2RI7A

Crystal structure of phd finger-linker-bromodomain y17e mutant from human bptf in the h3(1-9)k4me2 bound state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
168
structure length
168
Chain Sequence
TKLYCICKTPEDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome-remodeling factor subunit BPTF
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
total genus 58
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2ri7A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ri7A01
5COIA 5DY7A 1JSPB 4S3OB 2M1RA 3RTRB 3UVWA 3RPGB 2G6QA 2WP1A 3ZNIA 4NXJA 5H85A 5ETBA 5EK9A 5AD3A 2RSDA 5E9LA 5AD2A 4CUUA 2YYRA 4QSWA 4PPEA 5D1MB 2L85A 2AN6A 2YUCA 4IR3A 2VJEA 3HCTA 2FUIA 5F25A 4A9KA 5L96A 4A9FA 2K4DA 4UIZA 4QY4A 5CZGA 4N4GA 5DINA 5EA1A 5FEYA 4NUEA 2R10A 2YQDA 3N9NA 5B77A 4A9NA 5HJCA 4C9ZA 5G05B 4LJNA 4HBXA 3RPGC 4TT4A 4KCXA 2EODA 1WGMA 3AADA 5H1TA 1X4UA 2LGKA 4QSTA 4LZ2A 4NRBA 1N87A 3M62A 5AMFA 5FB0A 5IGNA 5IGLA 2VJFB 5ENHA 5CFWA 2LRIC 3C6WA 5FG6A 2L75A 2CKLB 4LC2A 5CRZA 2YQLA 5DKAA 5EPSA 1MM3A 5F3AA 4WZ2A 5F2PA 3O35A 2ECWA 4Z6IA 4QSQA 3ZVYA 3MULA 1Z2QA 1JM7B 2DATA 4LRGA 2ECTA 3G0JA 4IOOA 4A49A 5I29A 4A0CD 5ENJA 2VNFA 2LGGA 2L80A 5KH9A 4QR3A 1JM4B 3JVLA 4O7EA 4V3LC 5D3TA 5D26A 5E9IA 2QICA 3JVJA 5FFYA 5I80A 5DW2A 5FH8A 5BT3A 4QZSA 4MR3A 5CUDA 4CCGX 3T6RA 4O72A 2NAAA 5D3JA 3IHPA 2YREA 4V3KC 4YC9A 2VP7A 2RNWA 5FBXA 2M85A 3LXJA 4TTEA 4YBTA 2E6SA 2CT2A 5HQ7A 2YSMA 2MIQA 2ECIA 3IU6A 2VPBA 4UYFA 1N72A 5D25A 4QSSA 1WEOA 3U5KA 1LDJB 2E3KA 4HXRA 2Y1MA 4YBSA 5CQTA 1IYMA 5FE4A 3GV4A 3U5JA 4YYNA 2C2VS 5CQ7A 3PURA 5FFVA 3LQJA 3M99A 1WUMA 5TABA 3NXBA 5DYAA 5E9VA 4O70A 4WHWA 4XYAA 2YW8A 1G25A 5LKTA 2VPDA 3RCWA 2EA6A 4GPJA 4TZ8A 4PTBA 3TLPA 3S92A 4YY6A 1WEMA 5L8UA 4NRAA 5LUUA 4CFLA 5IGKA 2NXBA 2LQ6A 5FH7A 1X4IA 3I3JA 3UV5A 4FK5A 4N3WA 1WEQA 2JRJA 5FH6A 2L5UA 4C66A 2M6MA 4HXOA 4ALGA 4PCIA 4A9HA 3O70A 3VK6A 2I8NA 3S91A 3I2DA 5HCLA 1LDKC 3SVHA 4Q6FA 4ZDTA 2YQMA 3MB4A 1WEVA 5CUBA 5C4QA 4QSVA 5IG6A 5FE2A 3HMFA 4QEVA 2KWOA 2ZETC 4AP4A 1F68A 4YAXA 3SVGA 2Y1NA 4QR4A 5FE1A 4L7XA 3U5NA 4PY6A 5FE8A 3LJWA 1F62A 5D0CA 4Z1QA 1WUGA 5A5PA 3L11A 5FE6A 2LSPB 4QUUA 3ONIA 2R0YA 5J3XA 3O7AA 4UYHA 5FG5A 5CQAA 3UVDA 4BW1A 4YBMA 5CQ8A 5I7XA 5C8GA 2H0DB 3SOUA 4TS8A 4Z93A 5DYXA 2RNYA 4YY4A 1WILA 3FKMX 5A85A 2G4AA 5F1HA 2G45A 3L1XA 1WEUA 5DKCA 4QYDA 5B8DA 5KTUA 5A83A 3N9PA 5AITA 3LQHA 1EQFA 4O7AA 4A9MA 3M63A 2R0VA 5A5RA 2LGLA 2MNYA 4HXSA 4IR4A 4N4IA 3UVXA 3LRQA 4O75A 4YK0A 5LVQA 4AYCB 2FUUA 4O7BA 2YSJA 4UI9B 2DVVA 4I7BA 5D1LB 2L5EA 5CRMA 1X0JA 5II2A 4XUBA 3DAIA 5JWMA 4C67A 4J0RA 5A5QA 5DW1A 2D9EA 4NR7A 4ZUXU 2L84A 4CLBA 2VPGA 1WEWA 2WP2A 4QSUA 4YYMA 4S3OC 5EV9A 2DVRA 5DFCA 5L8TA 5IBNA 4MEOA 4YH3A 4CUTA 5IGMA 1FP0A 2DVQA 2QIZA 4IR5A 2UZGA 1WEEA 3ZVZB 5ENEA 5DYCA 5DFBA 5ENIA 5D24A 4L58A 4UIXA 3ZTGA 2YURA 3O37A 4NR4A 5CQ3A 2PNXA 1DVPA 4BW4A 4QC3A 5CP5A 5CQ4A 5KH3A 5CTLA 4R8PK 4QR5A 4HXMA 5TDRA 5I7YA 5DLXA 3JVKA 1XWHA 5D7XA 5C87A 2MT5A 4XY8A 1WFKA 4I7CA 4BJXA 4NYWA 5CUAA 3LQIA 4O7CA 4IOQA 4LYWA 4NUDA 4A9LA 5BT4A 5J0DA 2KWKA 4UP0A 4PCEA 5FB1A 2N9GA 2LGVA 5I3LA 2JMIA 4UYGA 2K16A 2LXPC 4BW2A 3T7LA 4AUQB 1WESA 4OGIA 5TB6A 5F5ZA 2CSZA 2JMJA 5E74A 3HTKC 5CQ6A 5E9KA 5A5NA 2ECNA 1E4UA 2Y43A 5LCWB 5B76A 4O64A 4YH4A 1E6IA 4O71A 5HFQA 5TDWA 4LK9A 2RI7A 4BW3A 4NR9A 2RNXA 4QB3A 3O34A 3QZTA 5DX4A 5EM3A 2YT5A 4YABA 4BHWA 5ENBA 3ASLA 4QF3A 4UYFB 4YADA 2DVSA 5D3SA 2KU3A 2YU4A 4CA1A 4LZSA 3P1FA 1VD4A 2RO1A 5KTWA 1JM7A 4OGJA 3KQIA 2KGGA 2MA6A 4TKPB 5FE5A 2YYNA 4HXKA 2JMDA 4CL9A 4CUQA 2ECGA 4MR5A 4YYIA 5DKDA 3P1DA 4TZ2A 4AVXA 5EWVA 2RFJA 5HFRA 4HBYA 4XY9A 5F61A 4R2YA 3N9MA 4AKNA 2YEKA 1ZBDB 4N4FA 4NS5A 4UIWA 1VYXA 3U5OA 2K17A 2VPEA 4A9IA 2KREA 4N4HA 3O33A 5FE3A 5LJ2A 2E7OA 2HDPA 2MJVB 4TU6A 2G43A 4QF2A 3AQAA 4MR4A 2QJ0A 4O77A 5HQ6A 5LVRA 3SOXA 5II1A 4B7YC 3P1EA 1ZS5A 5C89A 2LV9A 5KTXA 4NUCA 5D3LA 1WIMA 5I83A 3N9LA 2MD8C 2PUYA 5EWCA 5JG6A 3KNVA 1Z6UA 4TYLA 3UVYA 4MEQA 1X4JA 3HMHA 2OUOA 1T1HA 5KH7A 3QZSA 3KV6A 4LKAA 4QSXA 2H60A 5H9MA 5EI4A 4NR8A 4TU4A 4B86C 3UW9A 3P5OA 3JVMA 5HM0A 5DKHA 4Z6HA 4QEUA 4HBWA 4YATA 2IDAA 4Y03A 4A9JA 5D1KB 3DWYA 4YYKA 3UV2A 4YYJA 4Q0NA 5EP7A 5E3GA 5DLZA 5HENA 5L99A 2XEUA 4WZ3B 4TT2A 2GRCA 5E73A 5EISA 4HXNA 4ALHA 4GNGA 3O36A 3ZPVE 2XB1A 5CU8A 1JOCA 5EWHA 4X2IA 5HRWA 2VJEB 4R7EA 5CQ5A 4F3IA 5FE7A 5ETDA 5CUEA 5K29A 4Q0OA 4NYXA 4NRCA 3V43A 4UITA 2YHNA 2DKWA 4QSRA 3P1CA 3U5MA 5HRVA 2ECJA 3DQVR 4UP5A 4XI1A 4RVRA 3SVFA 5F36A 4IORA 3UV4A 4UYDA 4WZ0A 4YYGA 2H0DA 4MEPA 2MNZA 3K2JA 4KV4A 1CHCA 1Z60A 3Q2FA 2K1JA 4QUTA 4ZW1A 4YYDA 5BT5A 5I86A 4E96A 5EU1A 5C7NA 5EPRA 2M3HA 3GG3A 3ZYQA 5ACYA 4FIPA 2KYUA 4FJCA 4MSXA 2R0SA 5G4SA 3FL2A 3U5PA 2KGIA 4AYCA 5L98A 2KIZA 4PS5A 4ZQLA 4UYEA 4MVTA 5D3PA 2MD7B 5LKZA 5D3RA 4NQNA 4O78A 5H1UA 5A81A 4X3GA 2F6NA 1WE9A 2KTBB 4QYLA 3MXFA 5DBMA 4GNDA 2OO1A 2OXQC 4ZC9A 4FO9A 3HCSA 5L97A 3NG2A 4A4CA 3Q2EA 4NR5A 4MR6A 4P5OB 5CPEA 5LJ0A 4O76A 2MUMA 3HMEA 5DFDA 4A4BA 3ZPV1 5HELA 2OSSA 4LADB 5LKUA 3IU5A 1HYJA 2RS9B 5HRXA 4NYVA 4KV1A 4QNSA 2VJFA 3N9QA 5ENFA 4LDFA 3DPLR 5EWWA 5I88A 5CGPA 4UIUA 4TQNA 2CKLA 3PHDA 4I7DA 5AIUA 2L0BA 5FE0A 3MHSA 2MA5A 4NN2A 4F52B 5F62A 2F42A 5B79A 2YELA 5KO4A 2E6RA 4J0SA 4LYSA 5CY9A 5E9YA 2E7NA 1WEPA 5FDZA 5G04B 5HLSA 5E9MA 4A9OA 5A7CA 2LDRA 2YHOA 4UIYA 5F60A 4A9EA 2YEMA 4OUFA 5AMEA 2L43A 5D3NA 5LKXA 5G0FA 5EWDA 1U6GB 4QSPA 4W4UA 3EB5A 4HXPA 4FLPA 5EICA 2KE1A 2LXHC 4CUSA 5HQ5A 4J3IA 5E7DA 2KFTA 4O74A 4HBVA 2DX8A 3MQMA 4WHUA 5A5OA 4QEWA 2YW5A 4CURA 3SHBA 5C13A 4LZRA 4NQMA 4QBMA 5EVAA 2KR4A 5EGUA 4GB0A 2F6JA 4IR6A 1MM2A 4GNFA 5F1LA 4MENA 5E0RA 5E3DA 2BAYA 2LN0A 5F63A 4NR6A 1V87A 5EPBA 3U5LA 4IC3A 3MUKA 4LYIA 3ZYUA 4J1PA 4XUAA 2DWWA 3GL6A 4HXLA 5TBNA 2I50A 5B78A 5G4RA 5EYAF 5ENGA 2ECVA 5C11A 4CUPA 4Z1SA 2KWJA 3L1ZB 1VFYA 5CUCA 5TRBA 4BBQA 4O7FA 5FG4A 4CFKA 5IIDA 4LR6A 3PUQA 5FERA 5FE9A 2HYED 2KWNA 5DYUA 5CS8A 5H1VA 4WA6A 4IC2A 3MB3A 4DONA 4GNEA 5KU3A 4YYHA 5I89A 4UIVA 4QC1A 2YDWA 3QZVA 3G0LA 5I1QA 5KHMA 1K2FA 3HCUA 3N9OA 5CUGA 5TCMA 5C85A 5I40A 2I7KA 4WIVA 1FBVA 5D3HA 3MHHA 3EB6A 2D82A 5JI8A 2C2LA 3C5KA 5EQ1A 5FFWA 2CSYA 2EGPA 5B75A 3KV5A 5A82A 1WENA 5ENCA 3SOWA 4PKLA 5LJ1A 1RMDA 1BORA 5HEMA 5A5SA 2D8SA 1HYIA 3D7CA 4TT6A 2FSAA 4LLBA
