2RI7A

Crystal structure of phd finger-linker-bromodomain y17e mutant from human bptf in the h3(1-9)k4me2 bound state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
168
structure length
168
Chain Sequence
TKLYCICKTPEDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
molecule keywords Nucleosome-remodeling factor subunit BPTF
total genus 58
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2ri7A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ri7A01
2N9GA 4QYDA 5CUCA 5FH6A 4CCGX 5D3JA 4QNSA 3S92A 5FE2A 4A9MA 2H0DA 4BW1A 4YBMA 2G43A 2VPBA 4TU6A 5DW1A 4RVRA 1MM2A 1E4UA 4GNEA 4LADB 3LRQA 4TT2A 5FE8A 3MB3A 5K29A 2UZGA 5CQ7A 3ONIA 5CZGA 2YYRA 2YUCA 2I50A 3L1XA 4MR3A 4O74A 3UW9A 2FUUA 5FG4A 2KGIA 2MNZA 2LQ6A 5J0DA 2RSDA 5FERA 5TCMA 3O33A 1WE9A 4QUUA 3NXBA 1ZBDB 2F6JA 1K2FA 2MNYA 5L96A 1WEWA 4Z6IA 2E7OA 5HELA 5FG6A 4LC2A 4YH4A 2ECNA 2LSPB 5D3RA 5FFVA 4A9FA 2G4AA 5CQTA 4NR8A 2YURA 5G4SA 2EODA 1LDJB 4MEQA 3HMEA 4X2IA 5D1LB 4CFLA 4HXNA 1N87A 2VPGA 4YY6A 2D82A 4R2YA 3P1EA 5C87A 3LQHA 2ECTA 4HXKA 1F62A 5E9MA 2YDWA 4QEVA 4X3GA 4Q6FA 5EM3A 5TB6A 5F25A 4A0CD 4QSUA 3QZSA 4YYJA 3KV5A 5EP7A 5A7CA 4O7BA 2R0YA 5B75A 5E3GA 2OO1A 2D8SA 2F42A 1HYIA 2YYNA 4NYVA 3MHHA 5I7YA 4QSSA 5BT3A 5HENA 2QJ0A 4ZW1A 4PCEA 2E6RA 5BT5A 5CP5A 2HYED 2LXPC 4J3IA 3L1ZB 5ETBA 5D3HA 1FP0A 1CHCA 5CPEA 4O7AA 4Q0NA 3P5OA 5IGLA 2D9EA 5LJ2A 5DYAA 4I7DA 5CUAA 4HXLA 5HQ7A 3RPGC 5KH7A 4BHWA 5KH9A 2ECGA 2C2LA 3T6RA 5A81A 3HCTA 5G0FA 4ZQLA 5DYUA 5D25A 5C11A 5EU1A 1BORA 4IOQA 3U5PA 2ECJA 4LYSA 5DLZA 4YYGA 4WZ0A 4NQMA 4Y03A 5FB1A 5DKCA 5DFCA 4YYNA 4FIPA 4IR3A 3HMFA 4IR5A 4QF2A 3UVWA 3ZTGA 4AP4A 5HFRA 5H1VA 2M1RA 5C7NA 4Z93A 5HCLA 4LDFA 4IR4A 4YBTA 2VJEA 4F52B 3MUKA 3U5JA 5ENIA 4S3OB 5IIDA 3DQVR 5COIA 1X0JA 5CU8A 5DINA 4GPJA 1IYMA 2F6NA 2NXBA 5CUDA 5HFQA 2OXQC 4TU4A 2ECVA 3HCSA 5E7DA 5ACYA 3S91A 4NN2A 2RI7A 4YABA 3ZNIA 3U5KA 2K4DA 