2RI7A

Crystal structure of phd finger-linker-bromodomain y17e mutant from human bptf in the h3(1-9)k4me2 bound state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
168
structure length
168
Chain Sequence
TKLYCICKTPEDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
molecule keywords Nucleosome-remodeling factor subunit BPTF
total genus 58
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2ri7A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ri7A01
4UIUA 3ZYQA 5CGPA 5I83A 5DFDA 2VPGA 2HYED 3NG2A 2KR4A 1VFYA 4YBSA 4QSPA 5CY9A 5FG5A 5B79A 4UYEA 3MB4A 2OUOA 4HXSA 4J0RA 4QEVA 5CTLA 5I86A 4LRGA 4QSVA 3V43A 5EWVA 5CRZA 5HLSA 2YSJA 4ZDTA 2ECVA 2D9EA 4YADA 2R0YA 5H1TA 5TB6A 5JWMA 4O64A 4FJCA 5I80A 5TCMA 5J0DA 2C2VS 2DVRA 2YT5A 3L11A 3FKMX 5HJCA 5HQ7A 2MD8C 1U6GB 2PUYA 2L80A 5HRWA 5D3NA 4N4IA 4QYLA 4A9KA 3FL2A 4W4UA 2RO1A 4UIXA 2DWWA 2G45A 2H0DB 4MEOA 3UVDA 2DX8A 3P5OA 4PCIA 4YBTA 1T1HA 1WESA 2LRIC 4FK5A 3JVJA 2KREA 3P1DA 4YC9A 5D1LB 5G4RA 5B77A 4O7AA 2KU3A 2HDPA 2VJEB 5DYUA 4LKAA 5LKTA 4O78A 2M3HA 5E9YA 4PKLA 3T7LA 3G0JA 2YSMA 5K29A 2YUCA 2L5EA 4IR6A 5H9MA 4NR4A 4O76A 2KTBB 4Q6FA 5LVQA 4IR5A 2L43A 2DVQA 2LXPC 2IDAA 2YDWA 2ECGA 4MEPA 3DWYA 5IIDA 5ENEA 5D24A 4NUDA 5F3AA 2KIZA 4BBQA 1ZS5A 4XY8A 5EPSA 3M62A 3SVGA 5FE4A 3I2DA 5CQAA 5HCLA 4GNEA 5EQ1A 5FH7A 3MHHA 4O77A 3ZVYA 5ENIA 4LZ2A 2E6SA 4MENA 5A5PA 5A5SA 2AN6A 4P5OB 2DVSA 4NXJA 2VPBA 4YYMA 4WIVA 5G04B 4QEUA 4UIYA 3O36A 3HMEA 4BW2A 5CQ5A 5LKXA 2BAYA 2LQ6A 2Y1MA 5AD3A 2CSYA 5FBXA 4BHWA 2PNXA 3HMFA 2Y1NA 3SOWA 2RS9B 4A9LA 4QR3A 4TKPB 5FH6A 4HXPA 4A9FA 2LXHC 4O7EA 4CURA 2LGGA 3S92A 3U5JA 2R0VA 4Z6HA 4UIVA 3UVXA 4O74A 1X0JA 1LDJB 5IGKA 5DY7A 2VP7A 4QF2A 5FEYA 4CCGX 5A5OA 2YYNA 4J1PA 5D7XA 4B86C 3T6RA 5FE0A 5KH9A 4YBMA 4CUUA 4PY6A 1Z6UA 5TABA 3PURA 5F2PA 4UYFB 5ENGA 5HM0A 5L99A 3SVHA 5CQ8A 4YY6A 4CL9A 3M63A 4QR4A 2Y43A 5TBNA 4PCEA 4NUCA 4KV4A 3P1EA 4A0CD 4YYIA 4LLBA 4IORA 4WHUA 4XI1A 2QJ0A 3L1XA 3UV2A 5B75A 1K2FA 3NXBA 4I7BA 3C5KA 4QSXA 4QY4A 2L5UA 2EA6A 4J0SA 4HXNA 4AVXA 4QSTA 2G6QA 4C67A 1ZBDB 5D0CA 3JVLA 2D82A 4MR3A 4X2IA 4ALGA 4WZ3B 2ECIA 2YW8A 5BT4A 4O75A 2C2LA 2M6MA 3HMHA 5C13A 2YHOA 5ENHA 5E9VA 5HQ6A 3N9MA 5A82A 5KTXA 4GPJA 4QZSA 4BW4A 1F68A 4OGIA 2MA6A 3C6WA 4ZUXU 5L8TA 2FSAA 4GB0A 4N3WA 2KGGA 5HRVA 2L75A 4LC2A 3TLPA 4YABA 2K1JA 3VK6A 2MD7B 3Q2EA 2KFTA 3KV6A 3ONIA 2R10A 3ZNIA 3KNVA 1JM7A 5DW2A 1MM2A 4HBXA 5D3HA 5D26A 2H0DA 5FFVA 3MB3A 4V3KC 3LQIA 5D3JA 3I3JA 4N4GA 5G05B 3UVYA 5E3GA 5FE5A 4NRCA 5AMEA 4HXKA 5AMFA 3N9QA 4NQNA 2ECWA 4O70A 3LQHA 3SVFA 3M99A 4YAXA 4CUSA 4QSUA 5CQ6A 1JSPB 1Z60A 4QF3A 5TDRA 5CS8A 4KCXA 3O70A 4FLPA 3O35A 4XUAA 5H85A 4O7CA 5FE1A 2YREA 5D3TA 5EA1A 5HRXA 1RMDA 4QYDA 4R7EA 1N72A 2ECTA 2QICA 5HQ5A 3UV4A 2VPEA 4IR4A 1X4JA 4XUBA 3O7AA 4HBVA 5DX4A 1G25A 5L96A 4OGJA 5E9MA 1WILA 2YYRA 5EWDA 5AIUA 1WUMA 2OXQC 4R8PK 2WP1A 4WZ0A 4NYXA 5C87A 5JI8A 5EP7A 5IBNA 5KH3A 4QR5A 2DKWA 3LRQA 1FP0A 2YEKA 3O34A 3U5MA 5A5NA 1BORA 4UITA 4YATA 3HCUA 2YU4A 2H60A 5FB0A 3DAIA 5F61A 3U5PA 4Z1SA 3SHBA 3LQJA 5TDWA 4TT4A 4UYDA 1F62A 4YH3A 3JVKA 5FE9A 2RNYA 4TYLA 4Z6IA 2KE1A 4XYAA 5LUUA 2GRCA 4YY4A 2I8NA 2YHNA 4IC3A 4CA1A 1VYXA 5DFBA 5HENA 5TRBA 2JMDA 4XY9A 3N9LA 4LK9A 4AP4A 3S91A 2MJVB 2RFJA 4WZ2A 2VNFA 5FDZA 4NQMA 5BT3A 4LDFA 3U5NA 1LDKC 1WIMA 4FO9A 2F42A 5D3SA 5CQ7A 5L98A 4AUQB 1WEQA 5DKAA 5EGUA 4A9EA 3DPLR 5ENFA 4HBWA 5KU3A 2YEMA 5FE3A 4O7FA 5FE7A 2CKLA 4MR5A 2UZGA 5F25A 5KH7A 2YQLA 4A9MA 5EM3A 5AD2A 4O7BA 3ASLA 5D3LA 5E0RA 5J3XA 4AYCB 2LGKA 4A9HA 4GNDA 4MVTA 2M1RA 5F63A 3N9NA 3LJWA 4ZC9A 4MEQA 5ENJA 4Q0NA 5FB1A 4A49A 4I7CA 2YW5A 3JVMA 5E7DA 5CUAA 5FH8A 3U5OA 4MSXA 4X3GA 4HXOA 5D25A 5DYXA 5FE6A 3RTRB 5EWCA 4NR6A 2N9GA 2OO1A 5C85A 4E96A 5IGMA 5L97A 2M85A 4CFLA 5F36A 5CQTA 5DYAA 5I29A 2EODA 5F60A 4N4FA 5DLXA 1WEPA 3G0LA 3QZSA 5EISA 4ALHA 4NR5A 5C7NA 4QSWA 5EWHA 5DW1A 5ENCA 4NN2A 5CUCA 1E6IA 4A9NA 2FUUA 3ZVZB 3UVWA 5EWWA 2K4DA 4PTBA 5CFWA 4Z1QA 5D1KB 5EK9A 4WHWA 1XWHA 4LYIA 2YURA 2KWOA 4YH4A 1WEMA 5FERA 5KO4A 1WGMA 2MUMA 4LZRA 3AADA 5DKDA 5DKHA 1WEUA 4GNGA 2LSPB 3P1CA 5C11A 4QNSA 2K16A 5KTWA 2MNYA 4V3LC 4OUFA 5G4SA 4YYNA 5C4QA 4S3OB 5FFYA 4F52B 3LXJA 2LGLA 2DVVA 2F6JA 4QB3A 4YYKA 3GV4A 1WENA 5FG4A 4A9OA 5E73A 5B8DA 5C8GA 5F62A 4TT6A 5LJ2A 5G0FA 4TT2A 5H1VA 4QC1A 1X4IA 5HFQA 2QIZA 5I1QA 5II2A 2YQMA 4DONA 5CQ4A 3QZTA 5HEMA 1IYMA 5HFRA 2KWJA 3HCTA 4QEWA 4FIPA 2L84A 5A85A 5I89A 4TQNA 2JRJA 1WEVA 1WEWA 1DVPA 3UW9A 5EICA 2OSSA 3O33A 5LKZA 3ZYUA 1WFKA 5DFCA 2F6NA 5FE2A 3GL6A 3GG3A 4TU4A 5ETBA 4NR8A 5IGNA 2CT2A 4HXRA 5I3LA 4NRAA 2E3KA 5F5ZA 4NR9A 5IGLA 3EB6A 5ETDA 1HYJA 5EV9A 5KHMA 4UI9B 4QUTA 5A5QA 5EI4A 4NRBA 5DYCA 4NS5A 1WE9A 4BW1A 5I40A 3L1ZB 3Q2FA 4UP0A 5KTUA 4WA6A 4NR7A 4ZQLA 3N9PA 3KV5A 3ZPV1 2RI7A 4PS5A 4CLBA 5L8UA 5E9KA 4IOOA 4A4BA 4TU6A 4CUPA 5LJ0A 5II1A 3IU5A 2RNWA 5LKUA 5CP5A 1WUGA 4QUUA 4L7XA 5CZGA 2WP2A 4TZ8A 5COIA 5EPBA 4CFKA 3MHSA 1JM7B 3RPGB 2RNXA 2NXBA 5FG6A 2LV9A 1MM3A 4LYSA 5FE8A 3K2JA 3MQMA 2E7OA 2KWKA 4QSQA 5A83A 5I88A 2I50A 4BJXA 2KGIA 5LVRA 2LDRA 2KWNA 3MXFA 3ZPVE 2L0BA 5FFWA 4L58A 4YK0A 4A9IA 1V87A 2LN0A 4S3OC 4MR4A 5I7YA 4NYWA 1X4UA 4TS8A 5EVAA 2FUIA 2MNZA 5E9IA 2VJFA 2VPDA 4Y03A 2CSZA 1Z2QA 5DBMA 4B7YC 5D3PA 3MULA 5DINA 3P1FA 3MUKA 4C9ZA 3D7CA 2VJEA 2MIQA 5CUGA 2D8SA 4F3IA 4TZ2A 4BW3A 5CRMA 5HELA 2E6RA 5EU1A 5ACYA 3SOXA 4NYVA 2E7NA 4QC3A 3HCSA 4A9JA 4A4CA 4C66A 3RCWA 2MT5A 5LJ1A 4TTEA 4CUQA 2JMIA 5F1LA 2G43A 4IOQA 4LR6A 4Z93A 5CU8A 4J3IA 2ECNA 4R2YA 2K17A 2YQDA 4AYCA 4GNFA 3EB5A 4YYJA 4O72A 2G4AA 3U5LA 5BT5A 1N87A 2CKLB 4UP5A 1WEEA 2EGPA 4IR3A 2XB1A 2YELA 4HXMA 2VJFB 5E3DA 5B76A 4LYWA 5IG6A 3O37A 2RSDA 5A5RA 4N4HA 5F1HA 4AKNA 4Q0OA 5CUEA 4YYDA 1JOCA 2NAAA 3PHDA 5CUDA 2MA5A 2DATA 4CUTA 3SOUA 3IHPA 5A7CA 5E9LA 3IU6A 3U5KA 5CPEA 5EPRA 4PPEA 5EYAF 2JMJA 5JG6A 4QSSA 1FBVA 1E4UA 4I7DA 3ZTGA 4KV1A 5E74A 2XEUA 2R0SA 5C89A 4LZSA 4NUEA 2ZETC 4HXLA 4QBMA 4RVRA 5A81A 5LCWB 3N9OA 3RPGC 4HBYA 5AITA 5B78A 5D1MB 1JM4B 1EQFA 4UIZA 1VD4A 2L85A 3UV5A 2I7KA 5D3RA 5DKCA 4UIWA 4LJNA 3PUQA 3QZVA 3DQVR 4UYHA 4LADB 5ENBA 1CHCA 3KQIA 4O71A 5CQ3A 4IC2A 5CUBA 3AQAA 4UYGA 4YYGA 5DLZA 4YYHA 5H1UA 2KYUA 5I7XA 4QSRA 1HYIA 2LGVA 4UYFA 1WEOA 4ZW1A 2ECJA 4MR6A 3HTKC
