5TJHA 1DKNA 1RWVA 3EVEA 4TT3A 5BSTA 3DZCA 4EHDA 5CA0B 1C4WA 4CF5A 3WL5A 4B2YA 4X54A 5FBKA 3H1AA 2RHBA 3QH4A 1J42A 1M2OA 3KE8A 1PS8A 3N8IA 1A2QA 1P33A 3FFWA 3MRVA 3SK0A 4JLSA 1DJNA 2JW5A 4Y6PA 4ND5A 5CDGA 1WUTA 1IHUA 4PVDA 3SKYA 4NJEA 3RE1A 3UG6A 1C1DB 2AXQA 1UDWA 3LPMA 3RFTA 5YASA 1GG9A 1E7RA 3BTSA 4XGNA 4ZYVA 1RWKA 3KT0A 4N39A 2UVPB 3V9AA 4Y6QA 5BWMA 4UQPA 1CZKA 4ZT3A 3GNSA 3VV3A 3TECE 4ZTUB 1J22A 2IPOA 1O95A 4LC1A 3LCJA 3EF0A 3KVOA 4V39A 3FZEA 2I7CA 3TRHA 1YU6A 3DZKA 4CL0A 1RWPA 5C18A 4OQXA 4X6YA 5JPDA 1C3JA 4PSAA 4P34A 1UKZA 3E6AA 2BN4A 3W4JA 3ABRB 1SVMA 3KWJA 1NQUA 2J5XA 2Y1WA 2C3YA 3LWZA 1U04A 1RHKA 2MSEB 2XWJI 1TO1E 3BILA 2ATXA 2O0LA 4O0MA 3W78A 1E2FA 1VL1A 3LIIA 5DLDA 4QTXA 1N0UA 3GVXA 1E92A 2BUCA 3OLXA 5FV7A 1CTQA 1LW7A 1N0VC 3KCNA 3RNOA 3ANLA 3SC3A 1QO9A 5FO0A 1A4UA 1YGYA 1QG4A 5IUKC 2AF4C 5LJIA 1UAYA 4WJZA 4ZAWA 2GXSA 5FUMA 3S81A 4FD2A 4O4LF 1CKEA 1X7WA 4UPVA 1LBQA 4N9WA 4DKXA 1GPAA 1GSOA 3UN1A 2HCTA 4DQKA 4C4PA 5CT8A 2XZPA 2TYSB 3VC1A 2Y68A 4RZ3A 2Y1CA 4CIAA 4MR7A 5CJJA 3I0MA 3GW8A 3CJRA 4AROA 2BMAA 4BFZA 5JH7A 1SXQA 4OOEA 1M2VA 3QELB 4IGAA 4HRVA 3E5MA 3T95A 1CY8A 1J90A 1KJZA 2C77A 2P0EA 4TRRA 4EKYA 4LK3A 4J49A 4NFSA 3AF5A 3TM5A 3ZD6A 1WDTA 4Q19A 1EYZA 3EDYA 4MQMA 1OA1A 1IPFA 3LFHA 1ZNWA 4Z9AA 4AMGA 1P9RA 1ECLA 1U0GA 3I04M 4X97A 5E4JA 3VMMA 2OAP1 9ATCA 4D0SA 1M6EX 2R3SA 4MI1A 2PZBA 2R2AA 1TJYA 3D6JA 4JB2A 4OJNA 1UK7A 4ZVQA 1UQUA 3A3NA 3L7IA 1UFRA 5DJ5A 5IXJA 5JYDA 1NXSA 5TMDA 1A9XB 1NW5A 1P72A 1SZPA 2AR0A 4FDMA 1WCXA 1U28A 1NT4A 3MLAA 5DNEA 1UPTA 4B4WA 1E2KA 1T9GS 5BR4A 3PIIA 3TW0A 4LRQA 1M2VB 1J23A 1YQ9A 3QELA 3FB4A 4Y2YA 3SF0A 2FFAA 3KTDA 4R81A 3OMWA 1TKAA 1LPBB 5KYYB 1C81A 3U09A 5K4AA 2Z1DA 4NH0A 1ITZA 1ZL0A 3EQZA 4KPUB 3PUKA 3KAPA 3U3KA 3E23A 4X62B 3AVQA 5IAEA 3UMCA 3RYHB 