5I89A 4AKNA 3AQAA 4L58A 4LR6A 5DLXA 4GNFA 2LGVA 5KTUA 5HM0A 3SOWA 5EYAF 4XY9A 5HJCA 5KHMA 1FBVA 4IC3A 5LJ1A 3G0JA 4UIYA 4O71A 3U5OA 2QIZA 4TTEA 5ENJA 4UYHA 5HRWA 4PCIA 2KU3A 2ECWA 4MR6A 4TKPB 2KREA 4HBXA 5E9IA 4NRAA 5D26A 5EPSA 1X4IA 3ZPVE 4PY6A 2I7KA 2VPEA 2L0BA 4QUTA 4QF3A 5F1LA 3T7LA 2KFTA 3EB6A 4UYFA 3LJWA 5F5ZA 4FJCA 5TABA 5ENCA 3PUQA 5E0RA 3DWYA 2DWWA 4F3IA 1WESA 4ZUXU 3SVGA 2K1JA 4NUDA 4TT6A 4MR5A 5LKXA 1WEPA 2MA5A 4YC9A 5DW2A 4YBSA 4TZ2A 5EWWA 1U6GB 2VJFA 4WZ3B 5B77A 3DPLR 4QZSA 5FE0A 3P1CA 4PPEA 5FG5A 4TS8A 5D3NA 5F1HA 5C89A 4A9HA 3UV2A 1VD4A 3FKMX 2YW8A 4NYXA 4YK0A 3UVDA 1WEVA 4I7CA 5CQAA 4OGJA 5AITA 4A9KA 3SOUA 2MIQA 5BT4A 3I3JA 5DYXA 4NR5A 1WILA 1Z6UA 3UVXA 5I40A 2YSMA 5II1A 4BW4A 4IOOA 1ZS5A 3C6WA 5H1TA 2KWJA 4NQNA 4LJNA 5ENGA 2KR4A 1JM7B 4C9ZA 5J3XA 1WUGA 3JVLA 4J0SA 3SVFA 5D3LA 4MR4A 2CKLB 1Z2QA 4MEPA 2RNXA 4UIWA 5AMEA 4CLBA 5I80A 4UYDA 3N9MA 4FK5A 2FSAA 1EQFA 5IGNA 4AUQB 4LYWA 5FE7A 3GG3A 4QR4A 4V3LC 2YHOA 3JVMA 5HRXA 3O36A 4LK9A 4NUEA 2M6MA 5B76A 2CT2A 5CUGA 5G04B 4YYKA 3GV4A 4QR3A 3MQMA 4FLPA 5B79A 5EI4A 3IHPA 2DVRA 4N3WA 4BJXA 2DKWA 5A5QA 4YY4A 4WHWA 3PHDA 4TT4A 5FE3A 4CUSA 2LN0A 3U5LA 5FEYA 2KTBB 3PURA 4UYGA 2YQMA 4W4UA 4O7EA 4Q0OA 5EK9A 4ZDTA 4LYIA 4O75A 1WUMA 2E6SA 5JWMA 2PNXA 5II2A 2JRJA 2LDRA 4UP0A 2ECIA 4YH3A 5D0CA 3RTRB 2RFJA 5A82A 2LGGA 2EGPA 4CURA 4MVTA 3KV6A 4CUQA 2KE1A 2Y1NA 5EVAA 5IG6A 1VFYA 5FB0A 2L5UA 4HBWA 1WEQA 2C2VS 4YADA 5AD3A 2MD7B 4XI1A 5L8UA 5I29A 2Y43A 3SOXA 5ENBA 5CQ5A 4I7BA 4N4FA 4NYWA 4NS5A 3UV5A 2VJFB 4BW2A 5CTLA 5FE4A 4QY4A 2YEMA 4ALHA 3SHBA 5I88A 4WIVA 5TDRA 4ALGA 3MULA 5LKUA 4QSPA 3LXJA 2CKLA 2KGGA 2G45A 3I2DA 1X4UA 4ZC9A 5DX4A 4QEUA 4A9LA 4UYFB 5E3DA 2MJVB 5HLSA 4YYIA 2H60A 5EWHA 3UVYA 3M63A 4QEWA 5EISA 2I8NA 2VPDA 3EB5A 5FFWA 5G4RA 2DATA 3IU5A 5CUEA 4QSVA 5F36A 1X4JA 5EQ1A 1WENA 2LGKA 3ZYUA 5LCWB 4E96A 4OGIA 3N9NA 3QZTA 5D1MB 4YYDA 4LLBA 