chains in the Genus database with same CATH superfamily
4UIUA 3ZYQA 5CGPA 5I83A 5DFDA 2VPGA 2HYED 3NG2A 2KR4A 1VFYA 4YBSA 3SUBA 4QSPA 5CY9A 5FG5A 5B79A 4UYEA 3MB4A 2OUOA 4HXSA 4J0RA 4QEVA 5CTLA 5I86A 4LRGA 4QSVA 3FAOA 5EWVA 3V43A 5CRZA 5HLSA 2YSJA 4ZDTA 2ECVA 2D9EA 4YADA 2R0YA 5H1TA 5TB6A 5JWMA 4O64A 4FJCA 5I80A 3T9KA 5TCMA 5J0DA 2C2VS 2DVRA 2YT5A 3L11A 3FKMX 5HJCA 5HQ7A 4OGEA 2MD8C 1U6GB 2PUYA 2L80A 3DDTA 5HRWA 5D3NA 4N4IA 4QYLA 4A9KA 3FL2A 3FM8C 4W4UA 2RO1A 4UIXA 2DWWA 2FFWA 2G45A 2H0DB 4MEOA 3UVDA 2DX8A 3P5OA 4PCIA 2XOYA 4YBTA 1T1HA 1WESA 2LRIC 4FK5A 3JVJA 2KREA 3P1DA 4YC9A 5D1LB 5G4RA 5B77A 4O7AA 2DSMA 2KU3A 2HDPA 2VJEB 5DYUA 4LKAA 5LKTA 4O78A 2M3HA 5E9YA 4PKLA 3T7LA 3G0JA 5K3QA 2YSMA 5K29A 2YUCA 4F1PA 2L5EA 4IR6A 5H9MA 4NR4A 4O76A 2KTBB 4Q6FA 5LVQA 4IR5A 4AI6A 2L43A 2DVQA 5SVYA 2LXPC 2IDAA 2YDWA 2ECGA 4MEPA 3DWYA 5IIDA 5ENEA 5D24A 3MDBC 4NUDA 5F3AA 2KIZA 4BBQA 1ZS5A 4XY8A 5EPSA 3M62A 3SVGA 5FE4A 3I2DA 5CQAA 2IQJA 5HCLA 4GNEA 5EQ1A 5FH7A 3MHHA 4O77A 3ZVYA 5ENIA 4LZ2A 2E6SA 4MENA 5A5PA 5A5SA 2AN6A 4P5OB 2DVSA 4NXJA 2VPBA 4YYMA 4WIVA 5G04B 4QEUA 4UIYA 3O36A 3HMEA 4BW2A 5CQ5A 5LKXA 2BAYA 2LQ6A 2Y1MA 5AD3A 2CSYA 5FBXA 4BHWA 1DCQA 2LAUA 2PNXA 3HMFA 2Y1NA 3SOWA 2RS9B 4A9LA 4QR3A 4TKPB 5FH6A 4HXPA 4A9FA 2LXHC 4O7EA 3PLWA 3H7HA 4CURA 2LGGA 3S92A 3VKHA 3U5JA 4QQ4A 2R0VA 4Z6HA 4UIVA 3UVXA 4O74A 1X0JA 1LDJB 5IGKA 5DY7A 2VP7A 4QF2A 5FEYA 4CCGX 5A5OA 2YYNA 4J1PA 5D7XA 4B86C 3T6RA 5FE0A 5KH9A 4YBMA 4CUUA 4PY6A 1Z6UA 5TABA 3PURA 5F2PA 4UYFB 5ENGA 5HM0A 5L99A 3SVHA 5CQ8A 4YY6A 4CL9A 3M63A 4QR4A 2Y43A 5TBNA 4PCEA 3DWDA 4NUCA 4KV4A 3P1EA 4A0CD 4YYIA 4LLBA 4IORA 4WHUA 4XI1A 2QJ0A 3L1XA 3UV2A 5B75A 1K2FA 3NXBA 4I7BA 3C5KA 4QSXA 4QY4A 2L5UA 2EA6A 4J0SA 4HXNA 4AVXA 4QSTA 2G6QA 4C67A 3LVQE 1ZBDB 5D0CA 2JM3A 3JVLA 2D82A 4MR3A 4X2IA 4ALGA 4AKGA 4WZ3B 2ECIA 2YW8A 5BT4A 4O75A 2C2LA 2M6MA 3HMHA 5C13A 2YHOA 5ENHA 3M7KA 5E9VA 5HQ6A 3N9MA 2XOCA 5A82A 5KTXA 2YVRA 2RR4A 4GPJA 4QZSA 4BW4A 1F68A 4OGIA 2MA6A 3C6WA 4ZUXU 5L8TA 2FSAA 4GB0A 4N3WA 2KGGA 5HRVA 2L75A 4LC2A 3TLPA 4YABA 2K1JA 3VK6A 2MD7B 3Q2EA 2KFTA 3KV6A 3ONIA 2R10A 3ZNIA 3KNVA 5SVIB 1JM7A 5DW2A 1MM2A 4HBXA 5D3HA 5D26A 2H0DA 5FFVA 3MB3A 4V3KC 3LQIA 5D3JA 3I3JA 2P57A 4N4GA 5G05B 3UVYA 5E3GA 5FE5A 4NRCA 5AMEA 4HXKA 5AMFA 3N9QA 4NQNA 2ECWA 4O70A 3LQHA 3SVFA 3M99A 4YAXA 4CUSA 4QSUA 5CQ6A 5SVXA 1JSPB 1Z60A 3E2DA 4QF3A 5TDRA 5CS8A 4KCXA 3O47A 3O70A 4FLPA 2EXUA 3O35A 4XUAA 5H85A 4O7CA 5FE1A 2YREA 5D3TA 5EA1A 2FD4A 5HRXA 1RMDA 4QYDA 4R7EA 1N72A 2ECTA 2QICA 5HQ5A 2B0OE 3UV4A 2VPEA 4IR4A 1X4JA 4XUBA 3O7AA 4HBVA 5DX4A 1G25A 5L96A 4OGJA 5E9MA 1WILA 2YYRA 5EWDA 5AIUA 1WUMA 2OXQC 4R8PK 2WP1A 4WZ0A 4NYXA 5C87A 2CRWA 5JI8A 5EP7A 2CONA 5IBNA 5KH3A 3FEHA 4QR5A 2DKWA 3LRQA 1FP0A 2YEKA 3O34A 3U5MA 5A5NA 1BORA 4UITA 4YATA 3HCUA 2YU4A 2H60A 5FB0A 3DAIA 5F61A 3U5PA 4Z1SA 3SHBA 3LQJA 5TDWA 4TT4A 4UYDA 1F62A 4YH3A 3JVKA 5FE9A 2RNYA 4TYLA 4Z6IA 1MBMA 2KE1A 4XYAA 5LUUA 2GRCA 4YY4A 2I8NA 2YHNA 4IC3A 4CA1A 1VYXA 4H9DA 5DFBA 5HENA 5TRBA 2JMDA 4XY9A 3N9LA 4LK9A 4AP4A 3S91A 3D1BA 2MJVB 2RFJA 4WZ2A 2VNFA 5FDZA 4NQMA 5BT3A 4LDFA 3U5NA 1LDKC 1WIMA 3JUEA 2XP0A 4FO9A 4O62A 2F42A 5D3SA 5CQ7A 5L98A 4AUQB 1WEQA 5DKAA 5EGUA 4A9EA 3DPLR 5ENFA 4HBWA 5KU3A 2YEMA 5FE3A 4O7FA 5FE7A 2CKLA 4MR5A 2UZGA 5F25A 5KH7A 2YQLA 4A9MA 5EM3A 5AD2A 4O7BA 3ASLA 5D3LA 5E0RA 5J3XA 4AYCB 2LGKA 4A9HA 4GNDA 4MVTA 2M1RA 5F63A 3N9NA 3LJWA 4ZC9A 4MEQA 3FANA 5ENJA 4Q0NA 5FB1A 2EGMA 4I7CA 2YW5A 4A49A 3JVMA 2D8UA 5E7DA 5CUAA 5FH8A 3U5OA 2CSVA 2KKYA 4HXOA 5D25A 5DYXA 5FE6A 4MSXA 4X3GA 5EWCA 3RTRB 4NR6A 2N9GA 2OO1A 5C85A 2XOZA 5SVIA 4E96A 5IGMA 5L97A 2M85A 4CFLA 5F36A 5CQTA 5DYAA 5I29A 2EODA 5F60A 4N4FA 2CRRA 5DLXA 1WEPA 3G0LA 3QZSA 5EISA 4ALHA 1ZKRA 4NR5A 4QSWA 5EWHA 5DW1A 5ENCA 5C7NA 4NN2A 5CUCA 1E6IA 4A9NA 2FUUA 3ZVZB 3UVWA 5EWWA 2K4DA 4PTBA 5CFWA 4Z1QA 5D1KB 5EK9A 4WHWA 1XWHA 4LYIA 2YURA 2KWOA 4YH4A 1WEMA 5FERA 5KO4A 1WGMA 2MUMA 4LZRA 3AADA 5DKDA 5DKHA 1WEUA 4GNGA 2LSPB 3P1CA 5C11A 4QNSA 2K16A 4AKIA 5KTWA 2MNYA 4V3LC 4OUFA 5G4SA 4YYNA 5C4QA 4S3OB 5FFYA 4F52B 3LXJA 2LGLA 2DVVA 2F6JA 4QB3A 4YYKA 3GV4A 1WENA 5FG4A 4A9OA 5E73A 5B8DA 5C8GA 5F62A 4TT6A 5LJ2A 5G0FA 4TT2A 5H1VA 4QC1A 1X4IA 2DJAA 5HFQA 2QIZA 5I1QA 5II2A 2YQMA 4DONA 4AKHA 5CQ4A 3QZTA 5HEMA 1IYMA 5HFRA 2KWJA 3HCTA 4QEWA 4FIPA 2L84A 5A85A 5I89A 4TQNA 2JRJA 1WEVA 2JUNA 1WEWA 1DVPA 3UW9A 5EICA 2OSSA 3O33A 5LKZA 3ZYUA 1WFKA 5DFCA 2F6NA 5FE2A 3GL6A 3GG3A 4TU4A 5ETBA 4NR8A 5IGNA 2CT2A 2L7PA 4HXRA 5I3LA 4NRAA 2E3KA 5F5ZA 4NR9A 5IGLA 3EB6A 5ETDA 1HYJA 5EV9A 5KHMA 4UI9B 4QUTA 5A5QA 5EI4A 4NRBA 5DYCA 4NS5A 1WE9A 4BW1A 5I40A 3L1ZB 3Q2FA 4UP0A 5KTUA 4WA6A 4NR7A 4ZQLA 3N9PA 3KV5A 3ZPV1 2RI7A 4PS5A 4CLBA 4OGCA 4Z0RA 5L8UA 5E9KA 4IOOA 4A4BA 3ERRA 4TU6A 4CUPA 5LJ0A 5II1A 3IU5A 2RNWA 5LKUA 5CP5A 1WUGA 4QUUA 4L7XA 5CZGA 2WP2A 4TZ8A 5COIA 5EPBA 4CFKA 3MHSA 1JM7B 2E61A 3RPGB 2RNXA 2NXBA 5FG6A 2LV9A 2KKXA 1MM3A 4LYSA 5FE8A 3K2JA 3MQMA 2E7OA 2KWKA 4QSQA 5A83A 5I88A 2I50A 4BJXA 2KGIA 5LVRA 2LDRA 2KWNA 