6AT1A 4AG3A 1TADA 3BIFA 5JMWA 3OF5A 4FE4A 1QIGA 3A3OA 2PBZA 4YPVA 1B6TA 5ED0A 1KOLA 4D3YA 2NP6A 1JECA 1F2UA 3H84A 3GLHE 2P1ZA 2Z58A 4BLVA 3C14C 6REQB 2WWYA 3E5HA 3F9IA 1VFNA 4LSGA 1YZFA 3FUUA 2FX3A 1SHZA 2JFPA 3BEDA 1PZFA 4C7XA 1EB9A 3PUVA 2C99A 2HMTA 2Z04A 1JG3A 4RJIA 1QH1B 4KYVA 4EX7A 3CCCA 1PVOA 2QXTA 2OKCA 1QSGA 4AS2A 1DAPA 2P4HX 2MWMA 2KS6A 4GI3A 3JU3A 3ASUA 5DTQA 1A0OA 1CWUA 1EINA 1NP3A 4Z4EA 5THXA 5LIPA 2R4UA 4R2MA 2AEJA 3BWEA 3P9NA 1XRMA 1YS7A 2GK6A 3DMHA 2QU8A 4KQCA 3CYFA 4OBWA 4OHWA 4OP2A 4X6XA 3SSOA 4XFJA 4AY3A 1PEKE 2GPWA 4ZDIA 3FKJA 1NKTA 3CH6A 3FPJA 1WCWA 1UC4B 1ZOPA 2I2BA 3FSEA 2JGDB 4NZMA 3NH9A 1OV6A 1USGA 2H5LA 1G20A 3BFVA 3BTUA 2L42A 4HZGA 4I66A 2FMIA 3B5EA 3C8DA 4MUNA 4DILA 3HB9A 4AJKA 4V38A 3JQPA 3GGCA 3IHKA 4LKRA 1PUJA 4D45A 3UBTA 3A37A 1MNQA 1X80A 4KN8A 4F72A 2A9FA 5AIAA 2PGLA 4P54A 3QE2A 4TS9A 4B75A 3KSBC 1KHHA 1ESEA 1FP2A 1QWOA 2F9MA 2EW2A 2JH3A 3GGOA 3O90A 2JDIA 4Q05A 4KYTA 4RLSA 2ZRHA 2FR8A 3H5OA 3HKBA 2CLMB 3VHLB 1KORA 3DWIA 1W85B 4JKIA 2IHTA 4B7AA 2H7XA 1EXMA 2VYVA 2J6HA 3OC6A 4D9EA 2GM9A 1DP4A 3EULA 1U80A 4RYDA 5KOHA 4LOAA 3RVOA 1S6YA 3Q7TA 2JLAA 3TBFA 2OLKA 2G8NA 1Z6QA 3GH3A 3LVQE 4GH5A 5E2BA 5T3YA 4N4AA 4NICA 4PAMA 5DGIA 2XDYA 4H18A 1E63A 1U1CA 3CRW1 4PINA 1HM5A 2IYAA 3WQSB 1LNZA 3V42A 3ZDEA 2FP3A 1UT6A 2MT9A 3KG2A 5DNUA 1ZHFA 5AXCA 1UJMA 4EMTA 3O1JC 3EEBA 3F5QA 3MJSA 3OLQA 4XCVA 1BAPA 3SQMA 3PUIA 2X2EA 3MJFA 1YB7A 5GZ1A 4OVKA 4OXQA 2W6MA 1T0HB 1Q0TA 2BGKA 4MV1A 1P8AA 2EJUA 3RAPR 2BEVB 2FEOA 3L0DA 2RGGA 3SC4A 4BATA 4TTSA 4NLLA 4BECA 1G8KA 2GEVA 1C2TA 5DX8A 3RT1A 1BW9A 1II8B 3KQOA 4DV1B 1GQOA 3DTVD 1Y1TA 2HUPA 3CNLA 3L0IB 4M37A 5C4MA 1P4AA 1YZVA 2Q27A 4UBLA 2ZJ4A 3ETHA 1KYTA 3PHJA 1M10A 4HDCA 4UM7A 1GM5A 1KNXA 2I99A 4ES6A 4I55F 3GJ5A 4Y30A 2WIAA 1M75A 