4LZRA 4HXOA 3P1FA 5IGKA 4QSQA 3KQIA 4TZ8A 2YHNA 3SVHA 2RNWA 2WP1A 4LZ2A 1WEEA 4QYLA 5C4QA 4CUUA 5EA1A 2OUOA 5E73A 2VP7A 4QB3A 5JI8A 4MSXA 5CGPA 4GNDA 1JSPB 4QSTA 4NUCA 5DYCA 5LJ0A 2HDPA 2L80A 3LQJA 4XYAA 5KTXA 4Z1SA 4MENA 4O7CA 4QR5A 5L99A 4NRBA 5F3AA 4N4IA 4IR6A 4TYLA 4WA6A 3RPGB 5DFDA 5LVRA 5FH7A 1WEMA 5AD2A 4FO9A 3AADA 4WHUA 4J1PA 2KWOA 5FDZA 2DVSA 2PUYA 5E9YA 5EWCA 5FE9A 5CFWA 3D7CA 4A4BA 4BBQA 2YSJA 3L11A 4A9NA 5FBXA 4LKAA 4C67A 5C8GA 2VNFA 1V87A 3ZYQA 5TDWA 4HXPA 4QC1A 2LRIC 3M99A 2JMDA 5FE6A 5A5OA 1VYXA 5H9MA 2AN6A 5LUUA 4AYCB 4HBYA 5F63A 4A9OA 3KNVA 5B8DA 4TQNA 4Z6HA 5DKAA 5FFYA 5CQ3A 2JMJA 2RS9B 2XB1A 3V43A 1JM7A 3HMHA 5D1KB 4UI9B 5D3TA 5E9KA 3MB4A 4YYHA 4UYEA 5IGMA 4AYCA 4XUBA 4J0RA 2VJEB 4XUAA 2L43A 2E7NA 3N9LA 5EPBA 1XWHA 5A5NA 5HQ6A 3P1DA 5I86A 2JMIA 3ZPV1 2KYUA 2R10A 2YEKA 5IBNA 5LKTA 4UIUA 1HYJA 4UIXA 5CUBA 5F60A 3ZVYA 1WGMA 5B78A 3LQIA 5L8TA 4QC3A 5H85A 3MHSA 5H1UA 1JOCA 3JVKA 2YELA 4O70A 4R7EA 2WP2A 1JM4B 5A5RA 3U5MA 4V3KC 2DVVA 2CSZA 4CUPA 1G25A 4UP5A 5TRBA 2YT5A 4CUTA 3N9PA 5EWVA 4PKLA 4NR9A 5DFBA 5CRMA 2ZETC 4QBMA 5DKHA 5HEMA 5CQ6A 5EICA 4QSXA 5ENHA 3HCUA 3Q2EA 5C13A 3N9OA 4KV4A 4B7YC 4KV1A 1MM3A 2FUIA 2L5EA 5F61A 2MD8C 4HXSA 1WFKA 3O7AA 5HQ5A 4N4GA 4A9JA 1DVPA 2YW5A 4Z1QA 1T1HA 3NG2A 3ASLA 3MXFA 4PTBA 1WEUA 3C5KA 4UIZA 2OSSA 4CL9A 2LGLA 4O64A 3QZVA 4B86C 2L84A 5CS8A 3O70A 5KH3A 2YREA 5KTWA 5KU3A 3JVJA 3GL6A 4A9EA 5D3SA 1Z60A 5I83A 4O76A 2YQLA 2NAAA 4N4HA 2K16A 5JG6A 4UIVA 4O78A 4O77A 2RO1A 4NR4A 5E9VA 5D24A 1N72A 2XEUA 2DX8A 5L97A 4LZSA 5AMFA 2R0SA 5DBMA 4GB0A 2BAYA 4CFKA 4YATA 5A83A 4NRCA 3N9QA 5LKZA 3HTKC 5KO4A 4PS5A 2RNYA 5CQ4A 5EGUA 3O37A 4QSRA 4IORA 3O34A 4BW3A 2CSYA 2K17A 5E9LA 5TBNA 2R0VA 2GRCA 2YQDA 5I3LA 1RMDA 2DVQA 4YYMA 2H0DB 1E6IA 4A9IA 3FL2A 4A4CA 5F62A 2MT5A 4YAXA 5CRZA 3VK6A 3TLPA 5I7XA 4NR7A 4IC2A 2Y1MA 4WZ2A 4NXJA 5ETDA 2LV9A 4C66A 4O7FA 3DAIA 5A85A 5I1QA 2KWNA 4GNGA 2L75A 5AIUA 4MEOA 5F2PA 5L98A 4HXRA 4P5OB 2M3HA 5FH8A 3U5NA 3O35A 1WEOA 5G05B 3ZVZB 1WIMA 2E3KA 5DY7A 2M85A 4XY8A 4NR6A 5A5SA 5EV9A 3UV4A 2KWKA 5CQ8A 5LVQA 4OUFA 4A49A 1LDKC 2QICA 4LRGA 5D7XA 5A5PA 4S3OC 5FE1A 5EPRA 5HRVA 4UITA 4HBVA 2MA6A 4DONA 4KCXA 5FE5A 1F68A 2G6QA 3RCWA 2LXHC 3Q2FA 4CA1A 3G0LA 2YU4A 3M62A 2L85A 2MUMA 5E74A 5C85A 2KIZA 4HXMA 4QSWA 5DKDA 4L7XA 5EWDA 5D3PA 3K2JA 4R8PK 2IDAA 5ENEA 5ENFA 4AVXA 2EA6A 3IU6A 4O72A 5CY9A
chains in the Genus database with same CATH superfamily
2N9GA 4QYDA 5CUCA 5FH6A 4CCGX 5D3JA 4QNSA 3S92A 5FE2A 4A9MA 2H0DA 4BW1A 4YBMA 2G43A 2VPBA 4TU6A 5DW1A 4RVRA 1MM2A 1E4UA 4GNEA 4LADB 3LRQA 4TT2A 1DCQA 5FE8A 3MB3A 5K29A 2UZGA 5CQ7A 3ONIA 5CZGA 2YYRA 2B0OE 2I50A 2YUCA 3L1XA 4MR3A 4O74A 3UW9A 2FUUA 5FG4A 2KGIA 2MNZA 2LQ6A 5J0DA 2RSDA 5FERA 5TCMA 3O33A 1WE9A 4QUUA 3NXBA 1ZBDB 2F6JA 1K2FA 2MNYA 5L96A 1WEWA 4Z6IA 2E7OA 5HELA 4OGCA 5FG6A 4OGEA 4LC2A 4YH4A 2ECNA 2LSPB 5D3RA 5FFVA 4A9FA 2G4AA 5CQTA 4NR8A 2YURA 5G4SA 2EODA 1LDJB 4MEQA 3HMEA 4X2IA 5D1LB 4CFLA 4HXNA 1N87A 2LAUA 2VPGA 4YY6A 2D82A 4R2YA 3P1EA 3Q1DA 5C87A 3LQHA 2ECTA 5SVYA 2CRWA 4HXKA 1F62A 5E9MA 2YDWA 4QEVA 4X3GA 4Q6FA 3SUBA 5EM3A 5TB6A 5F25A 4A0CD 4QSUA 3QZSA 4YYJA 3FEHA 5EP7A 3KV5A 5A7CA 4O7BA 2R0YA 5B75A 5E3GA 2OO1A 2D8SA 2F42A 1HYIA 2YYNA 4NYVA 3MHHA 5I7YA 4QSSA 5BT3A 5HENA 2QJ0A 4ZW1A 4PCEA 2E6RA 5BT5A 5CP5A 2HYED 2LXPC 4J3IA 3L1ZB 5ETBA 5D3HA 1FP0A 1CHCA 5CPEA 4O7AA 4Q0NA 3P5OA 5IGLA 2D9EA 5LJ2A 2FFWA 5DYAA 4I7DA 5CUAA 4HXLA 5HQ7A 3RPGC 5KH7A 4BHWA 5KH9A 2ECGA 2C2LA 3T6RA 5A81A 3HCTA 5G0FA 4ZQLA 5DYUA 4H9DA 5D25A 5C11A 5EU1A 1BORA 4IOQA 3U5PA 2ECJA 4LYSA 5DLZA 4YYGA 4WZ0A 4NQMA 4Y03A 5FB1A 5DKCA 5DFCA 4YYNA 4FIPA 4IR3A 3HMFA 4IR5A 4QF2A 3UVWA 3ZTGA 3PLWA 4AP4A 5HFRA 2CONA 5H1VA 2M1RA 5C7NA 4Z93A 5HCLA 4LDFA 4IR4A 4YBTA 2VJEA 4F52B 3MUKA 3U5JA 5ENIA 4S3OB 5IIDA 3DQVR 5COIA 