chains in the Genus database with same CATH superfamily
5COIA 5DY7A 1JSPB 4S3OB 3FAOA 2M1RA 3RTRB 3UVWA 3RPGB 3T9KA 2G6QA 2WP1A 3VKGA 4NXJA 5H85A 3ZNIA 5ETBA 5EK9A 5AD3A 2RSDA 5E9LA 5AD2A 4CUUA 2YYRA 4QSWA 4PPEA 3E2DA 5D1MB 2L85A 2AN6A 2YUCA 4IR3A 2VJEA 3HCTA 2CRWA 2FUIA 5F25A 4A9KA 5L96A 4A9FA 2K4DA 4UIZA 4QY4A 5CZGA 4N4GA 5DINA 5EA1A 5FEYA 4NUEA 2R10A 2YQDA 3N9NA 5B77A 4A9NA 5HJCA 4C9ZA 2EJNA 5G05B 3FM8C 4LJNA 2CRRA 4HBXA 3RPGC 4TT4A 4KCXA 2EODA 3MDBC 1WGMA 3AADA 5H1TA 1X4UA 2LGKA 4QSTA 4LZ2A 4NRBA 1N87A 3M62A 5AMFA 5FB0A 5IGNA 5IGLA 2VJFB 5ENHA 3D1DA 5CFWA 2LRIC 2P57A 3C6WA 5FG6A 2L75A 2CKLB 4LC2A 5CRZA 2YQLA 5DKAA 5EPSA 1MM3A 5F3AA 4WZ2A 5F2PA 3O35A 5K3QA 4O62A 2ECWA 4Z6IA 4QSQA 3ZVYA 3MULA 1Z2QA 1JM7B 2DATA 4LRGA 2ECTA 3G0JA 4IOOA 4A49A 5I29A 4A0CD 5ENJA 2VNFA 2LGGA 2L80A 5KH9A 4QR3A 1JM4B 3JVLA 4O7EA 4V3LC 5D3TA 5D26A 5E9IA 2QICA 3JVJA 5FFYA 5I80A 5DW2A 5FH8A 5BT3A 4QZSA 4MR3A 5SVIA 5CUDA 4CCGX 3ERRA 3T6RA 4O72A 2NAAA 5D3JA 3IHPA 2YREA 4V3KC 4YC9A 2VP7A 2RNWA 5FBXA 2M85A 3LXJA 4TTEA 4YBTA 2E6SA 2CT2A 5HQ7A 2YSMA 2MIQA 2ECIA 3IU6A 2FD4A 4UYFA 2VPBA 1N72A 5D25A 4QSSA 1WEOA 3U5KA 1LDJB 2E3KA 4HXRA 2Y1MA 4YBSA 5CQTA 2EGMA 1IYMA 5FE4A 3GV4A 3U5JA 4YYNA 2C2VS 5CQ7A 2MKEA 3PURA 5FFVA 3LQJA 3M99A 1WUMA 5TABA 3NXBA 5DYAA 5E9VA 4O70A 4WHWA 4XYAA 2YW8A 1G25A 2CONA 5LKTA 2VPDA 3RCWA 2EA6A 4GPJA 4TZ8A 4PTBA 3TLPA 3S92A 4YY6A 1WEMA 5L8UA 4NRAA 5LUUA 4CFLA 5IGKA 2NXBA 2LQ6A 3FEHA 5FH7A 3Q1DA 1X4IA 3I3JA 3UV5A 4FK5A 4N3WA 1WEQA 2JRJA 5FH6A 2L5UA 4C66A 2M6MA 4HXOA 3LJUX 4ALGA 4PCIA 4A9HA 3O70A 3VK6A 2I8NA 3S91A 3I2DA 4OGCA 5HCLA 1LDKC 3SVHA 4Q6FA 4ZDTA 2YQMA 3MB4A 1WEVA 5CUBA 3JUEA 5C4QA 4QSVA 3FJUB 5IG6A 5FE2A 3HMFA 4QEVA 2KWOA 2ZETC 4AP4A 1F68A 4YAXA 3SVGA 2Y1NA 4QR4A 5FE1A 4L7XA 3U5NA 4PY6A 5FE8A 3LJWA 1F62A 5D0CA 4Z1QA 1WUGA 5A5PA 3L11A 5FE6A 2LSPB 4QUUA 3ONIA 2R0YA 4OGEA 5J3XA 3O7AA 4UYHA 5FG5A 5CQAA 3UVDA 4BW1A 4YBMA 5CQ8A 5I7XA 5C8GA 2H0DB 3SOUA 4TS8A 4Z93A 5DYXA 2RNYA 4YY4A 1WILA 3FKMX 5A85A 2G4AA 5F1HA 2G45A 3L1XA 1WEUA 5DKCA 4QYDA 5B8DA 5KTUA 5A83A 3N9PA 5AITA 3LQHA 1EQFA 4O7AA 4A9MA 3M63A 2R0VA 5A5RA 2LAUA 2LGLA 2MNYA 4HXSA 4IR4A 4N4IA 3UVXA 4AKGA 3LRQA 4O75A 4YK0A 5LVQA 4AYCB 2FUUA 4O7BA 2YSJA 4UI9B 2DVVA 4I7BA 2DSMA 2L5EA 5CRMA 5D1LB 1X0JA 5II2A 4XUBA 3DAIA 5JWMA 4C67A 4J0RA 5A5QA 5DW1A 2D9EA 4NR7A 4ZUXU 2L84A 4CLBA 2VPGA 1WEWA 2WP2A 4QSUA 4GNGA 5SVYA 4YYMA 4S3OC 5EV9A 2DVRA 5DFCA 5L8TA 5IBNA 4MEOA 4YH3A 4CUTA 5IGMA 1FP0A 2DVQA 2QIZA 4IR5A 2UZGA 1WEEA 3ZVZB 5ENEA 5DYCA 5DFBA 5ENIA 5D24A 4L58A 3LVRE 4UIXA 3ZTGA 2YURA 3O37A 1ZKRA 3KDEC 4NR4A 5CQ3A 2PNXA 1DVPA 4BW4A 4QC3A 5CP5A 5CQ4A 5KH3A 5CTLA 4R8PK 4QR5A 4HXMA 5TDRA 5I7YA 5DLXA 3JVKA 1XWHA 5D7XA 5C87A 2MT5A 4XY8A 1WFKA 4I7CA 4BJXA 4AKHA 4NYWA 5CUAA 3LQIA 4O7CA 4IOQA 4LYWA 4NUDA 4A9LA 5BT4A 5J0DA 2KWKA 2RR4A 4PCEA 4UP0A 5FB1A 2N9GA 2LGVA 5I3LA 2JMIA 4UYGA 2K16A 2LXPC 4BW2A 3T7LA 4AUQB 1WESA 4OGIA 5TB6A 5F5ZA 2CSZA 2JMJA 5E74A 3HTKC 5CQ6A 5E9KA 5A5NA 2ECNA 1E4UA 2Y43A 5LCWB 5B76A 4O64A 4YH4A 1E6IA 4O71A 5HFQA 5TDWA 4LK9A 2RI7A 4BW3A 4NR9A 2RNXA 4QB3A 3O34A 3QZTA 5DX4A 5EM3A 2YT5A 4YABA 4BHWA 5ENBA 3ASLA 4QF3A 2JUNA 2EXUA 4UYFB 4YADA 2DVSA 5D3SA 2KU3A 2YU4A 4CA1A 4LZSA 3P1FA 1VD4A 2RO1A 2IQJA 5KTWA 1JM7A 4OGJA 3KQIA 2KGGA 2MA6A 4TKPB 5FE5A 2YYNA 4HXKA 2JMDA 4CL9A 4CUQA 2ECGA 4MR5A 4YYIA 4Z0OA 5DKDA 3P1DA 4TZ2A 4AVXA 5EWVA 2RFJA 5HFRA 4HBYA 4XY9A 5F61A 4R2YA 3SUBA 3N9MA 4AKNA 2YEKA 1ZBDB 4N4FA 4NS5A 4UIWA 1VYXA 3U5OA 2K17A 2VPEA 4A9IA 2KREA 3FANA 4N4HA 3O33A 1DCQA 5FE3A 5LJ2A 2E7OA 2HDPA 2MJVB 4TU6A 2G43A 4QF2A 3AQAA 4MR4A 2QJ0A 4O77A 5HQ6A 5LVRA 2OWAA 5II1A 3SOXA 4B7YC 3P1EA 1ZS5A 5C89A 2LV9A 5KTXA 3PLWA 4NUCA 2CSVA 5D3LA 1WIMA 5I83A 3N9LA 2MD8C 2PUYA 5EWCA 5JG6A 3KNVA 4F1PA 1Z6UA 4TYLA 3UVYA 2D8UA 4MEQA 1X4JA 3HMHA 2OUOA 1T1HA 2FFWA 5KH7A 3QZSA 3KV6A 4LKAA 5SVXA 4QSXA 2H60A 4AI6A 5H9MA 5EI4A 4NR8A 4TU4A 4B86C 3UW9A 3P5OA 3JVMA 5HM0A 5DKHA 4Z6HA 4QEUA 4HBWA 4YATA 2IDAA 4Y03A 4A9JA 5D1KB 3DWYA 4YYKA 3UV2A 4YYJA 4Q0NA 5EP7A 5E3GA 5DLZA 5HENA 5L99A 2XEUA 4WZ3B 4TT2A 2GRCA 5E73A 5EISA 4HXNA 4ALHA 2XOZA 3O36A 3H7HA 2XB1A 3ZPVE 5CU8A 1JOCA 5EWHA 4X2IA 5HRWA 2VJEB 4R7EA 4Z0RA 5CQ5A 4F3IA 5FE7A 5ETDA 5CUEA 5K29A 4Q0OA 2DJAA 4NYXA 4NRCA 3V43A 4UITA 2YHNA 2DKWA 4QSRA 3P1CA 3U5MA 5HRVA 2ECJA 3DQVR 4UP5A 4XI1A 4RVRA 3SVFA 3O47A 5F36A 4IORA 3UV4A 4UYDA 4WZ0A 4YYGA 2H0DA 1MBMA 4MEPA 2MNZA 3K2JA 4KV4A 1CHCA 1Z60A 3Q2FA 2K1JA 4QUTA 4ZW1A 4YYDA 5BT5A 5I86A 4E96A 5EU1A 5C7NA 5EPRA 2M3HA 3GG3A 3ZYQA 5ACYA 4FIPA 2KYUA 4FJCA 3M7KA 2JM3A 4MSXA 2R0SA 5G4SA 3FL2A 3U5PA 1PUOA 2KGIA 4AYCA 5L98A 2KIZA 4PS5A 4ZQLA 4UYEA 4MVTA 5D3PA 2MD7B 2L7PA 5LKZA 5D3RA 4NQNA 4O78A 5H1UA 5A81A 4X3GA 2F6NA 1WE9A 2KTBB 4QYLA 3MXFA 5DBMA 4GNDA 2OO1A 2OXQC 4ZC9A 3D1BA 4FO9A 3HCSA 5L97A 3NG2A 4A4CA 3Q2EA 4NR5A 4MR6A 4P5OB 5CPEA 5LJ0A 4O76A 2MUMA 3HMEA 5DFDA 2YVRA 4QQ4A 4A4BA 3ZPV1 5HELA 2OSSA 4LADB 5LKUA 3IU5A 1HYJA 2RS9B 5HRXA 4NYVA 4KV1A 5SVIB 4QNSA 2VJFA 3DWDA 3N9QA 2XOYA 