3MXFA 3FJUB 3ZPVE 2L0BA 5FFWA 4L58A 4YK0A 4A9IA 1V87A 2LN0A 4S3OC 4MR4A 5I7YA 4NYWA 1X4UA 3LVRE 4TS8A 5EVAA 2FUIA 2MNZA 5E9IA 2VJFA 2VPDA 4Y03A 2CSZA 1Z2QA 5DBMA 4B7YC 5D3PA 3MULA 5DINA 3P1FA 3MUKA 2MKEA 3D7CA 2VJEA 1PUOA 2MIQA 4C9ZA 5CUGA 2D8SA 4F3IA 4TZ2A 4BW3A 5CRMA 5HELA 2E6RA 5EU1A 4Z0OA 5ACYA 3SOXA 4NYVA 2E7NA 4QC3A 3HCSA 4A9JA 4A4CA 4C66A 3RCWA 2MT5A 2EJNA 2M13A 5LJ1A 4TTEA 4CUQA 2JMIA 5F1LA 2G43A 4IOQA 4LR6A 4Z93A 5CU8A 4J3IA 2ECNA 4R2YA 2K17A 2YQDA 4AYCA 4GNFA 3EB5A 4YYJA 4O72A 2G4AA 3U5LA 5BT5A 3KDEC 1N87A 2CKLB 4UP5A 1WEEA 2EGPA 4IR3A 2XB1A 2YELA 4HXMA 2VJFB 5E3DA 5B76A 3VKGA 3LDYA 4LYWA 5IG6A 3O37A 2RSDA 5A5RA 4N4HA 5F1HA 4AKNA 4Q0OA 5CUEA 4YYDA 1JOCA 2NAAA 3PHDA 5CUDA 2MA5A 2DATA 4CUTA 3SOUA 3IHPA 5A7CA 5E9LA 3IU6A 3U5KA 5CPEA 5EPRA 4PPEA 5EYAF 2JMJA 5JG6A 4QSSA 1FBVA 1E4UA 4I7DA 3ZTGA 4KV1A 5E74A 2XEUA 2R0SA 5C89A 4LZSA 4NUEA 2ZETC 4HXLA 4QBMA 4RVRA 5A81A 5LCWB 3N9OA 3RPGC 4HBYA 5AITA 5B78A 5D1MB 1JM4B 1EQFA 4UIZA 1VD4A 2L85A 3UV5A 2I7KA 5D3RA 5DKCA 3Q1DA 4UIWA 3LJUX 4LJNA 3PUQA 3QZVA 2OWAA 4UYHA 3DQVR 4LADB 5ENBA 1CHCA 3KQIA 4O71A 5CQ3A 4IC2A 5CUBA 3AQAA 4UYGA 4YYGA 5DLZA 4YYHA 5H1UA 2KYUA 5I7XA 4QSRA 1HYIA 2LGVA 4UYFA 1WEOA 4ZW1A 2ECJA 4MR6A 3D1DA 3HTKC
chains in the Genus database with same CATH topology
4UIUA 3ZYQA 5CGPA 5I83A 5DFDA 2VPGA 2HYED 3NG2A 2KR4A 1VFYA 4YBSA 4QSPA 5CY9A 5FG5A 5B79A 4UYEA 3MB4A 2OUOA 4HXSA 4J0RA 4QEVA 5CTLA 5I86A 4LRGA 4QSVA 3V43A 5EWVA 5CRZA 5HLSA 2YSJA 4ZDTA 2ECVA 2D9EA 4YADA 2R0YA 5H1TA 5TB6A 5JWMA 4O64A 4FJCA 5I80A 5TCMA 5J0DA 2C2VS 2DVRA 2YT5A 3L11A 3FKMX 5HJCA 5HQ7A 2MD8C 1U6GB 2PUYA 2L80A 5HRWA 5D3NA 4N4IA 4QYLA 4A9KA 3FL2A 4W4UA 2RO1A 4UIXA 2DWWA 2G45A 2H0DB 4MEOA 3UVDA 2DX8A 3P5OA 4PCIA 4YBTA 1T1HA 1WESA 2LRIC 4FK5A 3JVJA 2KREA 3P1DA 4YC9A 5D1LB 5G4RA 5B77A 4O7AA 2KU3A 2HDPA 2VJEB 5DYUA 4LKAA 5LKTA 4O78A 2M3HA 5E9YA 4PKLA 3T7LA 3G0JA 2YSMA 5K29A 2YUCA 2L5EA 4IR6A 5H9MA 4NR4A 4O76A 2KTBB 4Q6FA 5LVQA 4IR5A 2L43A 2DVQA 2LXPC 2IDAA 2YDWA 2ECGA 4MEPA 3DWYA 5IIDA 5ENEA 5D24A 4NUDA 5F3AA 2KIZA 4BBQA 1ZS5A 4XY8A 5EPSA 3M62A 3SVGA 5FE4A 3I2DA 5CQAA 5HCLA 4GNEA 5EQ1A 5FH7A 3MHHA 4O77A 3ZVYA 5ENIA 4LZ2A 2E6SA 4MENA 5A5PA 5A5SA 2AN6A 4P5OB 2DVSA 4NXJA 2VPBA 4YYMA 4WIVA 5G04B 4QEUA 4UIYA 3O36A 3HMEA 4BW2A 5CQ5A 5LKXA 2BAYA 2LQ6A 2Y1MA 5AD3A 2CSYA 5FBXA 4BHWA 2PNXA 3HMFA 2Y1NA 3SOWA 2RS9B 4A9LA 4QR3A 4TKPB 5FH6A 4HXPA 4A9FA 2LXHC 4O7EA 4CURA 2LGGA 3S92A 3U5JA 2R0VA 4Z6HA 4UIVA 3UVXA 4O74A 1X0JA 1LDJB 5IGKA 5DY7A 2VP7A 4QF2A 5FEYA 4CCGX 5A5OA 2YYNA 4J1PA 5D7XA 4B86C 3T6RA 5FE0A 5KH9A 4YBMA 4CUUA 4PY6A 1Z6UA 5TABA 3PURA 5F2PA 4UYFB 5ENGA 5HM0A 5L99A 3SVHA 5CQ8A 4YY6A 4CL9A 3M63A 4QR4A 2Y43A 5TBNA 4PCEA 4NUCA 4KV4A 3P1EA 4A0CD 4YYIA 4LLBA 4IORA 4WHUA 4XI1A 2QJ0A 3L1XA 3UV2A 5B75A 1K2FA 3NXBA 4I7BA 3C5KA 4QSXA 4QY4A 2L5UA 2EA6A 4J0SA 4HXNA 4AVXA 4QSTA 2G6QA 4C67A 1ZBDB 5D0CA 3JVLA 2D82A 4MR3A 4X2IA 4ALGA 4WZ3B 2ECIA 2YW8A 5BT4A 4O75A 2C2LA 2M6MA 3HMHA 5C13A 2YHOA 5ENHA 5E9VA 5HQ6A 3N9MA 5A82A 5KTXA 4GPJA 4QZSA 4BW4A 1F68A 4OGIA 2MA6A 3C6WA 4ZUXU 5L8TA 2FSAA 4GB0A 4N3WA 2KGGA 5HRVA 2L75A 4LC2A 3TLPA 4YABA 2K1JA 3VK6A 2MD7B 3Q2EA 2KFTA 3KV6A 3ONIA 2R10A 3ZNIA 3KNVA 1JM7A 5DW2A 1MM2A 4HBXA 5D3HA 5D26A 2H0DA 5FFVA 3MB3A 4V3KC 3LQIA 5D3JA 3I3JA 4N4GA 5G05B 3UVYA 5E3GA 5FE5A 4NRCA 5AMEA 4HXKA 5AMFA 3N9QA 4NQNA 2ECWA 4O70A 3LQHA 3SVFA 3M99A 4YAXA 4CUSA 4QSUA 5CQ6A 1JSPB 1Z60A 4QF3A 5TDRA 5CS8A 4KCXA 3O70A 4FLPA 3O35A 4XUAA 5H85A 4O7CA 5FE1A 2YREA 5D3TA 5EA1A 5HRXA 1RMDA 4QYDA 4R7EA 1N72A 2ECTA 2QICA 5HQ5A 3UV4A 2VPEA 4IR4A 1X4JA 4XUBA 3O7AA 4HBVA 5DX4A 1G25A 5L96A 4OGJA 5E9MA 1WILA 2YYRA 5EWDA 5AIUA 1WUMA 2OXQC 4R8PK 2WP1A 4WZ0A 4NYXA 5C87A 5JI8A 5EP7A 5IBNA 5KH3A 4QR5A 2DKWA 3LRQA 1FP0A 2YEKA 3O34A 3U5MA 5A5NA 1BORA 4UITA 4YATA 3HCUA 2YU4A 2H60A 5FB0A 3DAIA 5F61A 3U5PA 4Z1SA 3SHBA 3LQJA 5TDWA 4TT4A 4UYDA 1F62A 4YH3A 3JVKA 5FE9A 2RNYA 4TYLA 4Z6IA 2KE1A 4XYAA 5LUUA 2GRCA 4YY4A 2I8NA 2YHNA 4IC3A 4CA1A 1VYXA 5DFBA 5HENA 5TRBA 2JMDA 4XY9A 3N9LA 4LK9A 4AP4A 3S91A 2MJVB 2RFJA 4WZ2A 2VNFA 5FDZA 4NQMA 5BT3A 4LDFA 3U5NA 1LDKC 1WIMA 4FO9A 2F42A 5D3SA 5CQ7A 5L98A 4AUQB 1WEQA 5DKAA 5EGUA 4A9EA 3DPLR 5ENFA 4HBWA 5KU3A 2YEMA 5FE3A 4O7FA 5FE7A 2CKLA 4MR5A 2UZGA 5F25A 5KH7A 2YQLA 4A9MA 5EM3A 5AD2A 4O7BA 3ASLA 5D3LA 5E0RA 5J3XA 4AYCB 2LGKA 4A9HA 4GNDA 4MVTA 2M1RA 5F63A 3N9NA 3LJWA 4ZC9A 4MEQA 5ENJA 4Q0NA 5FB1A 4A49A 4I7CA 2YW5A 3JVMA 5E7DA 5CUAA 5FH8A 3U5OA 4MSXA 4X3GA 4HXOA 5D25A 5DYXA 5FE6A 3RTRB 5EWCA 4NR6A 2N9GA 2OO1A 5C85A 4E96A 5IGMA 5L97A 2M85A 4CFLA 5F36A 5CQTA 5DYAA 5I29A 2EODA 5F60A 4N4FA 5DLXA 1WEPA 3G0LA 3QZSA 5EISA 4ALHA 4NR5A 5C7NA 4QSWA 5EWHA 5DW1A 5ENCA 4NN2A 5CUCA 1E6IA 4A9NA 2FUUA 3ZVZB 3UVWA 5EWWA 2K4DA 4PTBA 5CFWA 4Z1QA 5D1KB 5EK9A 4WHWA 1XWHA 4LYIA 2YURA 2KWOA 4YH4A 1WEMA 5FERA 5KO4A 1WGMA 2MUMA 4LZRA 3AADA 5DKDA 5DKHA 1WEUA 4GNGA 2LSPB 3P1CA 5C11A 4QNSA 2K16A 5KTWA 2MNYA 4V3LC 4OUFA 5G4SA 4YYNA 5C4QA 4S3OB 5FFYA 4F52B 3LXJA 2LGLA 2DVVA 2F6JA 4QB3A 4YYKA 3GV4A 1WENA 5FG4A 4A9OA 5E73A 5B8DA 5C8GA 5F62A 4TT6A 5LJ2A 5G0FA 4TT2A 5H1VA 4QC1A 1X4IA 5HFQA 2QIZA 5I1QA 5II2A 2YQMA 4DONA 5CQ4A 3QZTA 5HEMA 1IYMA 5HFRA 2KWJA 3HCTA 4QEWA 4FIPA 2L84A 5A85A 5I89A 4TQNA 2JRJA 1WEVA 1WEWA 1DVPA 3UW9A 5EICA 2OSSA 3O33A 5LKZA 3ZYUA 1WFKA 5DFCA 2F6NA 5FE2A 3GL6A 3GG3A 4TU4A 5ETBA 4NR8A 5IGNA 2CT2A 4HXRA 5I3LA 4NRAA 2E3KA 5F5ZA 4NR9A 5IGLA 3EB6A 5ETDA 1HYJA 5EV9A 5KHMA 4UI9B 4QUTA 5A5QA 5EI4A 4NRBA 5DYCA 4NS5A 1WE9A 4BW1A 5I40A 3L1ZB 3Q2FA 4UP0A 5KTUA 4WA6A 4NR7A 4ZQLA 3N9PA 3KV5A 3ZPV1 2RI7A 4PS5A 4CLBA 5L8UA 5E9KA 4IOOA 4A4BA 4TU6A 4CUPA 