1X0JA 5CU8A 5DINA 4GPJA 1IYMA 2F6NA 2NXBA 5CUDA 5HFQA 2OXQC 4TU4A 2ECVA 3HCSA 5E7DA 5ACYA 3S91A 4NN2A 2RI7A 4YABA 3ZNIA 3U5KA 2K4DA 5I89A 4AKNA 3AQAA 4L58A 4LR6A 5DLXA 4GNFA 2EGMA 2LGVA 5KTUA 5HM0A 3SOWA 5EYAF 3MDBC 4XY9A 5HJCA 5KHMA 1FBVA 4IC3A 5LJ1A 3G0JA 4UIYA 4O71A 3U5OA 2QIZA 4TTEA 5ENJA 2RR4A 4UYHA 5HRWA 4PCIA 1PUOA 2ECWA 4MR6A 2KU3A 2KREA 4TKPB 4HBXA 5E9IA 4NRAA 5D26A 5EPSA 1X4IA 3ZPVE 4PY6A 2I7KA 2VPEA 2E61A 2L0BA 4QUTA 4QF3A 5F1LA 3T7LA 2KFTA 3EB6A 4UYFA 3LJWA 5F5ZA 4FJCA 5TABA 5ENCA 3PUQA 5E0RA 3DWYA 2DWWA 4F3IA 1WESA 4ZUXU 3SVGA 2K1JA 4NUDA 4TT6A 4MR5A 5LKXA 1WEPA 2MA5A 4YC9A 5DW2A 4YBSA 4TZ2A 5EWWA 1U6GB 2VJFA 4WZ3B 5B77A 3DPLR 4QZSA 5FE0A 3P1CA 4PPEA 5FG5A 4TS8A 5D3NA 5F1HA 5C89A 2CSVA 4A9HA 3UV2A 1VD4A 3FKMX 2YW8A 4NYXA 4YK0A 3UVDA 4AKIA 1WEVA 5CQAA 4OGJA 4I7CA 5AITA 4A9KA 3SOUA 2EXUA 2MIQA 5BT4A 3I3JA 5DYXA 4NR5A 1WILA 1Z6UA 3UVXA 5I40A 2YSMA 5II1A 4BW4A 4IOOA 1ZS5A 3C6WA 5H1TA 2KWJA 4NQNA 4LJNA 5ENGA 2KR4A 1JM7B 4C9ZA 5J3XA 1WUGA 3JVLA 4J0SA 3SVFA 5D3LA 4MR4A 2CKLB 1Z2QA 4MEPA 2RNXA 4UIWA 5AMEA 4CLBA 5I80A 4UYDA 3N9MA 4FK5A 2FSAA 1EQFA 5IGNA 4AUQB 2XOYA 4LYWA 5FE7A 3GG3A 4QR4A 4V3LC 2YHOA 3JVMA 5HRXA 3O36A 4LK9A 4NUEA 2M6MA 5B76A 2CT2A 5CUGA 5G04B 4YYKA 3GV4A 4QR3A 3MQMA 4FLPA 5B79A 5EI4A 3IHPA 2DVRA 4N3WA 4BJXA 2DKWA 5A5QA 4YY4A 4WHWA 3PHDA 4TT4A 5FE3A 4CUSA 2LN0A 3U5LA 5FEYA 2KTBB 3PURA 4UYGA 2YQMA 4W4UA 4O7EA 4Q0OA 5EK9A 4ZDTA 4LYIA 2KKXA 4O75A 1WUMA 2E6SA 5JWMA 2PNXA 5II2A 2JRJA 2LDRA 4UP0A 2ECIA 4YH3A 5D0CA 3RTRB 2RFJA 5A82A 2LGGA 2EGPA 4CURA 4MVTA 3KV6A 4CUQA 2KE1A 2Y1NA 5EVAA 5IG6A 3D1DA 4F1PA 1VFYA 5FB0A 2L5UA 4HBWA 1WEQA 2C2VS 4YADA 5AD3A 2MD7B 4XI1A 5L8UA 5I29A 2Y43A 3SOXA 5ENBA 5CQ5A 4I7BA 4N4FA 4NYWA 4NS5A 3UV5A 2VJFB 4BW2A 5CTLA 5FE4A 2XOCA 2M13A 4QY4A 2YEMA 4ALHA 3SHBA 5I88A 4WIVA 5TDRA 4ALGA 3MULA 5LKUA 4QSPA 3LXJA 2CKLA 4O62A 2KGGA 2G45A 3I2DA 1X4UA 4ZC9A 