1QFZA 1YJQA 5JMTA 5ALPA 3K8YA 5C3UA 1GFZA 4F46A 3UB3A 3ZS8A 4KQ1A 3COVA 3U7QB 4TLLB 3OZIA 5HOQA 5ES3A 5EVCA 3U9LA 3HM2A 1Z06A 3F2VA 4Z4IA 4S3MA 3RVJA 3CLSC 5I4CA 4KSCA 4QYMA 4PAGA 5DT9A 1KI8A 3BK2A 4Q21A 3VPCA 3L1HA 3UAZA 4CG2A 1DBQA 4PZPA 1PT9A 1WOYA 1E1KA 1MB0A 1SU7A 3BULA 2XF8A 4PO1A 3UGTA 1ESNA 1PT6A 3RK1A 4TYWA 5JAIA 2E4AA 1BA2A 3W9UA 1TYAE 2GHRA 3EIOA 4TV8A 4YCCA 4ZANA 2Q6TA 4YALA 3PJGA 1B1AA 2YHAA 3ML1A 1JEQB 3P9XA 4G6ZA 1EP2B 4LIPD 1PYOA 4MUGA 4AICA 2G82A 5ES4B 3I61A 5J4HA 3CLKA 2VZ9A 4G5QA 3WL8A 3UMBA 3V8QA 5LNK1 1P4HA 1GL3A 5TEVA 2XT6A 2QUBA 5AVJA 1IXZA 1KAHA 1SCDA 3TZQA 4YT2A 4BE4A 4BMZA 4EO4A 1QUFA 1VJDA 3QTBA 4A82A 3D4PA 3AOEA 2OC4A 2AXPA 4RBNA 4NPCA 4QG7A 1X9GA 4MJ7A 4YRZA 3LX6A 4TSRA 5J5CA 3WVNA 3ZY4A 3Q8LA 4Q1FA 1VXRA 4R2WA 1O08A 1N5RA 3WMWA 1CZHA 1TLTA 3CUKA 4WOBA 2VOEA 3LWBA 3ZU3A 5FF9A 2G70A 1KY4A 2ZFUA 1N2CE 2C9OA 1VSUA 2XKAA 3LF2A 4KLNA 4OLJA 1UMCB 2LGJA 4E13A 3I1FA 1FFWA 1PS9A 1NVKA 5HGJA 4DLSA 5T4EA 2W6ID 5GJBA 2BGNA 1OBOA 1VB5A 2C5EA 4DXAA 1R8JA 2OOKA 1NF3A 4OA8A 1M73E 3N5KA 1A7AA 2R68A 3NBFA 1A3CA 2Y8EA 3IULA 4K5QA 2JHGA 3CONA 4TN1A 5KU7A 4LW8A 2AOXA 2ZJ1A 3B6KA 1ZIYA 3ORRA 4EP1A 4I14A 3FWZA 5KWJA 2QVGA 1O6ZA 2ZYHA 2OENG 4TL8A 3CW2A 4KVZA 2XY4A 2ZREA 4BEBA 2EKBA 1XEWX 4XE5A 1ZM7A 2IEYA 4CF3A 1ZBQA 5JDIA 3ETDA 1F5NA 4RA9A 4N54A 1T0JB 1JSCA 3X1XA 2ONYA 4Q18A 2F8SA 4QASA 3E58A 4NR0A 5KTKA 5L9AA 3VDRA 3QWBA 5AIBA 3VR3D 3Q8XB 4M4SA 4DHWA 4L5IA 4REQA 3T7AA 2PKRA 3JYNA 5E1OA 1ZONA 4LYJA 1FDVA 1G21A 3KR1A 3NXKA 4JLNA 5CIWA 4FP9A 4YVFA 3H2JA 1K86A 5THKA 3R9WA 3LLUA 4RTQA 1CUSA 1V11B 4ZVVA 3QBEA 4NIMA 3OLYA 4HF7A 5LL6P 4K6KA 3CUEF 2E4XA 3H5TA 3TTYA 1SAYA 2VJMB 1JBEA 4J1SA 4BNWA 1QGDA 4PYJA 3EXIB 3AR4A 2A5YB 3SZRA 4N3CA 5LP1A 3MYYA 4JB8A 1YJ8A 5IM5A 2ANBA 4GR4A 2E18A 4DR4B 