5ENFA 4LDFA 3DPLR 4AKIA 5EWWA 5I88A 5CGPA 4UIUA 4TQNA 2CKLA 3PHDA 4I7DA 5AIUA 2L0BA 5FE0A 2B0OE 3MHSA 2MA5A 4NN2A 4F52B 2E61A 5F62A 2F42A 5B79A 2YELA 5KO4A 2E6RA 4J0SA 4LYSA 5CY9A 5E9YA 2E7NA 1WEPA 5FDZA 5G04B 5HLSA 5E9MA 4A9OA 2KKYA 5A7CA 2LDRA 2YHOA 4UIYA 5F60A 4A9EA 2YEMA 4OUFA 5AMEA 2L43A 5D3NA 5LKXA 5G0FA 5EWDA 1U6GB 4QSPA 3VKHA 4W4UA 3EB5A 4HXPA 4FLPA 5EICA 2KE1A 2LXHC 4CUSA 5HQ5A 4J3IA 5E7DA 2KFTA 4O74A 4HBVA 2DX8A 3MQMA 4WHUA 4H9DA 5A5OA 4QEWA 2YW5A 4CURA 3SHBA 5C13A 4LZRA 4NQMA 4QBMA 5EVAA 2KR4A 5EGUA 4GB0A 2F6JA 4IR6A 1MM2A 4GNFA 5F1LA 4MENA 5E0RA 2M13A 5E3DA 2BAYA 2LN0A 5F63A 4NR6A 1V87A 5EPBA 3U5LA 4IC3A 3LDYA 3MUKA 4LYIA 3ZYUA 4J1PA 2XP0A 4XUAA 2DWWA 3GL6A 4HXLA 5TBNA 2I50A 5B78A 5G4RA 5EYAF 5ENGA 2ECVA 5C11A 4CUPA 4Z1SA 2KWJA 3L1ZB 1VFYA 5CUCA 5TRBA 4BBQA 4O7FA 5FG4A 4CFKA 5IIDA 4LR6A 3PUQA 5FERA 5FE9A 2HYED 2KWNA 2XOCA 5DYUA 5CS8A 5H1VA 4WA6A 4IC2A 3MB3A 4DONA 4GNEA 5KU3A 4YYHA 5I89A 4UIVA 4QC1A 2YDWA 3QZVA 3G0LA 5I1QA 5KHMA 1K2FA 2KKXA 3HCUA 3N9OA 5CUGA 5TCMA 5C85A 5I40A 2I7KA 3DDTA 4WIVA 1FBVA 5D3HA 3MHHA 3EB6A 2D82A 5JI8A 2C2LA 3C5KA 5EQ1A 5FFWA 2CSYA 2EGPA 5B75A 3LVQE 3KV5A 5A82A 1WENA 5ENCA 3SOWA 4PKLA 5LJ1A 1RMDA 1BORA 5HEMA 5A5SA 2D8SA 1HYIA 3D7CA 4TT6A 2FSAA 4LLBA
chains in the Genus database with same CATH topology
5COIA 5DY7A 1JSPB 4S3OB 2M1RA 3RTRB 3UVWA 3RPGB 2G6QA 2WP1A 3ZNIA 4NXJA 5H85A 5ETBA 5EK9A 5AD3A 2RSDA 5E9LA 5AD2A 4CUUA 2YYRA 4QSWA 4PPEA 5D1MB 2L85A 2AN6A 2YUCA 4IR3A 2VJEA 3HCTA 2FUIA 5F25A 4A9KA 5L96A 4A9FA 2K4DA 4UIZA 4QY4A 5CZGA 4N4GA 5DINA 5EA1A 5FEYA 4NUEA 2R10A 2YQDA 3N9NA 5B77A 4A9NA 5HJCA 4C9ZA 5G05B 4LJNA 4HBXA 3RPGC 4TT4A 4KCXA 2EODA 1WGMA 3AADA 5H1TA 1X4UA 2LGKA 4QSTA 4LZ2A 4NRBA 1N87A 3M62A 5AMFA 5FB0A 5IGNA 5IGLA 2VJFB 5ENHA 5CFWA 2LRIC 3C6WA 5FG6A 2L75A 2CKLB 4LC2A 5CRZA 2YQLA 5DKAA 5EPSA 1MM3A 5F3AA 4WZ2A 5F2PA 3O35A 2ECWA 4Z6IA 4QSQA 3ZVYA 3MULA 1Z2QA 1JM7B 2DATA 4LRGA 2ECTA 3G0JA 4IOOA 4A49A 5I29A 4A0CD 5ENJA 2VNFA 2LGGA 2L80A 5KH9A 4QR3A 1JM4B 3JVLA 4O7EA 4V3LC 5D3TA 5D26A 5E9IA 2QICA 3JVJA 5FFYA 5I80A 5DW2A 5FH8A 5BT3A 4QZSA 4MR3A 5CUDA 4CCGX 3T6RA 4O72A 2NAAA 5D3JA 3IHPA 2YREA 4V3KC 4YC9A 2VP7A 2RNWA 5FBXA 2M85A 3LXJA 4TTEA 4YBTA 2E6SA 2CT2A 5HQ7A 2YSMA 2MIQA 2ECIA 3IU6A 2VPBA 4UYFA 1N72A 5D25A 4QSSA 1WEOA 3U5KA 1LDJB 2E3KA 4HXRA 2Y1MA 4YBSA 5CQTA 1IYMA 5FE4A 3GV4A 3U5JA 4YYNA 2C2VS 5CQ7A 3PURA 5FFVA 3LQJA 3M99A 1WUMA 5TABA 3NXBA 5DYAA 5E9VA 4O70A 4WHWA 4XYAA 2YW8A 1G25A 5LKTA 2VPDA 3RCWA 2EA6A 4GPJA 4TZ8A 4PTBA 3TLPA 3S92A 4YY6A 1WEMA 5L8UA 4NRAA 5LUUA 4CFLA 5IGKA 2NXBA 2LQ6A 5FH7A 1X4IA 3I3JA 3UV5A 4FK5A 4N3WA 1WEQA 2JRJA 5FH6A 2L5UA 4C66A 2M6MA 4HXOA 4ALGA 4PCIA 4A9HA 3O70A 3VK6A 2I8NA 3S91A 3I2DA 5HCLA 1LDKC 3SVHA 4Q6FA 4ZDTA 2YQMA 3MB4A 1WEVA 5CUBA 5C4QA 4QSVA 5IG6A 5FE2A 3HMFA 4QEVA 2KWOA 2ZETC 4AP4A 1F68A 4YAXA 3SVGA 2Y1NA 4QR4A 5FE1A 4L7XA 3U5NA 4PY6A 5FE8A 3LJWA 1F62A 5D0CA 4Z1QA 1WUGA 5A5PA 3L11A 5FE6A 2LSPB 4QUUA 3ONIA 2R0YA 5J3XA 3O7AA 4UYHA 5FG5A 5CQAA 3UVDA 4BW1A 4YBMA 5CQ8A 5I7XA 5C8GA 2H0DB 3SOUA 4TS8A 4Z93A 5DYXA 2RNYA 4YY4A 1WILA 3FKMX 5A85A 2G4AA 5F1HA 2G45A 3L1XA 1WEUA 5DKCA 4QYDA 5B8DA 5KTUA 5A83A 3N9PA 5AITA 3LQHA 1EQFA 4O7AA 4A9MA 3M63A 2R0VA 5A5RA 2LGLA 2MNYA 4HXSA 4IR4A 4N4IA 3UVXA 3LRQA 4O75A 4YK0A 5LVQA 4AYCB 2FUUA 4O7BA 2YSJA 4UI9B 2DVVA 4I7BA 5D1LB 2L5EA 5CRMA 1X0JA 5II2A 4XUBA 3DAIA 5JWMA 4C67A 4J0RA 5A5QA 5DW1A 2D9EA 4NR7A 4ZUXU 2L84A 4CLBA 2VPGA 1WEWA 2WP2A 4QSUA 4YYMA 4S3OC 5EV9A 2DVRA 5DFCA 5L8TA 5IBNA 4MEOA 4YH3A 4CUTA 5IGMA 1FP0A 2DVQA 2QIZA 4IR5A 2UZGA 1WEEA 3ZVZB 5ENEA 5DYCA 5DFBA 5ENIA 5D24A 4L58A 4UIXA 3ZTGA 2YURA 3O37A 4NR4A 5CQ3A 2PNXA 1DVPA 4BW4A 4QC3A 5CP5A 5CQ4A 5KH3A 5CTLA 4R8PK 4QR5A 4HXMA 5TDRA 5I7YA 5DLXA 3JVKA 1XWHA 5D7XA 5C87A 2MT5A 4XY8A 1WFKA 4I7CA 4BJXA 4NYWA 5CUAA 3LQIA 4O7CA 4IOQA 4LYWA 4NUDA 4A9LA 5BT4A 5J0DA 2KWKA 4UP0A 4PCEA 5FB1A 2N9GA 2LGVA 5I3LA 2JMIA 4UYGA 2K16A 2LXPC 4BW2A 3T7LA 4AUQB 1WESA 4OGIA 5TB6A 5F5ZA 2CSZA 2JMJA 5E74A 3HTKC 5CQ6A 5E9KA 5A5NA 2ECNA 1E4UA 2Y43A 5LCWB 5B76A 4O64A 4YH4A 1E6IA 4O71A 5HFQA 5TDWA 4LK9A 2RI7A 4BW3A 4NR9A 2RNXA 4QB3A 3O34A 3QZTA 5DX4A 5EM3A 2YT5A 4YABA 4BHWA 5ENBA 3ASLA 4QF3A 4UYFB 4YADA 2DVSA 5D3SA 2KU3A 2YU4A 4CA1A 4LZSA 3P1FA 1VD4A 2RO1A 5KTWA 1JM7A 4OGJA 3KQIA 2KGGA 2MA6A 4TKPB 5FE5A 2YYNA 4HXKA 2JMDA 4CL9A 4CUQA 2ECGA 4MR5A 4YYIA 5DKDA 3P1DA 4TZ2A 4AVXA 5EWVA 2RFJA 5HFRA 4HBYA 4XY9A 5F61A 4R2YA 3N9MA 4AKNA 2YEKA 1ZBDB 4N4FA 4NS5A 4UIWA 1VYXA 3U5OA 2K17A 2VPEA 4A9IA 2KREA 4N4HA 3O33A 5FE3A 5LJ2A 2E7OA 2HDPA 2MJVB 4TU6A 2G43A 4QF2A 3AQAA 4MR4A 2QJ0A 4O77A 5HQ6A 5LVRA 3SOXA 5II1A 4B7YC 3P1EA 1ZS5A 5C89A 2LV9A 5KTXA 4NUCA 5D3LA 1WIMA 5I83A 3N9LA 2MD8C 2PUYA 5EWCA 5JG6A 3KNVA 1Z6UA 4TYLA 3UVYA 4MEQA 1X4JA 3HMHA 2OUOA 1T1HA 5KH7A 3QZSA 3KV6A 4LKAA 4QSXA 2H60A 5H9MA 5EI4A 4NR8A 4TU4A 4B86C 3UW9A 3P5OA 3JVMA 5HM0A 5DKHA 4Z6HA 4QEUA 4HBWA 4YATA 2IDAA 4Y03A 4A9JA 5D1KB 3DWYA 4YYKA 3UV2A 4YYJA 4Q0NA 5EP7A 5E3GA 5DLZA 5HENA 5L99A 2XEUA 4WZ3B 4TT2A 2GRCA 5E73A 5EISA 4HXNA 4ALHA 4GNGA 3O36A 3ZPVE 2XB1A 5CU8A 1JOCA 5EWHA 4X2IA 5HRWA 2VJEB 4R7EA 5CQ5A 4F3IA 5FE7A 5ETDA 5CUEA 5K29A 4Q0OA 4NYXA 4NRCA 3V43A 4UITA 2YHNA 2DKWA 4QSRA 3P1CA 3U5MA 5HRVA 2ECJA 3DQVR 4UP5A 4XI1A 4RVRA 3SVFA 5F36A 4IORA 3UV4A 4UYDA 4WZ0A 4YYGA 2H0DA 4MEPA 2MNZA 3K2JA 4KV4A 1CHCA 1Z60A 3Q2FA 2K1JA 4QUTA 4ZW1A 4YYDA 5BT5A 5I86A 4E96A 5EU1A 5C7NA 5EPRA 2M3HA 3GG3A 3ZYQA 5ACYA 4FIPA 2KYUA 4FJCA 4MSXA 2R0SA 5G4SA 3FL2A 3U5PA 2KGIA 4AYCA 5L98A 2KIZA 4PS5A 4ZQLA 4UYEA 4MVTA 5D3PA 2MD7B 5LKZA 5D3RA 4NQNA 4O78A 5H1UA 5A81A 4X3GA 2F6NA 1WE9A 2KTBB 