5DX4A 4QEUA 4A9LA 4UYFB 5E3DA 2MJVB 5HLSA 4YYIA 2H60A 5EWHA 3UVYA 3M63A 4QEWA 5EISA 2I8NA 2VPDA 3EB5A 5FFWA 5G4RA 5K3QA 2DATA 3IU5A 5CUEA 4QSVA 5F36A 1X4JA 5EQ1A 1WENA 2LGKA 3ZYUA 2P57A 5LCWB 4E96A 4OGIA 3O47A 3N9NA 3QZTA 3LJUX 4YYDA 4LLBA 5D1MB 4LZRA 4HXOA 3P1FA 3M7KA 5IGKA 4QSQA 3KQIA 4TZ8A 2YHNA 3SVHA 2RNWA 2WP1A 3FAOA 2EJNA 4LZ2A 1WEEA 4QYLA 2MKEA 5C4QA 4CUUA 5EA1A 2OUOA 3T9KA 5E73A 2VP7A 3VKGA 4QB3A 5JI8A 4MSXA 5CGPA 4GNDA 1JSPB 4QSTA 4NUCA 5DYCA 5LJ0A 2HDPA 2L80A 3LQJA 4XYAA 5KTXA 2XP0A 4Z1SA 3JUEA 4MENA 4O7CA 2KKYA 4QR5A 5L99A 4NRBA 5F3AA 3E2DA 4N4IA 4IR6A 2JM3A 4TYLA 4WA6A 3RPGB 5DFDA 5LVRA 5FH7A 1WEMA 5AD2A 4FO9A 3AADA 4WHUA 4J1PA 2KWOA 5FDZA 2DVSA 2PUYA 5E9YA 5EWCA 5FE9A 5CFWA 1MBMA 3D7CA 4A4BA 4BBQA 2YSJA 3L11A 4A9NA 5FBXA 4LKAA 4C67A 5C8GA 2VNFA 1V87A 2D8UA 2FD4A 5SVXA 4HXPA 5TDWA 3ZYQA 4QC1A 2LRIC 3M99A 2JMDA 5FE6A 5A5OA 1VYXA 5H9MA 2AN6A 5LUUA 4AYCB 4HBYA 5F63A 4A9OA 3KNVA 5B8DA 4TQNA 4Z6HA 5DKAA 5FFYA 5CQ3A 2JMJA 2RS9B 2XB1A 3V43A 1JM7A 3HMHA 5D1KB 4UI9B 5D3TA 5E9KA 2IQJA 3MB4A 4YYHA 4UYEA 5IGMA 4AYCA 4XUBA 4J0RA 2VJEB 4XUAA 2L43A 2E7NA 3N9LA 5EPBA 1XWHA 5A5NA 5HQ6A 5SVIB 3P1DA 5I86A 2JMIA 4QQ4A 3ZPV1 2KYUA 2R10A 3LDYA 2YEKA 5IBNA 5LKTA 2DJAA 4UIUA 3LVQE 1HYJA 4UIXA 5CUBA 5F60A 3ZVYA 1WGMA 5B78A 3LQIA 5L8TA 4QC3A 5H85A 3MHSA 5H1UA 1JOCA 2YVRA 3JVKA 2YELA 4O70A 4R7EA 2WP2A 1JM4B 3VKHA 5A5RA 3U5MA 4V3KC 2DVVA 4AI6A 2CSZA 4CUPA 1G25A 3ERRA 5TRBA 2YT5A 4UP5A 4CUTA 3N9PA 5EWVA 4PKLA 2DSMA 4NR9A 2XOZA 5DFBA 5CRMA 2ZETC 4Z0RA 4QBMA 5DKHA 5HEMA 5CQ6A 4QSXA 5EICA 5ENHA 3FANA 3Q2EA 3HCUA 5C13A 3N9OA 4KV4A 4B7YC 4KV1A 1MM3A 2FUIA 3DWDA 2L5EA 5F61A 2MD8C 4HXSA 1WFKA 3O7AA 5HQ5A 4N4GA 4A9JA 1DVPA 2YW5A 4Z1QA 1T1HA 3NG2A 3ASLA 3MXFA 4PTBA 1WEUA 3C5KA 4UIZA 2L7PA 2OSSA 4CL9A 2LGLA 4O64A 3QZVA 3KDEC 4B86C 2L84A 5CS8A 3O70A 5KH3A 2YREA 5KTWA 5KU3A 3JVJA 3GL6A 5SVIA 4A9EA 5D3SA 1Z60A 5I83A 