5LJ0A 5II1A 3IU5A 2RNWA 5LKUA 5CP5A 1WUGA 4QUUA 4L7XA 5CZGA 2WP2A 4TZ8A 5COIA 5EPBA 4CFKA 3MHSA 1JM7B 3RPGB 2RNXA 2NXBA 5FG6A 2LV9A 1MM3A 4LYSA 5FE8A 3K2JA 3MQMA 2E7OA 2KWKA 4QSQA 5A83A 5I88A 2I50A 4BJXA 2KGIA 5LVRA 2LDRA 2KWNA 3MXFA 3ZPVE 2L0BA 5FFWA 4L58A 4YK0A 4A9IA 1V87A 2LN0A 4S3OC 4MR4A 5I7YA 4NYWA 1X4UA 4TS8A 5EVAA 2FUIA 2MNZA 5E9IA 2VJFA 2VPDA 4Y03A 2CSZA 1Z2QA 5DBMA 4B7YC 5D3PA 3MULA 5DINA 3P1FA 3MUKA 4C9ZA 3D7CA 2VJEA 2MIQA 5CUGA 2D8SA 4F3IA 4TZ2A 4BW3A 5CRMA 5HELA 2E6RA 5EU1A 5ACYA 3SOXA 4NYVA 2E7NA 4QC3A 3HCSA 4A9JA 4A4CA 4C66A 3RCWA 2MT5A 5LJ1A 4TTEA 4CUQA 2JMIA 5F1LA 2G43A 4IOQA 4LR6A 4Z93A 5CU8A 4J3IA 2ECNA 4R2YA 2K17A 2YQDA 4AYCA 4GNFA 3EB5A 4YYJA 4O72A 2G4AA 3U5LA 5BT5A 1N87A 2CKLB 4UP5A 1WEEA 2EGPA 4IR3A 2XB1A 2YELA 4HXMA 2VJFB 5E3DA 5B76A 4LYWA 5IG6A 3O37A 2RSDA 5A5RA 4N4HA 5F1HA 4AKNA 4Q0OA 5CUEA 4YYDA 1JOCA 2NAAA 3PHDA 5CUDA 2MA5A 2DATA 4CUTA 3SOUA 3IHPA 5A7CA 5E9LA 3IU6A 3U5KA 5CPEA 5EPRA 4PPEA 5EYAF 2JMJA 5JG6A 4QSSA 1FBVA 1E4UA 4I7DA 3ZTGA 4KV1A 5E74A 2XEUA 2R0SA 5C89A 4LZSA 4NUEA 2ZETC 4HXLA 4QBMA 4RVRA 5A81A 5LCWB 3N9OA 3RPGC 4HBYA 5AITA 5B78A 5D1MB 1JM4B 1EQFA 4UIZA 1VD4A 2L85A 3UV5A 2I7KA 5D3RA 5DKCA 4UIWA 4LJNA 3PUQA 3QZVA 3DQVR 4UYHA 4LADB 5ENBA 1CHCA 3KQIA 4O71A 5CQ3A 4IC2A 5CUBA 3AQAA 4UYGA 4YYGA 5DLZA 4YYHA 5H1UA 2KYUA 5I7XA 4QSRA 1HYIA 2LGVA 4UYFA 1WEOA 4ZW1A 2ECJA 4MR6A 3HTKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UIU A;  3ZYQ A;  5CGP A;  5I83 A;  5DFD A;  2VPG A;  2HYE D;  3NG2 A;  2KR4 A;  1VFY A;  4YBS A;  4QSP A;  5CY9 A;  5FG5 A;  5B79 A;  4UYE A;  3MB4 A;  2OUO A;  4HXS A;  4J0R A;  4QEV A;  5CTL A;  5I86 A;  4LRG A;  4QSV A;  3V43 A;  5EWV A;  5CRZ A;  5HLS A;  2YSJ A;  4ZDT A;  2ECV A;  2D9E A;  4YAD A;  2R0Y A;  5H1T A;  5TB6 A;  5JWM A;  4O64 A;  4FJC A;  5I80 A;  5TCM A;  5J0D A;  2C2V S;  2DVR A;  2YT5 A;  3L11 A;  3FKM X;  5HJC A;  5HQ7 A;  2MD8 C;  1U6G B;  2PUY A;  2L80 A;  5HRW A;  5D3N A;  4N4I A;  4QYL A;  4A9K A;  3FL2 A;  4W4U A;  2RO1 A;  4UIX A;  2DWW A;  2G45 A;  2H0D B;  4MEO A;  3UVD A;  2DX8 A;  3P5O A;  4PCI A;  4YBT A;  1T1H A;  1WES A;  2LRI C;  4FK5 A;  3JVJ A;  2KRE A;  3P1D A;  4YC9 A;  5D1L B;  5G4R A;  5B77 A;  4O7A A;  2KU3 A;  2HDP A;  2VJE B;  5DYU A;  4LKA A;  5LKT A;  4O78 A;  2M3H A;  5E9Y A;  4PKL A;  3T7L A;  3G0J A;  2YSM A;  5K29 A;  2YUC A;  2L5E A;  4IR6 A;  5H9M A;  4NR4 A;  4O76 A;  2KTB B;  4Q6F A;  5LVQ A;  4IR5 A;  2L43 A;  2DVQ A;  2LXP C;  2IDA A;  2YDW A;  2ECG A;  4MEP A;  3DWY A;  5IID A;  5ENE A;  5D24 A;  4NUD A;  5F3A A;  2KIZ A;  4BBQ A;  1ZS5 A;  4XY8 A;  5EPS A;  3M62 A;  3SVG A;  5FE4 A;  3I2D A;  5CQA A;  5HCL A;  4GNE A;  5EQ1 A;  5FH7 A;  3MHH A;  4O77 A;  3ZVY A;  5ENI A;  4LZ2 A;  2E6S A;  4MEN A;  5A5P A;  5A5S A;  2AN6 A;  4P5O B;  2DVS A;  4NXJ A;  2VPB A;  4YYM A;  4WIV A;  5G04 B;  4QEU A;  4UIY A;  3O36 A;  3HME A;  4BW2 A;  5CQ5 A;  5LKX A;  2BAY A;  2LQ6 A;  2Y1M A;  5AD3 A;  2CSY A;  5FBX A;  4BHW A;  2PNX A;  3HMF A;  2Y1N A;  3SOW A;  2RS9 B;  4A9L A;  4QR3 A;  4TKP B;  5FH6 A;  4HXP A;  4A9F A;  2LXH C;  4O7E A;  4CUR A;  2LGG A;  3S92 A;  3U5J A;  2R0V A;  4Z6H A;  4UIV A;  3UVX A;  4O74 A;  1X0J A;  1LDJ B;  5IGK A;  5DY7 A;  2VP7 A;  4QF2 A;  5FEY A;  4CCG X;  5A5O A;  2YYN A;  4J1P A;  5D7X A;  4B86 C;  3T6R A;  5FE0 A;  5KH9 A;  4YBM A;  4CUU A;  4PY6 A;  1Z6U A;  5TAB A;  3PUR A;  5F2P A;  4UYF B;  5ENG A;  5HM0 A;  5L99 A;  3SVH A;  5CQ8 A;  4YY6 A;  4CL9 A;  3M63 A;  4QR4 A;  2Y43 A;  5TBN A;  4PCE A;  4NUC A;  4KV4 A;  3P1E A;  4A0C D;  4YYI A;  4LLB A;  4IOR A;  4WHU A;  4XI1 A;  2QJ0 A;  3L1X A;  3UV2 A;  5B75 A;  1K2F A;  3NXB A;  4I7B A;  3C5K A;  4QSX A;  4QY4 A;  2L5U A;  2EA6 A;  4J0S A;  4HXN A;  4AVX A;  4QST A;  2G6Q A;  4C67 A;  1ZBD B;  5D0C A;  3JVL A;  2D82 A;  4MR3 A;  4X2I A;  4ALG A;  4WZ3 B;  2ECI A;  2YW8 A;  5BT4 A;  4O75 A;  2C2L A;  2M6M A;  3HMH A;  5C13 A;  2YHO A;  5ENH A;  5E9V A;  5HQ6 A;  3N9M A;  5A82 A;  5KTX A;  4GPJ A;  4QZS A;  4BW4 A;  1F68 A;  4OGI A;  2MA6 A;  3C6W A;  4ZUX U;  5L8T A;  2FSA A;  4GB0 A;  4N3W A;  2KGG A;  5HRV A;  2L75 A;  4LC2 A;  3TLP A;  4YAB A;  2K1J A;  3VK6 A;  2MD7 B;  3Q2E A;  2KFT A;  3KV6 A;  3ONI A;  2R10 A;  3ZNI A;  3KNV A;  1JM7 A;  5DW2 A;  1MM2 A;  4HBX A;  5D3H A;  5D26 A;  2H0D A;  5FFV A;  3MB3 A;  4V3K C;  3LQI A;  5D3J A;  3I3J A;  4N4G A;  5G05 B;  3UVY A;  5E3G A;  5FE5 A;  4NRC A;  5AME A;  4HXK A;  5AMF A;  3N9Q A;  4NQN A;  2ECW A;  4O70 A;  3LQH A;  3SVF A;  3M99 A;  4YAX A;  4CUS A;  4QSU A;  5CQ6 A;  1JSP B;  1Z60 A;  4QF3 A;  5TDR A;  5CS8 A;  4KCX A;  3O70 A;  4FLP A;  3O35 A;  4XUA A;  5H85 A;  4O7C A;  5FE1 A;  2YRE A;  5D3T A;  5EA1 A;  5HRX A;  1RMD A;  4QYD A;  4R7E A;  1N72 A;  2ECT A;  2QIC A;  5HQ5 A;  3UV4 A;  2VPE A;  4IR4 A;  1X4J A;  4XUB A;  3O7A A;  4HBV A;  5DX4 A;  1G25 A;  5L96 A;  4OGJ A;  5E9M A;  1WIL A;  2YYR A;  5EWD A;  5AIU A;  1WUM A;  2OXQ C;  4R8P K;  2WP1 A;  4WZ0 A;  4NYX A;  5C87 A;  5JI8 A;  5EP7 A;  5IBN A;  5KH3 A;  4QR5 A;  2DKW A;  3LRQ A;  1FP0 A;  2YEK A;  3O34 A;  3U5M A;  5A5N A;  1BOR A;  4UIT A;  4YAT A;  3HCU A;  2YU4 A;  2H60 A;  5FB0 A;  3DAI A;  5F61 A;  3U5P A;  4Z1S A;  3SHB A;  3LQJ A;  5TDW A;  4TT4 A;  4UYD A;  1F62 A;  4YH3 A;  3JVK A;  5FE9 A;  2RNY A;  4TYL A;  4Z6I A;  2KE1 A;  4XYA A;  5LUU A;  2GRC A;  4YY4 A;  2I8N A;  2YHN A;  4IC3 A;  4CA1 A;  1VYX A;  5DFB A;  5HEN A;  5TRB A;  2JMD A;  4XY9 A;  3N9L A;  4LK9 A;  4AP4 A;  3S91 A;  2MJV B;  2RFJ A;  4WZ2 A;  2VNF A;  5FDZ A;  4NQM A;  5BT3 A;  4LDF A;  3U5N A;  1LDK C;  1WIM A;  4FO9 A;  2F42 A;  5D3S A;  5CQ7 A;  5L98 A;  4AUQ B;  1WEQ A;  5DKA A;  5EGU A;  4A9E A;  3DPL R;  5ENF A;  4HBW A;  5KU3 A;  2YEM A;  5FE3 A;  4O7F A;  5FE7 A;  2CKL A;  4MR5 A;  2UZG A;  5F25 A;  5KH7 A;  2YQL A;  4A9M A;  5EM3 A;  5AD2 A;  4O7B A;  3ASL A;  5D3L A;  5E0R A;  5J3X A;  4AYC B;  2LGK A;  4A9H A;  4GND A;  4MVT A;  2M1R A;  5F63 A;  3N9N A;  3LJW A;  4ZC9 A;  4MEQ A;  5ENJ A;  4Q0N A;  5FB1 A;  4A49 A;  4I7C A;  2YW5 A;  3JVM A;  5E7D A;  5CUA A;  5FH8 A;  3U5O A;  4MSX A;  4X3G A;  4HXO A;  5D25 A;  5DYX A;  5FE6 A;  3RTR B;  5EWC A;  4NR6 A;  2N9G A;  2OO1 A;  5C85 A;  4E96 A;  5IGM A;  5L97 A;  2M85 A;  4CFL A;  5F36 A;  5CQT A;  5DYA A;  5I29 A;  2EOD A;  5F60 A;  4N4F A;  5DLX A;  1WEP A;  3G0L A;  3QZS A;  5EIS A;  4ALH A;  4NR5 A;  5C7N A;  4QSW A;  5EWH A;  5DW1 A;  5ENC A;  4NN2 A;  5CUC A;  1E6I A;  4A9N A;  2FUU A;  3ZVZ B;  3UVW A;  5EWW A;  2K4D A;  4PTB A;  5CFW A;  4Z1Q A;  5D1K B;  5EK9 A;  4WHW A;  1XWH A;  4LYI A;  2YUR A;  2KWO A;  4YH4 A;  1WEM A;  5FER A;  5KO4 A;  1WGM A;  2MUM A;  4LZR A;  3AAD A;  5DKD A;  5DKH A;  1WEU A;  4GNG A;  2LSP B;  3P1C A;  5C11 A;  4QNS A;  2K16 A;  5KTW A;  2MNY A;  4V3L C;  4OUF A;  5G4S A;  4YYN A;  5C4Q A;  4S3O B;  5FFY A;  4F52 B;  3LXJ A;  2LGL A;  2DVV A;  2F6J A;  4QB3 A;  4YYK A;  3GV4 A;  1WEN A;  5FG4 A;  4A9O A;  5E73 A;  5B8D A;  5C8G A;  5F62 A;  4TT6 A;  5LJ2 A;  5G0F A;  4TT2 A;  5H1V A;  4QC1 A;  1X4I A;  5HFQ A;  2QIZ A;  5I1Q A;  5II2 A;  2YQM A;  4DON A;  5CQ4 A;  3QZT A;  5HEM A;  1IYM A;  5HFR A;  2KWJ A;  3HCT A;  4QEW A;  4FIP A;  2L84 A;  5A85 A;  5I89 A;  4TQN A;  2JRJ A;  1WEV A;  1WEW A;  1DVP A;  3UW9 A;  5EIC A;  2OSS A;  3O33 A;  5LKZ A;  3ZYU A;  1WFK A;  5DFC A;  2F6N A;  5FE2 A;  3GL6 A;  3GG3 A;  4TU4 A;  5ETB A;  4NR8 A;  5IGN A;  2CT2 A;  4HXR A;  5I3L A;  4NRA A;  2E3K A;  5F5Z A;  4NR9 A;  5IGL A;  3EB6 A;  5ETD A;  1HYJ A;  5EV9 A;  5KHM A;  4UI9 B;  4QUT A;  5A5Q A;  5EI4 A;  4NRB A;  5DYC A;  4NS5 A;  1WE9 A;  4BW1 A;  5I40 A;  3L1Z B;  3Q2F A;  4UP0 A;  5KTU A;  4WA6 A;  4NR7 A;  4ZQL A;  3N9P A;  3KV5 A;  3ZPV 1;  2RI7 A;  4PS5 A;  4CLB A;  5L8U A;  5E9K A;  4IOO A;  4A4B A;  4TU6 A;  4CUP A;  5LJ0 A;  5II1 A;  3IU5 A;  2RNW A;  5LKU A;  5CP5 A;  1WUG A;  4QUU A;  4L7X A;  5CZG A;  2WP2 A;  4TZ8 A;  5COI A;  5EPB A;  4CFK A;  3MHS A;  1JM7 B;  3RPG B;  2RNX A;  2NXB A;  5FG6 A;  2LV9 A;  1MM3 A;  4LYS A;  5FE8 A;  3K2J A;  3MQM A;  2E7O A;  2KWK A;  4QSQ A;  5A83 A;  5I88 A;  2I50 A;  4BJX A;  2KGI A;  5LVR A;  2LDR A;  2KWN A;  3MXF A;  3ZPV E;  2L0B A;  5FFW A;  4L58 A;  4YK0 A;  4A9I A;  1V87 A;  2LN0 A;  4S3O C;  4MR4 A;  5I7Y A;  4NYW A;  1X4U A;  4TS8 A;  5EVA A;  2FUI A;  2MNZ A;  5E9I A;  2VJF A;  2VPD A;  4Y03 A;  2CSZ A;  1Z2Q A;  5DBM A;  4B7Y C;  5D3P A;  3MUL A;  5DIN A;  3P1F A;  3MUK A;  4C9Z A;  3D7C A;  2VJE A;  2MIQ A;  5CUG A;  2D8S A;  4F3I A;  4TZ2 A;  4BW3 A;  5CRM A;  5HEL A;  2E6R A;  5EU1 A;  5ACY A;  3SOX A;  4NYV A;  2E7N A;  4QC3 A;  3HCS A;  4A9J A;  4A4C A;  4C66 A;  3RCW A;  2MT5 A;  5LJ1 A;  4TTE A;  4CUQ A;  2JMI A;  5F1L A;  2G43 A;  4IOQ A;  4LR6 A;  4Z93 A;  5CU8 A;  4J3I A;  2ECN A;  4R2Y A;  2K17 A;  2YQD A;  4AYC A;  4GNF A;  3EB5 A;  4YYJ A;  4O72 A;  2G4A A;  3U5L A;  5BT5 A;  1N87 A;  2CKL B;  4UP5 A;  1WEE A;  2EGP A;  4IR3 A;  2XB1 A;  2YEL A;  4HXM A;  2VJF B;  5E3D A;  5B76 A;  4LYW A;  5IG6 A;  3O37 A;  2RSD A;  5A5R A;  4N4H A;  5F1H A;  4AKN A;  4Q0O A;  5CUE A;  4YYD A;  1JOC A;  2NAA A;  3PHD A;  5CUD A;  2MA5 A;  2DAT A;  4CUT A;  3SOU A;  3IHP A;  5A7C A;  5E9L A;  3IU6 A;  3U5K A;  5CPE A;  5EPR A;  4PPE A;  5EYA F;  2JMJ A;  5JG6 A;  4QSS A;  1FBV A;  1E4U A;  4I7D A;  3ZTG A;  4KV1 A;  5E74 A;  2XEU A;  2R0S A;  5C89 A;  4LZS A;  4NUE A;  2ZET C;  4HXL A;  4QBM A;  4RVR A;  5A81 A;  5LCW B;  3N9O A;  3RPG C;  4HBY A;  5AIT A;  5B78 A;  5D1M B;  1JM4 B;  1EQF A;  4UIZ A;  1VD4 A;  2L85 A;  3UV5 A;  2I7K A;  5D3R A;  5DKC A;  4UIW A;  4LJN A;  3PUQ A;  3QZV A;  3DQV R;  4UYH A;  4LAD B;  5ENB A;  1CHC A;  3KQI A;  4O71 A;  5CQ3 A;  4IC2 A;  5CUB A;  3AQA A;  4UYG A;  4YYG A;  5DLZ A;  4YYH A;  5H1U A;  2KYU A;  5I7X A;  4QSR A;  1HYI A;  2LGV A;  4UYF A;  1WEO A;  4ZW1 A;  2ECJ A;  4MR6 A;  3HTK C; 
#chains in the Genus database with same CATH topology
 4UIU A;  3ZYQ A;  5CGP A;  5I83 A;  5DFD A;  2VPG A;  2HYE D;  3NG2 A;  2KR4 A;  1VFY A;  4YBS A;  3SUB A;  4QSP A;  5CY9 A;  5FG5 A;  5B79 A;  4UYE A;  3MB4 A;  2OUO A;  4HXS A;  4J0R A;  4QEV A;  5CTL A;  5I86 A;  4LRG A;  4QSV A;  3FAO A;  5EWV A;  3V43 A;  5CRZ A;  5HLS A;  2YSJ A;  4ZDT A;  2ECV A;  2D9E A;  4YAD A;  2R0Y A;  5H1T A;  5TB6 A;  5JWM A;  4O64 A;  4FJC A;  5I80 A;  3T9K A;  5TCM A;  5J0D A;  2C2V S;  2DVR A;  2YT5 A;  3L11 A;  3FKM X;  5HJC A;  5HQ7 A;  4OGE A;  2MD8 C;  1U6G B;  2PUY A;  2L80 A;  3DDT A;  5HRW A;  5D3N A;  4N4I A;  4QYL A;  4A9K A;  3FL2 A;  3FM8 C;  4W4U A;  2RO1 A;  4UIX A;  2DWW A;  2FFW A;  2G45 A;  2H0D B;  4MEO A;  3UVD A;  2DX8 A;  3P5O A;  4PCI A;  2XOY A;  4YBT A;  1T1H A;  1WES A;  2LRI C;  4FK5 A;  3JVJ A;  2KRE A;  3P1D A;  4YC9 A;  5D1L B;  5G4R A;  5B77 A;  4O7A A;  2DSM A;  2KU3 A;  2HDP A;  2VJE B;  5DYU A;  4LKA A;  5LKT A;  4O78 A;  2M3H A;  5E9Y A;  4PKL A;  3T7L A;  3G0J A;  5K3Q A;  2YSM A;  5K29 A;  2YUC A;  4F1P A;  2L5E A;  4IR6 A;  5H9M A;  4NR4 A;  4O76 A;  2KTB B;  4Q6F A;  5LVQ A;  4IR5 A;  4AI6 A;  2L43 A;  2DVQ A;  