4B31A 1P4JA 1CY4A 1F2TB 3RGGA 1N7HA 3PPYA 4PG4A 4EHHA 4YV2A 5KU1A 2KWIA 2PWAA 5EERA 4B83A 2Y1LA 4B4KA 1JHZA 4DIBA 3K9GA 4DMFA 4C14A 4M60A 3C7AA 3UXMA 2G4VA 4RVHA 1I51A 5GIOE 5J4YA 2O5CA 4YRPA 1LJUA 1HWYA 4WCDA 3N28A 4DA6A 2QI9F 2WWIA 3DBRB 3M6XA 4ISCA 1WTAA 3ZHSA 5ITZA 4RTSA 3NJ8A 3R4CA 2YZNA 2VP9A 4L2IA 1C4KA 3C3DA 4HQ0A 2GJSA 1T5DX 2PUFA 2YJ3A 2BFBB 2QV0A 3EOZA 2ARKA 1RQRA 1KMCA 1RLOA 1ZL2A 3PQ8A 3KVRA 4Z3KA 1SUAA 4UTVA 1K08A 4ZDKA 3NBQA 4LHZA 3QKSB 1RWXA 5FT9A 5IT5A 1TKRA 2IEAA 5I3ZA 4HI0E 2KE5A 5FLKA 1VSBA 3NOXA 5TF0A 1VE1A 1Y3AA 1EZ4A 1K9SA 3LDFA 2I91A 4XDYA 3M4YA 3LQ1A 4AT1A 4JLAA 4G0ZA 4DBVO 1EHYA 2QRVA 1OX4B 1RLMA 1JFFA 1JR3E 4HPWA 4PHHA 4RZQA 3ED1A 3JWPA 1Q0RA 1YHZA 3R3XA 4M21A 1WB4A 2FQYA 1SXJC 4KLCA 5BO5A 2X5OA 1KO4A 2ZZNA 2A9VA 4R84A 1GUBA 1UZLA 3WWEA 1I01A 4ZZ3A 3L6CA 4J7UA 2R47A 2Q5QA 4LZLA 4U0JA 4ZU6X 4DMHA 3D6AA 3CE6A 4RH0A 1NBHA 3CLVA 1PLJA 3O3OB 1HV8A 4DVGA 5JD4A 1R9NA 3ZNNA 1V5WA 1Z62A 1YS2X 1TA0A 4WXYB 3RIXA 1YJXA 1XKQA 2EZ9A 4HJXA 5IW8A 3D6UA 5E4TA 1RM4A 4OFXA 2JCVA 3WGJA 3EXHC 2JLUA 2I4NA 3EZGA 3IAAA 4MR8A 4X3PA 4DXHA 2NXNA 3EVAA 5EXSA 3ETGA 4ND7A 2EJVA 2BLLA 2G76A 4RF5A 1FFHA 4ETMA 3E3LA 4BVJA 2YZMA 5ANRB 1KU6A 4ZMBA 1R0BA 1W2GA 3OO0A 3L43A 4N3AA 2IYNA 1VDZA 2FG5A 5LQMA 4ONEA 3NHWA 4H08A 2CHVA 1LF5A 4FDUA 3BH6A 4RDIA 5JVDB 4EPWA 3D1VA 1L0BA 4BJHB 1QK4A 4KX3A 4Y2PA 1JDZA 3FLBA 3MUNA 4EUNA 3RHZA 4UZEA 3UC5A 5BR1A 3PIRA 1I3OA 2YWCA 3M34A 2A7QA 1CZUA 2EJTA 2JK1A 2NG1A 3Q11A 5E9AA 3RJ5A 4JYZA 2AG6A 3GUVA 3N6RA 1Z2AA 4EI2A 1MX1A 3RSSA 1P5HA 1TT5B 4YCDA 4ZAXA 3FNQA 1O94A 3FPKA 3KQLA 3DMYA 2FG6C 3DBRA 4EUKA 2NU8B 4RY9A 5DLEA 1W2WB 3AIMA 4M9RA 1Z56C 5A03A 3REFA 3ICQB 5EGSA 3PQEA 5BT8A 4LGCA 2LDBA 2P9BA 5LZ5A 4I3GA 1XTJA 4HEHA 1TCCA 4O5OA 4PCVA 3W2IA 4G0QA 4MYSA 4EI9A 