4QYLA 3MXFA 5DBMA 4GNDA 2OO1A 2OXQC 4ZC9A 4FO9A 3HCSA 5L97A 3NG2A 4A4CA 3Q2EA 4NR5A 4MR6A 4P5OB 5CPEA 5LJ0A 4O76A 2MUMA 3HMEA 5DFDA 4A4BA 3ZPV1 5HELA 2OSSA 4LADB 5LKUA 3IU5A 1HYJA 2RS9B 5HRXA 4NYVA 4KV1A 4QNSA 2VJFA 3N9QA 5ENFA 4LDFA 3DPLR 5EWWA 5I88A 5CGPA 4UIUA 4TQNA 2CKLA 3PHDA 4I7DA 5AIUA 2L0BA 5FE0A 3MHSA 2MA5A 4NN2A 4F52B 5F62A 2F42A 5B79A 2YELA 5KO4A 2E6RA 4J0SA 4LYSA 5CY9A 5E9YA 2E7NA 1WEPA 5FDZA 5G04B 5HLSA 5E9MA 4A9OA 5A7CA 2LDRA 2YHOA 4UIYA 5F60A 4A9EA 2YEMA 4OUFA 5AMEA 2L43A 5D3NA 5LKXA 5G0FA 5EWDA 1U6GB 4QSPA 4W4UA 3EB5A 4HXPA 4FLPA 5EICA 2KE1A 2LXHC 4CUSA 5HQ5A 4J3IA 5E7DA 2KFTA 4O74A 4HBVA 2DX8A 3MQMA 4WHUA 5A5OA 4QEWA 2YW5A 4CURA 3SHBA 5C13A 4LZRA 4NQMA 4QBMA 5EVAA 2KR4A 5EGUA 4GB0A 2F6JA 4IR6A 1MM2A 4GNFA 5F1LA 4MENA 5E0RA 5E3DA 2BAYA 2LN0A 5F63A 4NR6A 1V87A 5EPBA 3U5LA 4IC3A 3MUKA 4LYIA 3ZYUA 4J1PA 4XUAA 2DWWA 3GL6A 4HXLA 5TBNA 2I50A 5B78A 5G4RA 5EYAF 5ENGA 2ECVA 5C11A 4CUPA 4Z1SA 2KWJA 3L1ZB 1VFYA 5CUCA 5TRBA 4BBQA 4O7FA 5FG4A 4CFKA 5IIDA 4LR6A 3PUQA 5FERA 5FE9A 2HYED 2KWNA 5DYUA 5CS8A 5H1VA 4WA6A 4IC2A 3MB3A 4DONA 4GNEA 5KU3A 4YYHA 5I89A 4UIVA 4QC1A 2YDWA 3QZVA 3G0LA 5I1QA 5KHMA 1K2FA 3HCUA 3N9OA 5CUGA 5TCMA 5C85A 5I40A 2I7KA 4WIVA 1FBVA 5D3HA 3MHHA 3EB6A 2D82A 5JI8A 2C2LA 3C5KA 5EQ1A 5FFWA 2CSYA 2EGPA 5B75A 3KV5A 5A82A 1WENA 5ENCA 3SOWA 4PKLA 5LJ1A 1RMDA 1BORA 5HEMA 5A5SA 2D8SA 1HYIA 3D7CA 4TT6A 2FSAA 4LLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COI A;  5DY7 A;  1JSP B;  4S3O B;  2M1R A;  3RTR B;  3UVW A;  3RPG B;  2G6Q A;  2WP1 A;  3ZNI A;  4NXJ A;  5H85 A;  5ETB A;  5EK9 A;  5AD3 A;  2RSD A;  5E9L A;  5AD2 A;  4CUU A;  2YYR A;  4QSW A;  4PPE A;  5D1M B;  2L85 A;  2AN6 A;  2YUC A;  4IR3 A;  2VJE A;  3HCT A;  2FUI A;  5F25 A;  4A9K A;  5L96 A;  4A9F A;  2K4D A;  4UIZ A;  4QY4 A;  5CZG A;  4N4G A;  5DIN A;  5EA1 A;  5FEY A;  4NUE A;  2R10 A;  2YQD A;  3N9N A;  5B77 A;  4A9N A;  5HJC A;  4C9Z A;  5G05 B;  4LJN A;  4HBX A;  3RPG C;  4TT4 A;  4KCX A;  2EOD A;  1WGM A;  3AAD A;  5H1T A;  1X4U A;  2LGK A;  4QST A;  4LZ2 A;  4NRB A;  1N87 A;  3M62 A;  5AMF A;  5FB0 A;  5IGN A;  5IGL A;  2VJF B;  5ENH A;  5CFW A;  2LRI C;  3C6W A;  5FG6 A;  2L75 A;  2CKL B;  4LC2 A;  5CRZ A;  2YQL A;  5DKA A;  5EPS A;  1MM3 A;  5F3A A;  4WZ2 A;  5F2P A;  3O35 A;  2ECW A;  4Z6I A;  4QSQ A;  3ZVY A;  3MUL A;  1Z2Q A;  1JM7 B;  2DAT A;  4LRG A;  2ECT A;  3G0J A;  4IOO A;  4A49 A;  5I29 A;  4A0C D;  5ENJ A;  2VNF A;  2LGG A;  2L80 A;  5KH9 A;  4QR3 A;  1JM4 B;  3JVL A;  4O7E A;  4V3L C;  5D3T A;  5D26 A;  5E9I A;  2QIC A;  3JVJ A;  5FFY A;  5I80 A;  5DW2 A;  5FH8 A;  5BT3 A;  4QZS A;  4MR3 A;  5CUD A;  4CCG X;  3T6R A;  4O72 A;  2NAA A;  5D3J A;  3IHP A;  2YRE A;  4V3K C;  4YC9 A;  2VP7 A;  2RNW A;  5FBX A;  2M85 A;  3LXJ A;  4TTE A;  4YBT A;  2E6S A;  2CT2 A;  5HQ7 A;  2YSM A;  2MIQ A;  2ECI A;  3IU6 A;  2VPB A;  4UYF A;  1N72 A;  5D25 A;  4QSS A;  1WEO A;  3U5K A;  1LDJ B;  2E3K A;  4HXR A;  2Y1M A;  4YBS A;  5CQT A;  1IYM A;  5FE4 A;  3GV4 A;  3U5J A;  4YYN A;  2C2V S;  5CQ7 A;  3PUR A;  5FFV A;  3LQJ A;  3M99 A;  1WUM A;  5TAB A;  3NXB A;  5DYA A;  5E9V A;  4O70 A;  4WHW A;  4XYA A;  2YW8 A;  1G25 A;  5LKT A;  2VPD A;  3RCW A;  2EA6 A;  4GPJ A;  4TZ8 A;  4PTB A;  3TLP A;  3S92 A;  4YY6 A;  1WEM A;  5L8U A;  4NRA A;  5LUU A;  4CFL A;  5IGK A;  2NXB A;  2LQ6 A;  5FH7 A;  1X4I A;  3I3J A;  3UV5 A;  4FK5 A;  4N3W A;  1WEQ A;  2JRJ A;  5FH6 A;  2L5U A;  4C66 A;  2M6M A;  4HXO A;  4ALG A;  4PCI A;  4A9H A;  3O70 A;  3VK6 A;  2I8N A;  3S91 A;  3I2D A;  5HCL A;  1LDK C;  3SVH A;  4Q6F A;  4ZDT A;  2YQM A;  3MB4 A;  1WEV A;  5CUB A;  5C4Q A;  4QSV A;  5IG6 A;  5FE2 A;  3HMF A;  4QEV A;  2KWO A;  2ZET C;  4AP4 A;  1F68 A;  4YAX A;  3SVG A;  2Y1N A;  4QR4 A;  5FE1 A;  4L7X A;  3U5N A;  4PY6 A;  5FE8 A;  3LJW A;  1F62 A;  5D0C A;  4Z1Q A;  1WUG A;  5A5P A;  3L11 A;  5FE6 A;  2LSP B;  4QUU A;  3ONI A;  2R0Y A;  5J3X A;  3O7A A;  4UYH A;  5FG5 A;  5CQA A;  3UVD A;  4BW1 A;  4YBM A;  5CQ8 A;  5I7X A;  5C8G A;  2H0D B;  3SOU A;  4TS8 A;  4Z93 A;  5DYX A;  2RNY A;  4YY4 A;  1WIL A;  3FKM X;  5A85 A;  2G4A A;  5F1H A;  2G45 A;  3L1X A;  1WEU A;  5DKC A;  4QYD A;  5B8D A;  5KTU A;  5A83 A;  3N9P A;  5AIT A;  3LQH A;  1EQF A;  4O7A A;  4A9M A;  3M63 A;  2R0V A;  5A5R A;  2LGL A;  2MNY A;  4HXS A;  4IR4 A;  4N4I A;  3UVX A;  3LRQ A;  4O75 A;  4YK0 A;  5LVQ A;  4AYC B;  2FUU A;  4O7B A;  2YSJ A;  4UI9 B;  2DVV A;  4I7B A;  5D1L B;  2L5E A;  5CRM A;  1X0J A;  5II2 A;  4XUB A;  3DAI A;  5JWM A;  4C67 A;  4J0R A;  5A5Q A;  5DW1 A;  2D9E A;  4NR7 A;  4ZUX U;  2L84 A;  4CLB A;  2VPG A;  1WEW A;  2WP2 A;  4QSU A;  4YYM A;  4S3O C;  5EV9 A;  2DVR A;  5DFC A;  5L8T A;  5IBN A;  4MEO A;  4YH3 A;  4CUT A;  5IGM A;  1FP0 A;  2DVQ A;  2QIZ A;  4IR5 A;  2UZG A;  1WEE A;  3ZVZ B;  5ENE A;  5DYC A;  5DFB A;  5ENI A;  5D24 A;  4L58 A;  4UIX A;  3ZTG A;  2YUR A;  3O37 A;  4NR4 A;  5CQ3 A;  2PNX A;  1DVP A;  4BW4 A;  4QC3 A;  5CP5 A;  5CQ4 A;  5KH3 A;  5CTL A;  4R8P K;  4QR5 A;  4HXM A;  5TDR A;  5I7Y A;  5DLX A;  3JVK A;  1XWH A;  5D7X A;  5C87 A;  2MT5 A;  4XY8 A;  1WFK A;  4I7C A;  4BJX A;  4NYW A;  5CUA A;  3LQI A;  4O7C A;  4IOQ A;  4LYW A;  4NUD A;  4A9L A;  5BT4 A;  5J0D A;  2KWK A;  4UP0 A;  4PCE A;  5FB1 A;  2N9G A;  2LGV A;  5I3L A;  2JMI A;  4UYG A;  2K16 A;  2LXP C;  4BW2 A;  3T7L A;  4AUQ B;  1WES A;  4OGI A;  5TB6 A;  5F5Z A;  2CSZ A;  2JMJ A;  5E74 A;  3HTK C;  5CQ6 A;  5E9K A;  5A5N A;  2ECN A;  1E4U A;  2Y43 A;  5LCW B;  5B76 A;  4O64 A;  4YH4 A;  1E6I A;  4O71 A;  