5SVY A;  2LXP C;  2IDA A;  2YDW A;  2ECG A;  4MEP A;  3DWY A;  5IID A;  5ENE A;  5D24 A;  3MDB C;  4NUD A;  5F3A A;  2KIZ A;  4BBQ A;  1ZS5 A;  4XY8 A;  5EPS A;  3M62 A;  3SVG A;  5FE4 A;  3I2D A;  5CQA A;  2IQJ A;  5HCL A;  4GNE A;  5EQ1 A;  5FH7 A;  3MHH A;  4O77 A;  3ZVY A;  5ENI A;  4LZ2 A;  2E6S A;  4MEN A;  5A5P A;  5A5S A;  2AN6 A;  4P5O B;  2DVS A;  4NXJ A;  2VPB A;  4YYM A;  4WIV A;  5G04 B;  4QEU A;  4UIY A;  3O36 A;  3HME A;  4BW2 A;  5CQ5 A;  5LKX A;  2BAY A;  2LQ6 A;  2Y1M A;  5AD3 A;  2CSY A;  5FBX A;  4BHW A;  1DCQ A;  2LAU A;  2PNX A;  3HMF A;  2Y1N A;  3SOW A;  2RS9 B;  4A9L A;  4QR3 A;  4TKP B;  5FH6 A;  4HXP A;  4A9F A;  2LXH C;  4O7E A;  3PLW A;  3H7H A;  4CUR A;  2LGG A;  3S92 A;  3VKH A;  3U5J A;  4QQ4 A;  2R0V A;  4Z6H A;  4UIV A;  3UVX A;  4O74 A;  1X0J A;  1LDJ B;  5IGK A;  5DY7 A;  2VP7 A;  4QF2 A;  5FEY A;  4CCG X;  5A5O A;  2YYN A;  4J1P A;  5D7X A;  4B86 C;  3T6R A;  5FE0 A;  5KH9 A;  4YBM A;  4CUU A;  4PY6 A;  1Z6U A;  5TAB A;  3PUR A;  5F2P A;  4UYF B;  5ENG A;  5HM0 A;  5L99 A;  3SVH A;  5CQ8 A;  4YY6 A;  4CL9 A;  3M63 A;  4QR4 A;  2Y43 A;  5TBN A;  4PCE A;  3DWD A;  4NUC A;  4KV4 A;  3P1E A;  4A0C D;  4YYI A;  4LLB A;  4IOR A;  4WHU A;  4XI1 A;  2QJ0 A;  3L1X A;  3UV2 A;  5B75 A;  1K2F A;  3NXB A;  4I7B A;  3C5K A;  4QSX A;  4QY4 A;  2L5U A;  2EA6 A;  4J0S A;  4HXN A;  4AVX A;  4QST A;  2G6Q A;  4C67 A;  3LVQ E;  1ZBD B;  5D0C A;  2JM3 A;  3JVL A;  2D82 A;  4MR3 A;  4X2I A;  4ALG A;  4AKG A;  4WZ3 B;  2ECI A;  2YW8 A;  5BT4 A;  4O75 A;  2C2L A;  2M6M A;  3HMH A;  5C13 A;  2YHO A;  5ENH A;  3M7K A;  5E9V A;  5HQ6 A;  3N9M A;  2XOC A;  5A82 A;  5KTX A;  2YVR A;  2RR4 A;  4GPJ A;  4QZS A;  4BW4 A;  1F68 A;  4OGI A;  2MA6 A;  3C6W A;  4ZUX U;  5L8T A;  2FSA A;  4GB0 A;  4N3W A;  2KGG A;  5HRV A;  2L75 A;  4LC2 A;  3TLP A;  4YAB A;  2K1J A;  3VK6 A;  2MD7 B;  3Q2E A;  2KFT A;  3KV6 A;  3ONI A;  2R10 A;  3ZNI A;  3KNV A;  5SVI B;  1JM7 A;  5DW2 A;  1MM2 A;  4HBX A;  5D3H A;  5D26 A;  2H0D A;  5FFV A;  3MB3 A;  4V3K C;  3LQI A;  5D3J A;  3I3J A;  2P57 A;  4N4G A;  5G05 B;  3UVY A;  5E3G A;  5FE5 A;  4NRC A;  5AME A;  4HXK A;  5AMF A;  3N9Q A;  4NQN A;  2ECW A;  4O70 A;  3LQH A;  3SVF A;  3M99 A;  4YAX A;  4CUS A;  4QSU A;  5CQ6 A;  5SVX A;  1JSP B;  1Z60 A;  3E2D A;  4QF3 A;  5TDR A;  5CS8 A;  4KCX A;  3O47 A;  3O70 A;  4FLP A;  2EXU A;  3O35 A;  4XUA A;  5H85 A;  4O7C A;  5FE1 A;  2YRE A;  5D3T A;  5EA1 A;  2FD4 A;  5HRX A;  1RMD A;  4QYD A;  4R7E A;  1N72 A;  2ECT A;  2QIC A;  5HQ5 A;  2B0O E;  3UV4 A;  2VPE A;  4IR4 A;  1X4J A;  4XUB A;  3O7A A;  4HBV A;  5DX4 A;  1G25 A;  5L96 A;  4OGJ A;  5E9M A;  1WIL A;  2YYR A;  5EWD A;  5AIU A;  1WUM A;  2OXQ C;  4R8P K;  2WP1 A;  4WZ0 A;  4NYX A;  5C87 A;  2CRW A;  5JI8 A;  5EP7 A;  2CON A;  5IBN A;  5KH3 A;  3FEH A;  4QR5 A;  2DKW A;  3LRQ A;  1FP0 A;  2YEK A;  3O34 A;  3U5M A;  5A5N A;  1BOR A;  4UIT A;  4YAT A;  3HCU A;  2YU4 A;  2H60 A;  5FB0 A;  3DAI A;  5F61 A;  3U5P A;  4Z1S A;  3SHB A;  3LQJ A;  5TDW A;  4TT4 A;  4UYD A;  1F62 A;  4YH3 A;  3JVK A;  5FE9 A;  2RNY A;  4TYL A;  4Z6I A;  1MBM A;  2KE1 A;  4XYA A;  5LUU A;  2GRC A;  4YY4 A;  2I8N A;  2YHN A;  4IC3 A;  4CA1 A;  1VYX A;  4H9D A;  5DFB A;  5HEN A;  5TRB A;  2JMD A;  4XY9 A;  3N9L A;  4LK9 A;  4AP4 A;  3S91 A;  3D1B A;  2MJV B;  2RFJ A;  4WZ2 A;  2VNF A;  5FDZ A;  4NQM A;  5BT3 A;  4LDF A;  3U5N A;  1LDK C;  1WIM A;  3JUE A;  2XP0 A;  4FO9 A;  4O62 A;  2F42 A;  5D3S A;  5CQ7 A;  5L98 A;  4AUQ B;  1WEQ A;  5DKA A;  5EGU A;  4A9E A;  3DPL R;  5ENF A;  4HBW A;  5KU3 A;  2YEM A;  5FE3 A;  4O7F A;  5FE7 A;  2CKL A;  4MR5 A;  2UZG A;  5F25 A;  5KH7 A;  2YQL A;  4A9M A;  5EM3 A;  5AD2 A;  4O7B A;  3ASL A;  5D3L A;  5E0R A;  5J3X A;  4AYC B;  2LGK A;  4A9H A;  4GND A;  4MVT A;  2M1R A;  5F63 A;  3N9N A;  3LJW A;  4ZC9 A;  4MEQ A;  3FAN A;  5ENJ A;  4Q0N A;  5FB1 A;  2EGM A;  4I7C A;  2YW5 A;  4A49 A;  3JVM A;  2D8U A;  5E7D A;  5CUA A;  5FH8 A;  3U5O A;  2CSV A;  2KKY A;  4HXO A;  5D25 A;  5DYX A;  5FE6 A;  4MSX A;  4X3G A;  5EWC A;  3RTR B;  4NR6 A;  2N9G A;  2OO1 A;  5C85 A;  2XOZ A;  5SVI A;  4E96 A;  5IGM A;  5L97 A;  2M85 A;  4CFL A;  5F36 A;  5CQT A;  5DYA A;  5I29 A;  2EOD A;  5F60 A;  4N4F A;  2CRR A;  5DLX A;  1WEP A;  3G0L A;  3QZS A;  5EIS A;  4ALH A;  1ZKR A;  4NR5 A;  4QSW A;  5EWH A;  5DW1 A;  5ENC A;  5C7N A;  4NN2 A;  5CUC A;  1E6I A;  4A9N A;  2FUU A;  3ZVZ B;  3UVW A;  5EWW A;  2K4D A;  4PTB A;  5CFW A;  4Z1Q A;  5D1K B;  5EK9 A;  4WHW A;  1XWH A;  4LYI A;  2YUR A;  2KWO A;  4YH4 A;  1WEM A;  5FER A;  5KO4 A;  1WGM A;  2MUM A;  4LZR A;  3AAD A;  5DKD A;  5DKH A;  1WEU A;  4GNG A;  2LSP B;  3P1C A;  5C11 A;  4QNS A;  2K16 A;  4AKI A;  5KTW A;  2MNY A;  4V3L C;  4OUF A;  5G4S A;  4YYN A;  5C4Q A;  4S3O B;  5FFY A;  4F52 B;  3LXJ A;  2LGL A;  2DVV A;  2F6J A;  4QB3 A;  4YYK A;  3GV4 A;  1WEN A;  5FG4 A;  4A9O A;  5E73 A;  5B8D A;  5C8G A;  5F62 A;  4TT6 A;  5LJ2 A;  5G0F A;  4TT2 A;  5H1V A;  4QC1 A;  1X4I A;  2DJA A;  5HFQ A;  2QIZ A;  5I1Q A;  5II2 A;  2YQM A;  4DON A;  4AKH A;  5CQ4 A;  3QZT A;  5HEM A;  1IYM A;  5HFR A;  2KWJ A;  3HCT A;  4QEW A;  4FIP A;  2L84 A;  5A85 A;  5I89 A;  4TQN A;  2JRJ A;  1WEV A;  2JUN A;  1WEW A;  1DVP A;  3UW9 A;  5EIC A;  2OSS A;  3O33 A;  5LKZ A;  3ZYU A;  1WFK A;  5DFC A;  2F6N A;  5FE2 A;  3GL6 A;  3GG3 A;  4TU4 A;  5ETB A;  4NR8 A;  5IGN A;  2CT2 A;  2L7P A;  4HXR A;  5I3L A;  4NRA A;  2E3K A;  5F5Z A;  4NR9 A;  5IGL A;  3EB6 A;  5ETD A;  1HYJ A;  5EV9 A;  5KHM A;  