1FYVA 1Y7HA 2H2DA 3I01A 4HADA 4QDZA 5DNYB 1QVZA 4JDPA 5KOYA 5LOVA 2C54A 1KDRA 3FLAA 3M1AA 3PEEA 3G9UA 3TR0A 1N9GA 1WHTA 4HCJA 4CEJA 2O8BA 4P3XA 2MINB 3OBIA 4FI3C 4QFMA 3O3CA 5EHGA 4MAAA 4BNLA 1JV2B 1ETHA 3KEQA 3KELA 2CNWD 2WHQA 5GMOA 5J40A 1KEVA 3BA6A 2CNNA 3JZIA 5TQ2B 3IR7A 1CC1S 4RMIA 3IUYA 4R1SA 3RB8A 1SH7A 1EHCA 1U7WA 1UBSB 2JK0A 3EGDA 1X70A 2PZGA 5HF6A 1I80A 1SXPA 2H31A 3QOXA 5ALDA 4EG6A 3ND9A 1OAKA 5DDIP 1YF3A 1XU4A 1D6JA 3EXG2 5BQ3A 1LX6A 3WZLA 3QSGA 4LOJA 1UC8A 4RHYA 5DGDA 2JFOA 2R7KA 3B1VA 1H9BA 2ZBEA 3EUAA 5HKBA 2Z2JA 2BGGA 1K88A 5EHXA 2GN1A 5LZ7A 2P0AA 1SVUA 3OFSA 2BEUA 4K8OA 5F3DA 3DULA 3OZVA 3EW7A 3H2SA 3KT8A 3Q7RA 3R44A 3SE0A 2XMSA 3WK8A 3WMEA 3THXB 3AVYA 2JBAA 2VJPA 2YW2A 4HXFB 3WKCA 1R0ZA 4WE3A 3QPAA 2JLWA 2TMKA 4R2KA 5IJ0B 3CLUD 2WUWE 2I6FA 5CTJA 4UAUA 3WSTA 2J33A 3P1JA 3PXDA 3S29A 1YDWA 5B1EA 1PUXA 2CN1A 3GJYA 2WKPA 4Q93A 4JVOA 4EHJA 4AD8A 1OLUB 1LPMA 4O1MA 5BOVA 3ITNA 1LNQA 3D2BA 5IZCA 1QP7A 2IKQA 3JATB 4LXTA 1KE2A 2OHJA 3B1YA 3F7TA 3GAZA 4D0LB 1CY6A 2CHUA 2IPAB 3DZBA 1Z25A 4G0NA 1VJ0A 1Z34A 2P77A 3TIVA 1BXZA 4OHCA 3ESZA 1JZSA 5BP7A 3T3OA 4MIKA 1JA1A 2AFHE 2I2XB 3QGMA 4XDGA 3LKBA 2ASVA 5DV9A 5CVDA 3Q9SA 5DX1A 3ZU6A 1GUZA 3TQRA 3LX8A 4HQFA 3QX7A 4BTEA 3QOFA 3WNBA 4QO7A 2E0IA 4E31A 2LE0A 3H05A 3WTCA 1W1WA 3VJLA 2FOIA 3UGKA 1KYVA 3W1WA 1ODKA 3AI2A 2A67A 3WMXA 4BWYA 2H8GA 3H6GA 1UDRA 1MB3A 1GQ2A 3HB0A 2C4NA 3F6SA 4ZT2A 3V4SA 1JSZA 3G9XA 4AUMA 1T2VA 4UKDA 1DJPA 1BMDA 1Y5NA 2PSSA 3N87A 4MYDA 4YQZA 4EKIA 2WFLA 4OMFG 4C2AA 1KEEB 4EIWA 1K63A 1YWGO 1M1NA 3CW9A 3WO1A 4P08A 3N05A 2OVBA 3IPLA 2WINI 3I2HA 5HQJA 1KK1A 2PL3A 2HA5A 2WOOA 4NH4A 3V6MA 2Y2VA 4MK4A 4OXRA 3AFOA 3G1TA 1PG0A 2CL7X 4ND8A 2QAGA 3E1SA 4LJYA 3T9FA 2IOQA 1W44A 4CKWB 3CLSD 3G8AA 3NYWA 4D43A 1F8YA 1VGRA 1XCMA 3O4RA 