5HFQ A;  5TDW A;  4LK9 A;  2RI7 A;  4BW3 A;  4NR9 A;  2RNX A;  4QB3 A;  3O34 A;  3QZT A;  5DX4 A;  5EM3 A;  2YT5 A;  4YAB A;  4BHW A;  5ENB A;  3ASL A;  4QF3 A;  4UYF B;  4YAD A;  2DVS A;  5D3S A;  2KU3 A;  2YU4 A;  4CA1 A;  4LZS A;  3P1F A;  1VD4 A;  2RO1 A;  5KTW A;  1JM7 A;  4OGJ A;  3KQI A;  2KGG A;  2MA6 A;  4TKP B;  5FE5 A;  2YYN A;  4HXK A;  2JMD A;  4CL9 A;  4CUQ A;  2ECG A;  4MR5 A;  4YYI A;  5DKD A;  3P1D A;  4TZ2 A;  4AVX A;  5EWV A;  2RFJ A;  5HFR A;  4HBY A;  4XY9 A;  5F61 A;  4R2Y A;  3N9M A;  4AKN A;  2YEK A;  1ZBD B;  4N4F A;  4NS5 A;  4UIW A;  1VYX A;  3U5O A;  2K17 A;  2VPE A;  4A9I A;  2KRE A;  4N4H A;  3O33 A;  5FE3 A;  5LJ2 A;  2E7O A;  2HDP A;  2MJV B;  4TU6 A;  2G43 A;  4QF2 A;  3AQA A;  4MR4 A;  2QJ0 A;  4O77 A;  5HQ6 A;  5LVR A;  3SOX A;  5II1 A;  4B7Y C;  3P1E A;  1ZS5 A;  5C89 A;  2LV9 A;  5KTX A;  4NUC A;  5D3L A;  1WIM A;  5I83 A;  3N9L A;  2MD8 C;  2PUY A;  5EWC A;  5JG6 A;  3KNV A;  1Z6U A;  4TYL A;  3UVY A;  4MEQ A;  1X4J A;  3HMH A;  2OUO A;  1T1H A;  5KH7 A;  3QZS A;  3KV6 A;  4LKA A;  4QSX A;  2H60 A;  5H9M A;  5EI4 A;  4NR8 A;  4TU4 A;  4B86 C;  3UW9 A;  3P5O A;  3JVM A;  5HM0 A;  5DKH A;  4Z6H A;  4QEU A;  4HBW A;  4YAT A;  2IDA A;  4Y03 A;  4A9J A;  5D1K B;  3DWY A;  4YYK A;  3UV2 A;  4YYJ A;  4Q0N A;  5EP7 A;  5E3G A;  5DLZ A;  5HEN A;  5L99 A;  2XEU A;  4WZ3 B;  4TT2 A;  2GRC A;  5E73 A;  5EIS A;  4HXN A;  4ALH A;  4GNG A;  3O36 A;  3ZPV E;  2XB1 A;  5CU8 A;  1JOC A;  5EWH A;  4X2I A;  5HRW A;  2VJE B;  4R7E A;  5CQ5 A;  4F3I A;  5FE7 A;  5ETD A;  5CUE A;  5K29 A;  4Q0O A;  4NYX A;  4NRC A;  3V43 A;  4UIT A;  2YHN A;  2DKW A;  4QSR A;  3P1C A;  3U5M A;  5HRV A;  2ECJ A;  3DQV R;  4UP5 A;  4XI1 A;  4RVR A;  3SVF A;  5F36 A;  4IOR A;  3UV4 A;  4UYD A;  4WZ0 A;  4YYG A;  2H0D A;  4MEP A;  2MNZ A;  3K2J A;  4KV4 A;  1CHC A;  1Z60 A;  3Q2F A;  2K1J A;  4QUT A;  4ZW1 A;  4YYD A;  5BT5 A;  5I86 A;  4E96 A;  5EU1 A;  5C7N A;  5EPR A;  2M3H A;  3GG3 A;  3ZYQ A;  5ACY A;  4FIP A;  2KYU A;  4FJC A;  4MSX A;  2R0S A;  5G4S A;  3FL2 A;  3U5P A;  2KGI A;  4AYC A;  5L98 A;  2KIZ A;  4PS5 A;  4ZQL A;  4UYE A;  4MVT A;  5D3P A;  2MD7 B;  5LKZ A;  5D3R A;  4NQN A;  4O78 A;  5H1U A;  5A81 A;  4X3G A;  2F6N A;  1WE9 A;  2KTB B;  4QYL A;  3MXF A;  5DBM A;  4GND A;  2OO1 A;  2OXQ C;  4ZC9 A;  4FO9 A;  3HCS A;  5L97 A;  3NG2 A;  4A4C A;  3Q2E A;  4NR5 A;  4MR6 A;  4P5O B;  5CPE A;  5LJ0 A;  4O76 A;  2MUM A;  3HME A;  5DFD A;  4A4B A;  3ZPV 1;  5HEL A;  2OSS A;  4LAD B;  5LKU A;  3IU5 A;  1HYJ A;  2RS9 B;  5HRX A;  4NYV A;  4KV1 A;  4QNS A;  2VJF A;  3N9Q A;  5ENF A;  4LDF A;  3DPL R;  5EWW A;  5I88 A;  5CGP A;  4UIU A;  4TQN A;  2CKL A;  3PHD A;  4I7D A;  5AIU A;  2L0B A;  5FE0 A;  3MHS A;  2MA5 A;  4NN2 A;  4F52 B;  5F62 A;  2F42 A;  5B79 A;  2YEL A;  5KO4 A;  2E6R A;  4J0S A;  4LYS A;  5CY9 A;  5E9Y A;  2E7N A;  1WEP A;  5FDZ A;  5G04 B;  5HLS A;  5E9M A;  4A9O A;  5A7C A;  2LDR A;  2YHO A;  4UIY A;  5F60 A;  4A9E A;  2YEM A;  4OUF A;  5AME A;  2L43 A;  5D3N A;  5LKX A;  5G0F A;  5EWD A;  1U6G B;  4QSP A;  4W4U A;  3EB5 A;  4HXP A;  4FLP A;  5EIC A;  2KE1 A;  2LXH C;  4CUS A;  5HQ5 A;  4J3I A;  5E7D A;  2KFT A;  4O74 A;  4HBV A;  2DX8 A;  3MQM A;  4WHU A;  5A5O A;  4QEW A;  2YW5 A;  4CUR A;  3SHB A;  5C13 A;  4LZR A;  4NQM A;  4QBM A;  5EVA A;  2KR4 A;  5EGU A;  4GB0 A;  2F6J A;  4IR6 A;  1MM2 A;  4GNF A;  5F1L A;  4MEN A;  5E0R A;  5E3D A;  2BAY A;  2LN0 A;  5F63 A;  4NR6 A;  1V87 A;  5EPB A;  3U5L A;  4IC3 A;  3MUK A;  4LYI A;  3ZYU A;  4J1P A;  4XUA A;  2DWW A;  3GL6 A;  4HXL A;  5TBN A;  2I50 A;  5B78 A;  5G4R A;  5EYA F;  5ENG A;  2ECV A;  5C11 A;  4CUP A;  4Z1S A;  2KWJ A;  3L1Z B;  1VFY A;  5CUC A;  5TRB A;  4BBQ A;  4O7F A;  5FG4 A;  4CFK A;  5IID A;  4LR6 A;  3PUQ A;  5FER A;  5FE9 A;  2HYE D;  2KWN A;  5DYU A;  5CS8 A;  5H1V A;  4WA6 A;  4IC2 A;  3MB3 A;  4DON A;  4GNE A;  5KU3 A;  4YYH A;  5I89 A;  4UIV A;  4QC1 A;  2YDW A;  3QZV A;  3G0L A;  5I1Q A;  5KHM A;  1K2F A;  3HCU A;  3N9O A;  5CUG A;  5TCM A;  5C85 A;  5I40 A;  2I7K A;  4WIV A;  1FBV A;  5D3H A;  3MHH A;  3EB6 A;  2D82 A;  5JI8 A;  2C2L A;  3C5K A;  5EQ1 A;  5FFW A;  2CSY A;  2EGP A;  5B75 A;  3KV5 A;  5A82 A;  1WEN A;  5ENC A;  3SOW A;  4PKL A;  5LJ1 A;  1RMD A;  1BOR A;  5HEM A;  5A5S A;  2D8S A;  1HYI A;  3D7C A;  4TT6 A;  2FSA A;  4LLB A; 
#chains in the Genus database with same CATH topology
 5COI A;  5DY7 A;  1JSP B;  4S3O B;  3FAO A;  2M1R A;  3RTR B;  3UVW A;  3RPG B;  3T9K A;  2G6Q A;  2WP1 A;  3VKG A;  4NXJ A;  5H85 A;  3ZNI A;  5ETB A;  5EK9 A;  5AD3 A;  2RSD A;  5E9L A;  5AD2 A;  4CUU A;  2YYR A;  4QSW A;  4PPE A;  3E2D A;  5D1M B;  2L85 A;  2AN6 A;  2YUC A;  4IR3 A;  2VJE A;  3HCT A;  2CRW A;  2FUI A;  5F25 A;  4A9K A;  5L96 A;  4A9F A;  2K4D A;  4UIZ A;  4QY4 A;  5CZG A;  4N4G A;  5DIN A;  5EA1 A;  5FEY A;  4NUE A;  2R10 A;  2YQD A;  3N9N A;  5B77 A;  4A9N A;  5HJC A;  4C9Z A;  2EJN A;  5G05 B;  3FM8 C;  4LJN A;  2CRR A;  4HBX A;  3RPG C;  4TT4 A;  4KCX A;  2EOD A;  3MDB C;  1WGM A;  3AAD A;  5H1T A;  1X4U A;  2LGK A;  4QST A;  4LZ2 A;  4NRB A;  1N87 A;  3M62 A;  5AMF A;  5FB0 A;  5IGN A;  5IGL A;  2VJF B;  5ENH A;  3D1D A;  5CFW A;  2LRI C;  2P57 A;  3C6W A;  5FG6 A;  2L75 A;  2CKL B;  4LC2 A;  5CRZ A;  2YQL A;  5DKA A;  5EPS A;  1MM3 A;  5F3A A;  4WZ2 A;  5F2P A;  3O35 A;  5K3Q A;  4O62 A;  2ECW A;  4Z6I A;  4QSQ A;  3ZVY A;  3MUL A;  1Z2Q A;  1JM7 B;  2DAT A;  4LRG A;  2ECT A;  3G0J A;  4IOO A;  4A49 A;  5I29 A;  4A0C D;  5ENJ A;  2VNF A;  2LGG