4UI9 B;  4QUT A;  5A5Q A;  5EI4 A;  4NRB A;  5DYC A;  4NS5 A;  1WE9 A;  4BW1 A;  5I40 A;  3L1Z B;  3Q2F A;  4UP0 A;  5KTU A;  4WA6 A;  4NR7 A;  4ZQL A;  3N9P A;  3KV5 A;  3ZPV 1;  2RI7 A;  4PS5 A;  4CLB A;  4OGC A;  4Z0R A;  5L8U A;  5E9K A;  4IOO A;  4A4B A;  3ERR A;  4TU6 A;  4CUP A;  5LJ0 A;  5II1 A;  3IU5 A;  2RNW A;  5LKU A;  5CP5 A;  1WUG A;  4QUU A;  4L7X A;  5CZG A;  2WP2 A;  4TZ8 A;  5COI A;  5EPB A;  4CFK A;  3MHS A;  1JM7 B;  2E61 A;  3RPG B;  2RNX A;  2NXB A;  5FG6 A;  2LV9 A;  2KKX A;  1MM3 A;  4LYS A;  5FE8 A;  3K2J A;  3MQM A;  2E7O A;  2KWK A;  4QSQ A;  5A83 A;  5I88 A;  2I50 A;  4BJX A;  2KGI A;  5LVR A;  2LDR A;  2KWN A;  3MXF A;  3FJU B;  3ZPV E;  2L0B A;  5FFW A;  4L58 A;  4YK0 A;  4A9I A;  1V87 A;  2LN0 A;  4S3O C;  4MR4 A;  5I7Y A;  4NYW A;  1X4U A;  3LVR E;  4TS8 A;  5EVA A;  2FUI A;  2MNZ A;  5E9I A;  2VJF A;  2VPD A;  4Y03 A;  2CSZ A;  1Z2Q A;  5DBM A;  4B7Y C;  5D3P A;  3MUL A;  5DIN A;  3P1F A;  3MUK A;  2MKE A;  3D7C A;  2VJE A;  1PUO A;  2MIQ A;  4C9Z A;  5CUG A;  2D8S A;  4F3I A;  4TZ2 A;  4BW3 A;  5CRM A;  5HEL A;  2E6R A;  5EU1 A;  4Z0O A;  5ACY A;  3SOX A;  4NYV A;  2E7N A;  4QC3 A;  3HCS A;  4A9J A;  4A4C A;  4C66 A;  3RCW A;  2MT5 A;  2EJN A;  2M13 A;  5LJ1 A;  4TTE A;  4CUQ A;  2JMI A;  5F1L A;  2G43 A;  4IOQ A;  4LR6 A;  4Z93 A;  5CU8 A;  4J3I A;  2ECN A;  4R2Y A;  2K17 A;  2YQD A;  4AYC A;  4GNF A;  3EB5 A;  4YYJ A;  4O72 A;  2G4A A;  3U5L A;  5BT5 A;  3KDE C;  1N87 A;  2CKL B;  4UP5 A;  1WEE A;  2EGP A;  4IR3 A;  2XB1 A;  2YEL A;  4HXM A;  2VJF B;  5E3D A;  5B76 A;  3VKG A;  3LDY A;  4LYW A;  5IG6 A;  3O37 A;  2RSD A;  5A5R A;  4N4H A;  5F1H A;  4AKN A;  4Q0O A;  5CUE A;  4YYD A;  1JOC A;  2NAA A;  3PHD A;  5CUD A;  2MA5 A;  2DAT A;  4CUT A;  3SOU A;  3IHP A;  5A7C A;  5E9L A;  3IU6 A;  3U5K A;  5CPE A;  5EPR A;  4PPE A;  5EYA F;  2JMJ A;  5JG6 A;  4QSS A;  1FBV A;  1E4U A;  4I7D A;  3ZTG A;  4KV1 A;  5E74 A;  2XEU A;  2R0S A;  5C89 A;  4LZS A;  4NUE A;  2ZET C;  4HXL A;  4QBM A;  4RVR A;  5A81 A;  5LCW B;  3N9O A;  3RPG C;  4HBY A;  5AIT A;  5B78 A;  5D1M B;  1JM4 B;  1EQF A;  4UIZ A;  1VD4 A;  2L85 A;  3UV5 A;  2I7K A;  5D3R A;  5DKC A;  3Q1D A;  4UIW A;  3LJU X;  4LJN A;  3PUQ A;  3QZV A;  2OWA A;  4UYH A;  3DQV R;  4LAD B;  5ENB A;  1CHC A;  3KQI A;  4O71 A;  5CQ3 A;  4IC2 A;  5CUB A;  3AQA A;  4UYG A;  4YYG A;  5DLZ A;  4YYH A;  5H1U A;  2KYU A;  5I7X A;  4QSR A;  1HYI A;  2LGV A;  4UYF A;  1WEO A;  4ZW1 A;  2ECJ A;  4MR6 A;  3D1D A;  3HTK C; 
#chains in the Genus database with same CATH homology
 4UIU A;  3ZYQ A;  5CGP A;  5I83 A;  5DFD A;  2VPG A;  2HYE D;  3NG2 A;  2KR4 A;  1VFY A;  4YBS A;  4QSP A;  5CY9 A;  5FG5 A;  5B79 A;  4UYE A;  3MB4 A;  2OUO A;  4HXS A;  4J0R A;  4QEV A;  5CTL A;  5I86 A;  4LRG A;  4QSV A;  3V43 A;  5EWV A;  5CRZ A;  5HLS A;  2YSJ A;  4ZDT A;  2ECV A;  2D9E A;  4YAD A;  2R0Y A;  5H1T A;  5TB6 A;  5JWM A;  4O64 A;  4FJC A;  5I80 A;  5TCM A;  5J0D A;  2C2V S;  2DVR A;  2YT5 A;  3L11 A;  3FKM X;  5HJC A;  5HQ7 A;  2MD8 C;  1U6G B;  2PUY A;  2L80 A;  5HRW A;  5D3N A;  4N4I A;  4QYL A;  4A9K A;  3FL2 A;  4W4U A;  2RO1 A;  4UIX A;  2DWW A;  2G45 A;  2H0D B;  4MEO A;  3UVD A;  2DX8 A;  3P5O A;  4PCI A;  4YBT A;  1T1H A;  1WES A;  2LRI C;  4FK5 A;  3JVJ A;  2KRE A;  3P1D A;  4YC9 A;  5D1L B;  5G4R A;  5B77 A;  4O7A A;  2KU3 A;  2HDP A;  2VJE B;  5DYU A;  4LKA A;  5LKT A;  4O78 A;  2M3H A;  5E9Y A;  4PKL A;  3T7L A;  3G0J A;  2YSM A;  5K29 A;  2YUC A;  2L5E A;  4IR6 A;  5H9M A;  4NR4 A;  4O76 A;  2KTB B;  4Q6F A;  5LVQ A;  4IR5 A;  2L43 A;  2DVQ A;  2LXP C;  2IDA A;  2YDW A;  2ECG A;  4MEP A;  3DWY A;  5IID A;  5ENE A;  5D24 A;  4NUD A;  5F3A A;  2KIZ A;  4BBQ A;  1ZS5 A;  4XY8 A;  5EPS A;  3M62 A;  3SVG A;  5FE4 A;  3I2D A;  5CQA A;  5HCL A;  4GNE A;  5EQ1 A;  5FH7 A;  3MHH A;  4O77 A;  3ZVY A;  5ENI A;  4LZ2 A;  2E6S A;  4MEN A;  5A5P A;  5A5S A;  2AN6 A;  4P5O B;  2DVS A;  4NXJ A;  2VPB A;  4YYM A;  4WIV A;  5G04 B;  4QEU A;  4UIY A;  3O36 A;  3HME A;  4BW2 A;  5CQ5 A;  5LKX A;  2BAY A;  2LQ6 A;  2Y1M A;  5AD3 A;  2CSY A;  5FBX A;  4BHW A;  2PNX A;  3HMF A;  2Y1N A;  3SOW A;  2RS9 B;  4A9L A;  4QR3 A;  4TKP B;  5FH6 A;  4HXP A;  4A9F A;  2LXH C;  4O7E A;  4CUR A;  2LGG A;  3S92 A;  3U5J A;  2R0V A;  4Z6H A;  4UIV A;  3UVX A;  4O74 A;  1X0J A;  1LDJ B;  5IGK A;  5DY7 A;  2VP7 A;  4QF2 A;  5FEY A;  4CCG X;  5A5O A;  2YYN A;  4J1P A;  5D7X A;  4B86 C;  3T6R A;  5FE0 A;  5KH9 A;  4YBM A;  4CUU A;  4PY6 A;  1Z6U A;  5TAB A;  3PUR A;  5F2P A;  4UYF B;  5ENG A;  5HM0 A;  5L99 A;  3SVH A;  5CQ8 A;  4YY6 A;  4CL9 A;  3M63 A;  4QR4 A;  2Y43 A;  5TBN A;  4PCE A;  4NUC A;  4KV4 A;  3P1E A;  4A0C D;  4YYI A;  4LLB A;  4IOR A;  4WHU A;  4XI1 A;  2QJ0 A;  3L1X A;  3UV2 A;  5B75 A;  1K2F A;  3NXB A;  4I7B A;  3C5K A;  4QSX A;  4QY4 A;  2L5U A;  2EA6 A;  4J0S A;  4HXN A;  4AVX A;  4QST A;  2G6Q A;  4C67 A;  1ZBD B;  5D0C A;  3JVL A;  2D82 A;  4MR3 A;  4X2I A;  4ALG A;  4WZ3 B;  2ECI A;  2YW8 A;  5BT4 A;  4O75 A;  2C2L A;  2M6M A;  3HMH A;  5C13 A;  2YHO A;  5ENH A;  5E9V A;  5HQ6 A;  3N9M A;  5A82 A;  5KTX A;  4GPJ A;  4QZS A;  4BW4 A;  1F68 A;  4OGI A;  2MA6 A;  3C6W A;  4ZUX U;  5L8T A;  2FSA A;  4GB0 A;  4N3W A;  2KGG A;  5HRV A;  2L75 A;  4LC2 A;  3TLP A;  4YAB A;  2K1J A;  3VK6 A;  2MD7 B;  3Q2E A;  2KFT A;  3KV6 A;  3ONI A;  2R10 A;  3ZNI A;  3KNV A;  1JM7 A;  5DW2 A;  1MM2 A;  4HBX A;  5D3H A;  5D26 A;  2H0D A;  5FFV A;  3MB3 A;  4V3K C;  3LQI A;  5D3J A;  3I3J A;  4N4G A;  5G05 B;  3UVY A;  5E3G