1Z63A 1X86B 3WJ7A 2ID9A 2JC3A 5J9FA 3Q3JB 4DNOA 4DV7B 3CVOA 1W52X 1ZKMA 5GINE 3H5AA 1A97A 3EVDA 5BY2A 2V9ZA 1YZGA 5JTUA 1GPJA 1KEZA 1KOJA 2X6RA 4JIMA 1ECGA 4WH0A 4ENUA 3S1LA 1K89A 3G6KA 3ID6C 3LI2A 1V6SA 3HWRA 4LDJA 4P83A 4ZOLB 1DIRA 1IWPB 1L5HB 2GFQA 4TQUS 4EYGA 4ILEA 3TGPA 5JNLA 4HH4A 4EJSA 3GUYA 1SWWA 5CTAA 3FGNA 3NIFB 1YRWA 2DQYA 3DNPA 2JD0A 2SKCA 1MO5A 2FPPB 3JYHA 4HWTA 5IT9A 2PEYA 3TOSA 3PC2A 4Y0NA 5FV4A 3GJQA 3RS5A 1T8TA 2OCLA 1YA8A 3EGVA 2AYYA 2H2IA 4PPGA 4C29A 5KNDH 1YR3A 1IOLA 2O4UX 3JRWA 1K97A 3CRMA 3GCXA 4MQEA 3H6HA 5H9VA 2ERYA 2IU0A 2C5HA 1ZJYA 5AHWA 1VLQA 1O0CA 2XNDD 5DASA 3P9RA 3C6YA 3QVMA 4KQXA 3D3QA 1HDZA 1TPYA 4R0VA 3ZCPA 3QWIA 4AVYA 2HU5A 4FFLA 3I5YA 3GFFA 3TOXA 1KE1A 3FWHA 4ZJZA 3EMKA 3OM1A 4QATA 4JFAA 3CUYA 4P3PA 4RNCA 4BZXA 1ZFNA 1OI3A 3NT5A 5HM8A 1Z8DA 3V1KA 4W5JA 1A8IA 1VLLA 3TJMA 1F0PA 4E4TA 4WKNA 5FYQA 3LUBA 2BDTA 4CIXA 1KI6B 1EFHA 2WRZA 4TWZA 4P5PA 4JT4A 5EIAA 1EX6A 3R40A 1XA0A 2DJ5A 4H3KB 2CLDX 4MQEB 3WKBA 4XGQA 5F2OA 3V5NA 5CB4B 3NBYC 1NE7A 5AKJA 5C35A 2FPUA 2J0VA 5BYBA 2X1LA 2P27A 2RAFA 3SICE 3X1JA 4Z7JA 5ICCA 4F6CA 4FZ5A 1OKKD 2VJNA 4UCQA 1OTXA 1UBOS 2YXPX 1HDRA 1JLRA 1BGXT 1Z4OA 1YZLA 4WGFA 5HF5A 4C5BA 5LD2C 2DLCX 1E2IA 3HB4X 1KJWA 3EZ6A 3CH7A 3KZKA 3OIFA 1YR6A 4IJQA 4NOKA 3C5VA 4DLNA 4E1AA 5JASA 5HG0A 4TMYA 3Q98A 1B3BA 3BHJA 4MQUA 1M7BA 2CL5A 4WEQA 5CIQA 1JHMA 1NSFA 1U7TA 2YNMD 2YWRA 2QTVB 4RY0A 2MSDB 3O31A 4D79A 4MS3A 3GZ4A 5LDDC 3L7JA 3U44B 5LQJA 2FPGB 1E6WA 3RS0A 1DCKA 1E2DA 1M1YE 1HT0A 4ZVRA 3LZDA 2GQ0A 2YVLA 4ZVPA 4QOEA 1Z6GA 4LJRA 2VSXA 3E1GA 4EFMA 2QGNA 1V7CA 3FCAA 4QTTB 1U2GA 2V4MA 1WXIA 3RRXA 1JS1X 5EJGA 3H1TA 2XXAB 2P9EA 3QFHA 1YDHA 3HLTA 3TAHA 4TLEA 1WMDA 3O8NA 4C30A 1JIQA 1RBYA 2VP2A 2BGWA 1T3SA 2J9RA 4WBNB 3EVCA 3OCXA 3S3TA 1A96A 3P2MA 