A;  2L80 A;  5KH9 A;  4QR3 A;  1JM4 B;  3JVL A;  4O7E A;  4V3L C;  5D3T A;  5D26 A;  5E9I A;  2QIC A;  3JVJ A;  5FFY A;  5I80 A;  5DW2 A;  5FH8 A;  5BT3 A;  4QZS A;  4MR3 A;  5SVI A;  5CUD A;  4CCG X;  3ERR A;  3T6R A;  4O72 A;  2NAA A;  5D3J A;  3IHP A;  2YRE A;  4V3K C;  4YC9 A;  2VP7 A;  2RNW A;  5FBX A;  2M85 A;  3LXJ A;  4TTE A;  4YBT A;  2E6S A;  2CT2 A;  5HQ7 A;  2YSM A;  2MIQ A;  2ECI A;  3IU6 A;  2FD4 A;  4UYF A;  2VPB A;  1N72 A;  5D25 A;  4QSS A;  1WEO A;  3U5K A;  1LDJ B;  2E3K A;  4HXR A;  2Y1M A;  4YBS A;  5CQT A;  2EGM A;  1IYM A;  5FE4 A;  3GV4 A;  3U5J A;  4YYN A;  2C2V S;  5CQ7 A;  2MKE A;  3PUR A;  5FFV A;  3LQJ A;  3M99 A;  1WUM A;  5TAB A;  3NXB A;  5DYA A;  5E9V A;  4O70 A;  4WHW A;  4XYA A;  2YW8 A;  1G25 A;  2CON A;  5LKT A;  2VPD A;  3RCW A;  2EA6 A;  4GPJ A;  4TZ8 A;  4PTB A;  3TLP A;  3S92 A;  4YY6 A;  1WEM A;  5L8U A;  4NRA A;  5LUU A;  4CFL A;  5IGK A;  2NXB A;  2LQ6 A;  3FEH A;  5FH7 A;  3Q1D A;  1X4I A;  3I3J A;  3UV5 A;  4FK5 A;  4N3W A;  1WEQ A;  2JRJ A;  5FH6 A;  2L5U A;  4C66 A;  2M6M A;  4HXO A;  3LJU X;  4ALG A;  4PCI A;  4A9H A;  3O70 A;  3VK6 A;  2I8N A;  3S91 A;  3I2D A;  4OGC A;  5HCL A;  1LDK C;  3SVH A;  4Q6F A;  4ZDT A;  2YQM A;  3MB4 A;  1WEV A;  5CUB A;  3JUE A;  5C4Q A;  4QSV A;  3FJU B;  5IG6 A;  5FE2 A;  3HMF A;  4QEV A;  2KWO A;  2ZET C;  4AP4 A;  1F68 A;  4YAX A;  3SVG A;  2Y1N A;  4QR4 A;  5FE1 A;  4L7X A;  3U5N A;  4PY6 A;  5FE8 A;  3LJW A;  1F62 A;  5D0C A;  4Z1Q A;  1WUG A;  5A5P A;  3L11 A;  5FE6 A;  2LSP B;  4QUU A;  3ONI A;  2R0Y A;  4OGE A;  5J3X A;  3O7A A;  4UYH A;  5FG5 A;  5CQA A;  3UVD A;  4BW1 A;  4YBM A;  5CQ8 A;  5I7X A;  5C8G A;  2H0D B;  3SOU A;  4TS8 A;  4Z93 A;  5DYX A;  2RNY A;  4YY4 A;  1WIL A;  3FKM X;  5A85 A;  2G4A A;  5F1H A;  2G45 A;  3L1X A;  1WEU A;  5DKC A;  4QYD A;  5B8D A;  5KTU A;  5A83 A;  3N9P A;  5AIT A;  3LQH A;  1EQF A;  4O7A A;  4A9M A;  3M63 A;  2R0V A;  5A5R A;  2LAU A;  2LGL A;  2MNY A;  4HXS A;  4IR4 A;  4N4I A;  3UVX A;  4AKG A;  3LRQ A;  4O75 A;  4YK0 A;  5LVQ A;  4AYC B;  2FUU A;  4O7B A;  2YSJ A;  4UI9 B;  2DVV A;  4I7B A;  2DSM A;  2L5E A;  5CRM A;  5D1L B;  1X0J A;  5II2 A;  4XUB A;  3DAI A;  5JWM A;  4C67 A;  4J0R A;  5A5Q A;  5DW1 A;  2D9E A;  4NR7 A;  4ZUX U;  2L84 A;  4CLB A;  2VPG A;  1WEW A;  2WP2 A;  4QSU A;  4GNG A;  5SVY A;  4YYM A;  4S3O C;  5EV9 A;  2DVR A;  5DFC A;  5L8T A;  5IBN A;  4MEO A;  4YH3 A;  4CUT A;  5IGM A;  1FP0 A;  2DVQ A;  2QIZ A;  4IR5 A;  2UZG A;  1WEE A;  3ZVZ B;  5ENE A;  5DYC A;  5DFB A;  5ENI A;  5D24 A;  4L58 A;  3LVR E;  4UIX A;  3ZTG A;  2YUR A;  3O37 A;  1ZKR A;  3KDE C;  4NR4 A;  5CQ3 A;  2PNX A;  1DVP A;  4BW4 A;  4QC3 A;  5CP5 A;  5CQ4 A;  5KH3 A;  5CTL A;  4R8P K;  4QR5 A;  4HXM A;  5TDR A;  5I7Y A;  5DLX A;  3JVK A;  1XWH A;  5D7X A;  5C87 A;  2MT5 A;  4XY8 A;  1WFK A;  4I7C A;  4BJX A;  4AKH A;  4NYW A;  5CUA A;  3LQI A;  4O7C A;  4IOQ A;  4LYW A;  4NUD A;  4A9L A;  5BT4 A;  5J0D A;  2KWK A;  2RR4 A;  4PCE A;  4UP0 A;  5FB1 A;  2N9G A;  2LGV A;  5I3L A;  2JMI A;  4UYG A;  2K16 A;  2LXP C;  4BW2 A;  3T7L A;  4AUQ B;  1WES A;  4OGI A;  5TB6 A;  5F5Z A;  2CSZ A;  2JMJ A;  5E74 A;  3HTK C;  5CQ6 A;  5E9K A;  5A5N A;  2ECN A;  1E4U A;  2Y43 A;  5LCW B;  5B76 A;  4O64 A;  4YH4 A;  1E6I A;  4O71 A;  5HFQ A;  5TDW A;  4LK9 A;  2RI7 A;  4BW3 A;  4NR9 A;  2RNX A;  4QB3 A;  3O34 A;  3QZT A;  5DX4 A;  5EM3 A;  2YT5 A;  4YAB A;  4BHW A;  5ENB A;  3ASL A;  4QF3 A;  2JUN A;  2EXU A;  4UYF B;  4YAD A;  2DVS A;  5D3S A;  2KU3 A;  2YU4 A;  4CA1 A;  4LZS A;  3P1F A;  1VD4 A;  2RO1 A;  2IQJ A;  5KTW A;  1JM7 A;  4OGJ A;  3KQI A;  2KGG A;  2MA6 A;  4TKP B;  5FE5 A;  2YYN A;  4HXK A;  2JMD A;  4CL9 A;  4CUQ A;  2ECG A;  4MR5 A;  4YYI A;  4Z0O A;  5DKD A;  3P1D A;  4TZ2 A;  4AVX A;  5EWV A;  2RFJ A;  5HFR A;  4HBY A;  4XY9 A;  5F61 A;  4R2Y A;  3SUB A;  3N9M A;  4AKN A;  2YEK A;  1ZBD B;  4N4F A;  4NS5 A;  4UIW A;  1VYX A;  3U5O A;  2K17 A;  2VPE A;  4A9I A;  2KRE A;  3FAN A;  4N4H A;  3O33 A;  1DCQ A;  5FE3 A;  5LJ2 A;  2E7O A;  2HDP A;  2MJV B;  4TU6 A;  2G43 A;  4QF2 A;  3AQA A;  4MR4 A;  2QJ0 A;  4O77 A;  5HQ6 A;  5LVR A;  2OWA A;  5II1 A;  3SOX A;  4B7Y C;  3P1E A;  1ZS5 A;  5C89 A;  2LV9 A;  5KTX A;  3PLW A;  4NUC A;  2CSV A;  5D3L A;  1WIM A;  5I83 A;  3N9L A;  2MD8 C;  2PUY A;  5EWC A;  5JG6 A;  3KNV A;  4F1P A;  1Z6U A;  4TYL A;  3UVY A;  2D8U A;  4MEQ A;  1X4J A;  3HMH A;  2OUO A;  1T1H A;  2FFW A;  5KH7 A;  3QZS A;  3KV6 A;  4LKA A;  5SVX A;  4QSX A;  2H60 A;  4AI6 A;  5H9M A;  5EI4 A;  4NR8 A;  4TU4 A;  4B86 C;  3UW9 A;  3P5O A;  3JVM A;  5HM0 A;  5DKH A;  4Z6H A;  4QEU A;  4HBW A;  4YAT A;  2IDA A;  4Y03 A;  4A9J A;  5D1K B;  3DWY A;  4YYK A;  3UV2 A;  4YYJ A;  4Q0N A;  5EP7 A;  5E3G A;  5DLZ A;  5HEN A;  5L99 A;  2XEU A;  4WZ3 B;  4TT2 A;  2GRC A;  5E73 A;  5EIS A;  4HXN A;  4ALH A;  2XOZ A;  3O36 A;  3H7H A;  2XB1 A;  3ZPV E;  5CU8 A;  1JOC A;  5EWH A;  4X2I A;  5HRW A;  2VJE B;  4R7E A;  4Z0R A;  5CQ5 A;  4F3I A;  5FE7 A;  5ETD A;  5CUE A;  5K29 A;  4Q0O A;  2DJA A;  4NYX A;  4NRC A;  3V43 A;  4UIT A;  2YHN A;  2DKW A;  4QSR A;  3P1C A;  3U5M A;  5HRV A;  2ECJ A;  3DQV R;  4UP5 A;  4XI1 A;  4RVR A;  3SVF A;  3O47 A;  5F36 A;  4IOR A;  3UV4 A;  4UYD A;  4WZ0 A;  4YYG A;  2H0D A;  1MBM A;  4MEP A;  2MNZ A;  3K2J A;  4KV4 A;  1CHC A;  1Z60 A;  3Q2F A;  2K1J A;  4QUT A;  4ZW1 A;  4YYD A;  5BT5 A;  5I86 A;  4E96 A;  5EU1 A;  5C7N A;  5EPR A;  2M3H A;  3GG3 A;  3ZYQ A;  5ACY A;  4FIP A;  2KYU A;  4FJC A;  3M7K A;  2JM3 A;  4MSX