A;  5FE5 A;  4NRC A;  5AME A;  4HXK A;  5AMF A;  3N9Q A;  4NQN A;  2ECW A;  4O70 A;  3LQH A;  3SVF A;  3M99 A;  4YAX A;  4CUS A;  4QSU A;  5CQ6 A;  1JSP B;  1Z60 A;  4QF3 A;  5TDR A;  5CS8 A;  4KCX A;  3O70 A;  4FLP A;  3O35 A;  4XUA A;  5H85 A;  4O7C A;  5FE1 A;  2YRE A;  5D3T A;  5EA1 A;  5HRX A;  1RMD A;  4QYD A;  4R7E A;  1N72 A;  2ECT A;  2QIC A;  5HQ5 A;  3UV4 A;  2VPE A;  4IR4 A;  1X4J A;  4XUB A;  3O7A A;  4HBV A;  5DX4 A;  1G25 A;  5L96 A;  4OGJ A;  5E9M A;  1WIL A;  2YYR A;  5EWD A;  5AIU A;  1WUM A;  2OXQ C;  4R8P K;  2WP1 A;  4WZ0 A;  4NYX A;  5C87 A;  5JI8 A;  5EP7 A;  5IBN A;  5KH3 A;  4QR5 A;  2DKW A;  3LRQ A;  1FP0 A;  2YEK A;  3O34 A;  3U5M A;  5A5N A;  1BOR A;  4UIT A;  4YAT A;  3HCU A;  2YU4 A;  2H60 A;  5FB0 A;  3DAI A;  5F61 A;  3U5P A;  4Z1S A;  3SHB A;  3LQJ A;  5TDW A;  4TT4 A;  4UYD A;  1F62 A;  4YH3 A;  3JVK A;  5FE9 A;  2RNY A;  4TYL A;  4Z6I A;  2KE1 A;  4XYA A;  5LUU A;  2GRC A;  4YY4 A;  2I8N A;  2YHN A;  4IC3 A;  4CA1 A;  1VYX A;  5DFB A;  5HEN A;  5TRB A;  2JMD A;  4XY9 A;  3N9L A;  4LK9 A;  4AP4 A;  3S91 A;  2MJV B;  2RFJ A;  4WZ2 A;  2VNF A;  5FDZ A;  4NQM A;  5BT3 A;  4LDF A;  3U5N A;  1LDK C;  1WIM A;  4FO9 A;  2F42 A;  5D3S A;  5CQ7 A;  5L98 A;  4AUQ B;  1WEQ A;  5DKA A;  5EGU A;  4A9E A;  3DPL R;  5ENF A;  4HBW A;  5KU3 A;  2YEM A;  5FE3 A;  4O7F A;  5FE7 A;  2CKL A;  4MR5 A;  2UZG A;  5F25 A;  5KH7 A;  2YQL A;  4A9M A;  5EM3 A;  5AD2 A;  4O7B A;  3ASL A;  5D3L A;  5E0R A;  5J3X A;  4AYC B;  2LGK A;  4A9H A;  4GND A;  4MVT A;  2M1R A;  5F63 A;  3N9N A;  3LJW A;  4ZC9 A;  4MEQ A;  5ENJ A;  4Q0N A;  5FB1 A;  4A49 A;  4I7C A;  2YW5 A;  3JVM A;  5E7D A;  5CUA A;  5FH8 A;  3U5O A;  4MSX A;  4X3G A;  4HXO A;  5D25 A;  5DYX A;  5FE6 A;  3RTR B;  5EWC A;  4NR6 A;  2N9G A;  2OO1 A;  5C85 A;  4E96 A;  5IGM A;  5L97 A;  2M85 A;  4CFL A;  5F36 A;  5CQT A;  5DYA A;  5I29 A;  2EOD A;  5F60 A;  4N4F A;  5DLX A;  1WEP A;  3G0L A;  3QZS A;  5EIS A;  4ALH A;  4NR5 A;  5C7N A;  4QSW A;  5EWH A;  5DW1 A;  5ENC A;  4NN2 A;  5CUC A;  1E6I A;  4A9N A;  2FUU A;  3ZVZ B;  3UVW A;  5EWW A;  2K4D A;  4PTB A;  5CFW A;  4Z1Q A;  5D1K B;  5EK9 A;  4WHW A;  1XWH A;  4LYI A;  2YUR A;  2KWO A;  4YH4 A;  1WEM A;  5FER A;  5KO4 A;  1WGM A;  2MUM A;  4LZR A;  3AAD A;  5DKD A;  5DKH A;  1WEU A;  4GNG A;  2LSP B;  3P1C A;  5C11 A;  4QNS A;  2K16 A;  5KTW A;  2MNY A;  4V3L C;  4OUF A;  5G4S A;  4YYN A;  5C4Q A;  4S3O B;  5FFY A;  4F52 B;  3LXJ A;  2LGL A;  2DVV A;  2F6J A;  4QB3 A;  4YYK A;  3GV4 A;  1WEN A;  5FG4 A;  4A9O A;  5E73 A;  5B8D A;  5C8G A;  5F62 A;  4TT6 A;  5LJ2 A;  5G0F A;  4TT2 A;  5H1V A;  4QC1 A;  1X4I A;  5HFQ A;  2QIZ A;  5I1Q A;  5II2 A;  2YQM A;  4DON A;  5CQ4 A;  3QZT A;  5HEM A;  1IYM A;  5HFR A;  2KWJ A;  3HCT A;  4QEW A;  4FIP A;  2L84 A;  5A85 A;  5I89 A;  4TQN A;  2JRJ A;  1WEV A;  1WEW A;  1DVP A;  3UW9 A;  5EIC A;  2OSS A;  3O33 A;  5LKZ A;  3ZYU A;  1WFK A;  5DFC A;  2F6N A;  5FE2 A;  3GL6 A;  3GG3 A;  4TU4 A;  5ETB A;  4NR8 A;  5IGN A;  2CT2 A;  4HXR A;  5I3L A;  4NRA A;  2E3K A;  5F5Z A;  4NR9 A;  5IGL A;  3EB6 A;  5ETD A;  1HYJ A;  5EV9 A;  5KHM A;  4UI9 B;  4QUT A;  5A5Q A;  5EI4 A;  4NRB A;  5DYC A;  4NS5 A;  1WE9 A;  4BW1 A;  5I40 A;  3L1Z B;  3Q2F A;  4UP0 A;  5KTU A;  4WA6 A;  4NR7 A;  4ZQL A;  3N9P A;  3KV5 A;  3ZPV 1;  2RI7 A;  4PS5 A;  4CLB A;  5L8U A;  5E9K A;  4IOO A;  4A4B A;  4TU6 A;  4CUP A;  5LJ0 A;  5II1 A;  3IU5 A;  2RNW A;  5LKU A;  5CP5 A;  1WUG A;  4QUU A;  4L7X A;  5CZG A;  2WP2 A;  4TZ8 A;  5COI A;  5EPB A;  4CFK A;  3MHS A;  1JM7 B;  3RPG B;  2RNX A;  2NXB A;  5FG6 A;  2LV9 A;  1MM3 A;  4LYS A;  5FE8 A;  3K2J A;  3MQM A;  2E7O A;  2KWK A;  4QSQ A;  5A83 A;  5I88 A;  2I50 A;  4BJX A;  2KGI A;  5LVR A;  2LDR A;  2KWN A;  3MXF A;  3ZPV E;  2L0B A;  5FFW A;  4L58 A;  4YK0 A;  4A9I A;  1V87 A;  2LN0 A;  4S3O C;  4MR4 A;  5I7Y A;  4NYW A;  1X4U A;  4TS8 A;  5EVA A;  2FUI A;  2MNZ A;  5E9I A;  2VJF A;  2VPD A;  4Y03 A;  2CSZ A;  1Z2Q A;  5DBM A;  4B7Y C;  5D3P A;  3MUL A;  5DIN A;  3P1F A;  3MUK A;  4C9Z A;  3D7C A;  2VJE A;  2MIQ A;  5CUG A;  2D8S A;  4F3I A;  4TZ2 A;  4BW3 A;  5CRM A;  5HEL A;  2E6R A;  5EU1 A;  5ACY A;  3SOX A;  4NYV A;  2E7N A;  4QC3 A;  3HCS A;  4A9J A;  4A4C A;  4C66 A;  3RCW A;  2MT5 A;  5LJ1 A;  4TTE A;  4CUQ A;  2JMI A;  5F1L A;  2G43 A;  4IOQ A;  4LR6 A;  4Z93 A;  5CU8 A;  4J3I A;  2ECN A;  4R2Y A;  2K17 A;  2YQD A;  4AYC A;  4GNF A;  3EB5 A;  4YYJ A;  4O72 A;  2G4A A;  3U5L A;  5BT5 A;  1N87 A;  2CKL B;  4UP5 A;  1WEE A;  2EGP A;  4IR3 A;  2XB1 A;  2YEL A;  4HXM A;  2VJF B;  5E3D A;  5B76 A;  4LYW A;  5IG6 A;  3O37 A;  2RSD A;  5A5R A;  4N4H A;  5F1H A;  4AKN A;  4Q0O A;  5CUE A;  4YYD A;  1JOC A;  2NAA A;  3PHD A;  5CUD A;  2MA5 A;  2DAT A;  4CUT A;  3SOU A;  3IHP A;  5A7C A;  5E9L A;  3IU6 A;  3U5K A;  5CPE A;  5EPR A;  4PPE A;  5EYA F;  2JMJ A;  5JG6 A;  4QSS A;  1FBV A;  1E4U A;  4I7D A;  3ZTG A;  4KV1 A;  5E74 A;  2XEU A;  2R0S A;  5C89 A;  4LZS A;  4NUE A;  2ZET C;  4HXL A;  4QBM A;  4RVR A;  5A81 A;  5LCW B;  3N9O A;  3RPG C;  4HBY A;  5AIT A;  5B78 A;  5D1M B;  1JM4 B;  1EQF A;  4UIZ A;  1VD4 A;  2L85 A;  3UV5 A;  2I7K A;  5D3R A;  5DKC A;  4UIW A;  4LJN A;  3PUQ A;  3QZV A;  3DQV R;  4UYH A;  4LAD B;  5ENB A;  1CHC A;  3KQI A;  4O71 A;  5CQ3 A;  4IC2 A;  5CUB A;  3AQA A;  4UYG A;  4YYG A;  5DLZ A;  4YYH A;  5H1U A;  2KYU A;  5I7X A;  4QSR A;  1HYI A;  2LGV A;  4UYF A;  1WEO A;  4ZW1 A;  2ECJ A;  4MR6 A;  3HTK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...