4OM8A 4LYDA 4N47A 3UZUA 5B30A 1YL7A 4BV2A 3AY6A 2QV7A 2PX5A 2ZTHA 4J3NA 5EL0A 3RBVA 3EAQA 2QIPA 1XNQB 9MHTA 3RF7A 3U40A 2IITA 4I1PA 5AW6A 4EG3A 2Y67A 4H0CA 1AZSC 3ZGLA 2AMYA 1C3XA 2X5JO 1HLFA 2IYFA 3W2GA 1U6KA 3QLUA 3AINA 2C0QA 1WU7A 5A7FA 3LSYA 1Z3IX 3QFCA 1RC1A 4IEFB 4Y2GA 2QVBA 5LZ9A 5LQSA 1PYGA 4R2XA 2FWJA 1ZIOA 3SHWA 1MJHA 1ZLXA 4WLOA 5F5XA 4YAGA 2IH5A 3QXSA 5DTIA 1XKTA 4KUEA 3IXMA 3AF0A 5FPYA 4CF6A 2OMKA 1I8TA 2BFMA 1O5TA 4B35A 1QOQB 1U7UA 4EK9A 2VN8A 3TLBA 4UDOA 2QEQA 3MPOA 5HSGA 1MFPA 3LD9A 2H1HA 5GADl 1ZCJA 3JQRA 2HPZA 3FRHA 1DJQA 2Y6VA 3DMFA 3WXBA 5IS2A 2W00A 2WYUA 1N8TA 2PMBA 3LCRA 1JHAA 1IBSA 4XQGA 4EHIA 1J6UA 1VPEA 1CY7A 1UEXC 2BZSA 4H1UA 1NMQA 4KNYA 5KNCA 3E8MA 4IAOA 5ESDA 5DXFA 1OLOA 5FLEX 3UCXA 3B9PA 2GRAA 1IHPA 4FILA 3JYQA 3BD8A 3SFTA 4GOXA 3B7GA 4ANFA 1ZJWA 3O4JA 1JDPA 5ESWA 4D9NA 2XIJA 4JL5A 2YJZA 4M86A 1YNOA 2HRCA 3IUNA 3PNMA 1MRZA 4L74A 4JUBA 3HA2A 3GJZA 4L27A 5IF3A 1DQZA 3B70A 3G3EA 3I5UA 4WV3A 1E1LA 4G8BA 2IYUA 1PZNA 1S8AA 4KR2A 1EVEA 2J4FA 3G2JA 3I9KA 1HT3A 3NCTA 1Y4ZA 2D7CA 3TTWA 3WLLA 5REQA 4ID9A 4PIMA 3CVXA 3T99A 3OPXA 3F5FA 1A8QA 1RYYA 3KLBA 4NL4H 4Z0HO 5HFNA 4YV0A 1Q15A 4WOCA 3GGSA 3UJPA 2F43B 2IUTA 3KPYA 4GPIB 4QJ5A 4QPDA 4MRAA 4TXMA 5PNTA 4CF4A 5BOSA 4D8VA 1IUKA 4M6WB 3CH5A 1V5EA 3N86A 3HDQA 2WNSA 4I5GA 4X5OA 2H1RA 4YEDA 2POQX 4XUCA 3DKIA 3FTQA 3IP5A 2YY7A 3BAFA 3AL0C 1RYNA 4A73A 2G04A 3G68A 2PYIA 4Q5IA 3AV3A 3RRFA 1Q0HA 2EWWA 3TNFA 1LS6A 3X43A 1N33B 1WD5A 3L0CA 4OYYA 1T35A 4F91B 1AH2A 4V2UA 2R6DA 1Y3DE 1IY9A 2HU2A 1E1CA 3RUEA 3U7JA 4CEIA 3IOEA 2Q3FA 1CR0A 5J1TB 3RDPA 3UQYS 4D26A 3ZHTA 5IKPA 1KI1A 2OZVA 3CO0S 3LGXA 4AUNA 1NLMA 3KKOA 3X0DA 4OJKA 3ZDQA 4EBFA 4B3DA 1ZIDA 2RK6A 4OHFA 1DMRA 1C3OB 3HU3A 2AZTA 5CLHA 1FS6A 2VQFB 3AV0B 3LAWA 1AKYA 3HVJA 3PNQA 3KBBA<