A;  2R0S A;  5G4S A;  3FL2 A;  3U5P A;  1PUO A;  2KGI A;  4AYC A;  5L98 A;  2KIZ A;  4PS5 A;  4ZQL A;  4UYE A;  4MVT A;  5D3P A;  2MD7 B;  2L7P A;  5LKZ A;  5D3R A;  4NQN A;  4O78 A;  5H1U A;  5A81 A;  4X3G A;  2F6N A;  1WE9 A;  2KTB B;  4QYL A;  3MXF A;  5DBM A;  4GND A;  2OO1 A;  2OXQ C;  4ZC9 A;  3D1B A;  4FO9 A;  3HCS A;  5L97 A;  3NG2 A;  4A4C A;  3Q2E A;  4NR5 A;  4MR6 A;  4P5O B;  5CPE A;  5LJ0 A;  4O76 A;  2MUM A;  3HME A;  5DFD A;  2YVR A;  4QQ4 A;  4A4B A;  3ZPV 1;  5HEL A;  2OSS A;  4LAD B;  5LKU A;  3IU5 A;  1HYJ A;  2RS9 B;  5HRX A;  4NYV A;  4KV1 A;  5SVI B;  4QNS A;  2VJF A;  3DWD A;  3N9Q A;  2XOY A;  5ENF A;  4LDF A;  3DPL R;  4AKI A;  5EWW A;  5I88 A;  5CGP A;  4UIU A;  4TQN A;  2CKL A;  3PHD A;  4I7D A;  5AIU A;  2L0B A;  5FE0 A;  2B0O E;  3MHS A;  2MA5 A;  4NN2 A;  4F52 B;  2E61 A;  5F62 A;  2F42 A;  5B79 A;  2YEL A;  5KO4 A;  2E6R A;  4J0S A;  4LYS A;  5CY9 A;  5E9Y A;  2E7N A;  1WEP A;  5FDZ A;  5G04 B;  5HLS A;  5E9M A;  4A9O A;  2KKY A;  5A7C A;  2LDR A;  2YHO A;  4UIY A;  5F60 A;  4A9E A;  2YEM A;  4OUF A;  5AME A;  2L43 A;  5D3N A;  5LKX A;  5G0F A;  5EWD A;  1U6G B;  4QSP A;  3VKH A;  4W4U A;  3EB5 A;  4HXP A;  4FLP A;  5EIC A;  2KE1 A;  2LXH C;  4CUS A;  5HQ5 A;  4J3I A;  5E7D A;  2KFT A;  4O74 A;  4HBV A;  2DX8 A;  3MQM A;  4WHU A;  4H9D A;  5A5O A;  4QEW A;  2YW5 A;  4CUR A;  3SHB A;  5C13 A;  4LZR A;  4NQM A;  4QBM A;  5EVA A;  2KR4 A;  5EGU A;  4GB0 A;  2F6J A;  4IR6 A;  1MM2 A;  4GNF A;  5F1L A;  4MEN A;  5E0R A;  2M13 A;  5E3D A;  2BAY A;  2LN0 A;  5F63 A;  4NR6 A;  1V87 A;  5EPB A;  3U5L A;  4IC3 A;  3LDY A;  3MUK A;  4LYI A;  3ZYU A;  4J1P A;  2XP0 A;  4XUA A;  2DWW A;  3GL6 A;  4HXL A;  5TBN A;  2I50 A;  5B78 A;  5G4R A;  5EYA F;  5ENG A;  2ECV A;  5C11 A;  4CUP A;  4Z1S A;  2KWJ A;  3L1Z B;  1VFY A;  5CUC A;  5TRB A;  4BBQ A;  4O7F A;  5FG4 A;  4CFK A;  5IID A;  4LR6 A;  3PUQ A;  5FER A;  5FE9 A;  2HYE D;  2KWN A;  2XOC A;  5DYU A;  5CS8 A;  5H1V A;  4WA6 A;  4IC2 A;  3MB3 A;  4DON A;  4GNE A;  5KU3 A;  4YYH A;  5I89 A;  4UIV A;  4QC1 A;  2YDW A;  3QZV A;  3G0L A;  5I1Q A;  5KHM A;  1K2F A;  2KKX A;  3HCU A;  3N9O A;  5CUG A;  5TCM A;  5C85 A;  5I40 A;  2I7K A;  3DDT A;  4WIV A;  1FBV A;  5D3H A;  3MHH A;  3EB6 A;  2D82 A;  5JI8 A;  2C2L A;  3C5K A;  5EQ1 A;  5FFW A;  2CSY A;  2EGP A;  5B75 A;  3LVQ E;  3KV5 A;  5A82 A;  1WEN A;  5ENC A;  3SOW A;  4PKL A;  5LJ1 A;  1RMD A;  1BOR A;  5HEM A;  5A5S A;  2D8S A;  1HYI A;  3D7C A;  4TT6 A;  2FSA A;  4LLB A; 
#chains in the Genus database with same CATH homology
 5COI A;  5DY7 A;  1JSP B;  4S3O B;  2M1R A;  3RTR B;  3UVW A;  3RPG B;  2G6Q A;  2WP1 A;  3ZNI A;  4NXJ A;  5H85 A;  5ETB A;  5EK9 A;  5AD3 A;  2RSD A;  5E9L A;  5AD2 A;  4CUU A;  2YYR A;  4QSW A;  4PPE A;  5D1M B;  2L85 A;  2AN6 A;  2YUC A;  4IR3 A;  2VJE A;  3HCT A;  2FUI A;  5F25 A;  4A9K A;  5L96 A;  4A9F A;  2K4D A;  4UIZ A;  4QY4 A;  5CZG A;  4N4G A;  5DIN A;  5EA1 A;  5FEY A;  4NUE A;  2R10 A;  2YQD A;  3N9N A;  5B77 A;  4A9N A;  5HJC A;  4C9Z A;  5G05 B;  4LJN A;  4HBX A;  3RPG C;  4TT4 A;  4KCX A;  2EOD A;  1WGM A;  3AAD A;  5H1T A;  1X4U A;  2LGK A;  4QST A;  4LZ2 A;  4NRB A;  1N87 A;  3M62 A;  5AMF A;  5FB0 A;  5IGN A;  5IGL A;  2VJF B;  5ENH A;  5CFW A;  2LRI C;  3C6W A;  5FG6 A;  2L75 A;  2CKL B;  4LC2 A;  5CRZ A;  2YQL A;  5DKA A;  5EPS A;  1MM3 A;  5F3A A;  4WZ2 A;  5F2P A;  3O35 A;  2ECW A;  4Z6I A;  4QSQ A;  3ZVY A;  3MUL A;  1Z2Q A;  1JM7 B;  2DAT A;  4LRG A;  2ECT A;  3G0J A;  4IOO A;  4A49 A;  5I29 A;  4A0C D;  5ENJ A;  2VNF A;  2LGG A;  2L80 A;  5KH9 A;  4QR3 A;  1JM4 B;  3JVL A;  4O7E A;  4V3L C;  5D3T A;  5D26 A;  5E9I A;  2QIC A;  3JVJ A;  5FFY A;  5I80 A;  5DW2 A;  5FH8 A;  5BT3 A;  4QZS A;  4MR3 A;  5CUD A;  4CCG X;  3T6R A;  4O72 A;  2NAA A;  5D3J A;  3IHP A;  2YRE A;  4V3K C;  4YC9 A;  2VP7 A;  2RNW A;  5FBX A;  2M85 A;  3LXJ A;  4TTE A;  4YBT A;  2E6S A;  2CT2 A;  5HQ7 A;  2YSM A;  2MIQ A;  2ECI A;  3IU6 A;  2VPB A;  4UYF A;  1N72 A;  5D25 A;  4QSS A;  1WEO A;  3U5K A;  1LDJ B;  2E3K A;  4HXR A;  2Y1M A;  4YBS A;  5CQT A;  1IYM A;  5FE4 A;  3GV4 A;  3U5J A;  4YYN A;  2C2V S;  5CQ7 A;  3PUR A;  5FFV A;  3LQJ A;  3M99 A;  1WUM A;  5TAB A;  3NXB A;  5DYA A;  5E9V A;  4O70 A;  4WHW A;  4XYA A;  2YW8 A;  1G25 A;  5LKT A;  2VPD A;  3RCW A;  2EA6 A;  4GPJ A;  4TZ8 A;  4PTB A;  3TLP A;  3S92 A;  4YY6 A;  1WEM A;  5L8U A;  4NRA A;  5LUU A;  4CFL A;  5IGK A;  2NXB A;  2LQ6 A;  5FH7 A;  1X4I A;  3I3J A;  3UV5 A;  4FK5 A;  4N3W A;  1WEQ A;  2JRJ A;  5FH6 A;  2L5U A;  4C66 A;  2M6M A;  4HXO A;  4ALG A;  4PCI A;  4A9H A;  3O70 A;  3VK6 A;  2I8N A;  3S91 A;  3I2D A;  5HCL A;  1LDK C;  3SVH A;  4Q6F A;  4ZDT A;  2YQM A;  3MB4 A;  1WEV A;  5CUB A;  5C4Q A;  4QSV A;  5IG6 A;  5FE2 A;  3HMF A;  4QEV A;  2KWO A;  2ZET C;  4AP4 A;  1F68 A;  4YAX A;  3SVG A;  2Y1N A;  4QR4 A;  5FE1 A;  4L7X A;  3U5N A;  4PY6 A;  5FE8 A;  3LJW A;  1F62 A;  5D0C A;  4Z1Q A;  1WUG A;  5A5P A;  3L11 A;  5FE6 A;  2LSP B;  4QUU A;  3ONI A;  2R0Y A;  5J3X A;  3O7A A;  4UYH A;  5FG5 A;  5CQA A;  3UVD A;  4BW1 A;  4YBM A;  5CQ8 A;  5I7X A;  5C8G A;  2H0D B;  3SOU A;  4TS8 A;  4Z93 A;  5DYX A;  2RNY A;  4YY4 A;  1WIL A;  3FKM X;  5A85 A;  2G4A A;  5F1H A;  2G45 A;  3L1X A;  1WEU A;  5DKC A;  4QYD A;  5B8D A;  5KTU A;  5A83 A;  3N9P A;  5AIT A;  3LQH A;  1EQF A;  4O7A A;  4A9M A;  3M63 A;  2R0V A;  5A5R A;  2LGL A;  2MNY A;  4HXS A;  4IR4 A;  4N4I A;  3UVX A;  3LRQ A;  4O75 A;  4YK0 A;  5LVQ A;  4AYC B;  2FUU A;  4O7B A;  2YSJ A;  4UI9 B;  2DVV A;  4I7B A;  5D1L B;  2L5E A;  5CRM A;  1X0J A;  5II2 A;  4XUB A;  3DAI A;  5JWM A;  4C67 A;  4J0R A;  5A5Q A;  5DW1 A;  2D9E A;  4NR7 A;  4ZUX U;  2L84 A;  4CLB A;  2VPG A;  1WEW A;  2WP2 A;  4QSU A;  4YYM A;  4S3O C;  5EV9 A;  2DVR A;  5DFC A;  5L8T A;  5IBN A;  4MEO A;  4YH3 A;  4CUT A;  5IGM A;  1FP0 A;  2DVQ A;  2QIZ A;  4IR5 A;  2UZG A;  1WEE A;  3ZVZ B;  5ENE A;  5DYC A;  5DFB A;  5ENI A;  5D24 A;  4L58 A;  4UIX A;  3ZTG A;  2YUR A;  3O37 A;  4NR4 A;  5CQ3 A;  2PNX A;  1DVP A;  4BW4 A;  4QC3 A;  5CP5 A;  5CQ4 A;  5KH3 A;  5CTL A;  4R8P K;  4QR5 A;  4HXM A;  5TDR A;  5I7Y A;  5DLX A;  3JVK A;  1XWH A;  5D7X A;  5C87 A;  2MT5 A;  4XY8 A;  1WFK A;  4I7C A;  4BJX A;  4NYW A;  5CUA A;  3LQI A;  4O7C A;  4IOQ A;  4LYW A;  4NUD A;  4A9L A;  5BT4 A;  5J0D A;  2KWK A;  4UP0 A;  4PCE A;  5FB1 A;  2N9G A;  2LGV A;  5I3L A;  2JMI A;  4UYG A;  2K16 A;  2LXP C;  4BW2 A;  3T7L A;  4AUQ B;  1WES A;  4OGI A;  5TB6 A;  5F5Z A;  2CSZ A;  2JMJ A;  5E74 A;  3HTK C;  5CQ6 A;  5E9K A;  5A5N A;  2ECN A;  1E4U A;  2Y43 A;  5LCW B;  5B76 A;  4O64 A;  4YH4 A;  1E6I A;  4O71 A;  5HFQ A;  5TDW A;  4LK9 A;  2RI7 A;  4BW3 A;  4NR9 A;  2RNX A;  4QB3 A;  3O34 A;  3QZT A;  5DX4 A;  5EM3 A;  2YT5 A;  4YAB A;  4BHW A;  5ENB A;  3ASL A;  4QF3 A;  4UYF B;  4YAD A;  2DVS A;  5D3S A;  2KU3 A;  2YU4 A;  4CA1 A;  4LZS A;  3P1F A;  1VD4 A;  2RO1 A;  5KTW A;  1JM7 A;  4OGJ A;  3KQI A;  2KGG A;  2MA6 A;  4TKP B;  5FE5 A;  2YYN A;  4HXK A;  2JMD A;  4CL9 A;  4CUQ A;  2ECG A;  4MR5 A;  4YYI A;  5DKD A;  3P1D A;  4TZ2 A;  4AVX A;  5EWV A;  2RFJ A;  5HFR A;  4HBY A;  4XY9 A;  5F61 A;  4R2Y A;  3N9M A;  4AKN A;  2YEK A;  1ZBD B;  4N4F A;  4NS5 A;  4UIW A;  1VYX A;  3U5O A;  2K17 A;  2VPE A;  4A9I A;  2KRE A;  4N4H A;  3O33 A;  5FE3 A;  5LJ2 A;  2E7O A;  2HDP A;  2MJV B;  4TU6 A;  2G43 A;  4QF2 A;  3AQA A;  4MR4 A;  2QJ0 A;  4O77 A;  5HQ6 A;  5LVR A;  3SOX A;  5II1 A;  4B7Y C;  3P1E A;  1ZS5 A;  5C89 A;  2LV9 A;  5KTX A;  4NUC A;  5D3L A;  1WIM A;  5I83 A;  3N9L A;  2MD8 C;  2PUY A;  5EWC A;  5JG6 A;  3KNV A;  1Z6U A;  4TYL A;  3UVY A;  4MEQ A;  1X4J A;  3HMH A;  2OUO A;  1T1H A;  5KH7 A;  3QZS A;  3KV6 A;  4LKA A;  4QSX A;  2H60 A;  5H9M A;  5EI4 A;  4NR8 A;  4TU4 A;  4B86 C;  3UW9 A;  3P5O A;  3JVM A;  5HM0 A;  5DKH A;  4Z6H A;  4QEU A;  4HBW A;  4YAT A;  2IDA A;  4Y03 A;  4A9J A;  5D1K B;  3DWY A;  4YYK A;  3UV2 A;  4YYJ A;  4Q0N A;  5EP7 A;  5E3G A;  5DLZ A;  5HEN A;  5L99 A;  2XEU A;  4WZ3 B;  4TT2 A;  2GRC A;  5E73 A;  5EIS A;  4HXN A;  4ALH A;  4GNG A;  3O36 A;  3ZPV E;  2XB1 A;  5CU8 A;  1JOC A;  5EWH A;  4X2I A;  5HRW A;  2VJE B;  4R7E A;  5CQ5 A;  4F3I A;  5FE7 A;  5ETD A;  5CUE A;  5K29 A;  4Q0O A;  4NYX A;  4NRC A;  3V43 A;  4UIT A;  2YHN A;  2DKW A;  4QSR A;  3P1C A;  3U5M A;  5HRV A;  2ECJ A;  3DQV R;  4UP5 A;  4XI1 A;  4RVR A;  3SVF A;  5F36 A;  4IOR A;  3UV4 A;  4UYD A;  4WZ0 A;  4YYG A;  2H0D A;  4MEP A;  2MNZ A;  3K2J A;  4KV4 A;  1CHC A;  1Z60 A;  3Q2F A;  2K1J A;  4QUT A;  4ZW1 A;  4YYD A;  5BT5 A;  5I86 A;  4E96 A;  5EU1 A;  5C7N A;  5EPR A;  2M3H A;  3GG3 A;  3ZYQ A;  5ACY A;  4FIP A;  2KYU A;  4FJC A;  4MSX A;  2R0S A;  5G4S A;  3FL2 A;  3U5P A;  2KGI A;  4AYC A;  5L98 A;  2KIZ A;  4PS5 A;  4ZQL A;  4UYE A;  4MVT A;  5D3P A;  2MD7 B;  5LKZ A;  5D3R A;  4NQN A;  4O78 A;  5H1U A;  5A81 A;  4X3G A;  2F6N A;  1WE9 A;  2KTB B;  4QYL A;  3MXF A;  5DBM A;  4GND A;  2OO1 A;  2OXQ C;  4ZC9 A;  4FO9 A;  3HCS A;  5L97 A;  3NG2 A;  4A4C A;  3Q2E A;  4NR5 A;  4MR6 A;  4P5O B;  5CPE A;  5LJ0 A;  4O76 A;  2MUM A;  3HME A;  5DFD A;  4A4B A;  3ZPV 1;  5HEL A;  2OSS A;  4LAD B;  5LKU A;  3IU5 A;  1HYJ A;  2RS9 B;  5HRX A;  4NYV A;  4KV1 A;  4QNS A;  2VJF A;  3N9Q A;  5ENF A;  4LDF A;  3DPL R;  5EWW A;  5I88 A;  5CGP A;  4UIU A;  4TQN A;  2CKL A;  3PHD A;  4I7D A;  5AIU A;  2L0B A;  5FE0 A;  3MHS A;  2MA5 A;  4NN2 A;  4F52 B;  5F62 A;  2F42 A;  5B79 A;  2YEL A;  5KO4 A;  2E6R A;  4J0S A;  4LYS A;  5CY9 A;  5E9Y A;  2E7N A;  1WEP A;  5FDZ A;  5G04 B;  5HLS A;  5E9M A;  4A9O A;  5A7C A;  2LDR A;  2YHO A;  4UIY A;  5F60 A;  4A9E A;  2YEM A;  4OUF A;  5AME A;  2L43 A;  5D3N A;  5LKX A;  5G0F A;  5EWD A;  1U6G B;  4QSP A;  4W4U A;  3EB5 A;  4HXP A;  4FLP A;  5EIC A;  2KE1 A;  2LXH C;  4CUS A;  5HQ5 A;  4J3I A;  5E7D A;  2KFT A;  4O74 A;  4HBV A;  2DX8 A;  3MQM A;  4WHU A;  5A5O A;  4QEW A;  2YW5 A;  4CUR A;  3SHB A;  5C13 A;  4LZR A;  4NQM A;  4QBM A;  5EVA A;  2KR4 A;  5EGU A;  4GB0 A;  2F6J A;  4IR6 A;  1MM2 A;  4GNF A;  5F1L A;  4MEN A;  5E0R A;  5E3D A;  2BAY A;  2LN0 A;  5F63 A;  4NR6 A;  1V87 A;  5EPB A;  3U5L A;  4IC3 A;  3MUK A;  4LYI A;  3ZYU A;  4J1P A;  4XUA A;  2DWW A;  3GL6 A;  4HXL A;  5TBN A;  2I50 A;  5B78 A;  5G4R A;  5EYA F;  5ENG A;  2ECV A;  5C11 A;  4CUP A;  4Z1S A;  2KWJ A;  3L1Z B;  1VFY A;  5CUC A;  5TRB A;  4BBQ A;  4O7F A;  5FG4 A;  4CFK A;  5IID A;  4LR6 A;  3PUQ A;  5FER A;  5FE9 A;  2HYE D;  2KWN A;  5DYU A;  5CS8 A;  5H1V A;  4WA6 A;  4IC2 A;  3MB3 A;  4DON A;  4GNE A;  5KU3 A;  4YYH A;  5I89 A;  4UIV A;  4QC1 A;  2YDW A;  3QZV A;  3G0L A;  5I1Q A;  5KHM A;  1K2F A;  3HCU A;  3N9O A;  5CUG A;  5TCM A;  5C85 A;  5I40 A;  2I7K A;  4WIV A;  1FBV A;  5D3H A;  3MHH A;  3EB6 A;  2D82 A;  5JI8 A;  2C2L A;  3C5K A;  5EQ1 A;  5FFW A;  2CSY A;  2EGP A;  5B75 A;  3KV5 A;  5A82 A;  1WEN A;  5ENC A;  3SOW A;  4PKL A;  5LJ1 A;  1RMD A;  1BOR A;  5HEM A;  5A5S A;  2D8S A;  1HYI A;  3D7C A;  4TT6 A;  2FSA A;  4LLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...