4O76A 2YQLA 2NAAA 4N4HA 2K16A 5JG6A 4UIVA 4O78A 4O77A 2RO1A 4NR4A 5E9VA 5D24A 1N72A 2XEUA 2DX8A 5L97A 4LZSA 5AMFA 3H7HA 1ZKRA 2R0SA 5DBMA 4GB0A 2BAYA 4CFKA 3DDTA 4YATA 5A83A 4NRCA 3N9QA 4AKGA 5LKZA 3HTKC 5KO4A 4PS5A 3D1BA 2RNYA 5CQ4A 5EGUA 3O37A 3FJUB 4QSRA 4IORA 3O34A 4BW3A 2CSYA 3FM8C 2K17A 5E9LA 5TBNA 2R0VA 2GRCA 2YQDA 5I3LA 1RMDA 2DVQA 4YYMA 2H0DB 1E6IA 2JUNA 4A9IA 3FL2A 4A4CA 5F62A 2MT5A 4YAXA 5CRZA 3VK6A 3TLPA 5I7XA 4NR7A 4IC2A 2Y1MA 3LVRE 4WZ2A 4NXJA 5ETDA 2LV9A 4C66A 4O7FA 3DAIA 5A85A 5I1QA 2KWNA 4GNGA 2L75A 5AIUA 4MEOA 5F2PA 5L98A 4HXRA 4P5OB 2M3HA 5FH8A 3U5NA 3O35A 1WEOA 5G05B 3ZVZB 1WIMA 2E3KA 5DY7A 2M85A 4XY8A 4NR6A 5A5SA 5EV9A 3UV4A 2KWKA 5CQ8A 5LVQA 4OUFA 4A49A 1LDKC 2QICA 4LRGA 5D7XA 5A5PA 4S3OC 5FE1A 5EPRA 5HRVA 2CRRA 4UITA 4Z0OA 4HBVA 2MA6A 4DONA 4KCXA 5FE5A 4AKHA 1F68A 2G6QA 3RCWA 2LXHC 3Q2FA 4CA1A 3G0LA 2OWAA 2YU4A 3M62A 2L85A 2MUMA 5E74A 5C85A 2KIZA 4HXMA 4QSWA 5DKDA 4L7XA 5EWDA 5D3PA 3K2JA 4R8PK 2IDAA 5ENEA 5ENFA 4AVXA 2EA6A 3IU6A 4O72A 5CY9A
chains in the Genus database with same CATH topology
2N9GA 4QYDA 5CUCA 5FH6A 4CCGX 5D3JA 4QNSA 3S92A 5FE2A 4A9MA 2H0DA 4BW1A 4YBMA 2G43A 2VPBA 4TU6A 5DW1A 4RVRA 1MM2A 1E4UA 4GNEA 4LADB 3LRQA 4TT2A 5FE8A 3MB3A 5K29A 2UZGA 5CQ7A 3ONIA 5CZGA 2YYRA 2YUCA 2I50A 3L1XA 4MR3A 4O74A 3UW9A 2FUUA 5FG4A 2KGIA 2MNZA 2LQ6A 5J0DA 2RSDA 5FERA 5TCMA 3O33A 1WE9A 4QUUA 3NXBA 1ZBDB 2F6JA 1K2FA 2MNYA 5L96A 1WEWA 4Z6IA 2E7OA 5HELA 5FG6A 4LC2A 4YH4A 2ECNA 2LSPB 5D3RA 5FFVA 4A9FA 2G4AA 5CQTA 4NR8A 2YURA 5G4SA 2EODA 1LDJB 4MEQA 3HMEA 4X2IA 5D1LB 4CFLA 4HXNA 1N87A 2VPGA 4YY6A 2D82A 4R2YA 3P1EA 5C87A 3LQHA 2ECTA 4HXKA 1F62A 5E9MA 2YDWA 4QEVA 4X3GA 4Q6FA 5EM3A 5TB6A 5F25A 4A0CD 4QSUA 3QZSA 4YYJA 3KV5A 5EP7A 5A7CA 4O7BA 2R0YA 5B75A 5E3GA 2OO1A 2D8SA 2F42A 1HYIA 2YYNA 4NYVA 3MHHA 5I7YA 4QSSA 5BT3A 5HENA 2QJ0A 4ZW1A 4PCEA 2E6RA 5BT5A 5CP5A 2HYED 2LXPC 4J3IA 3L1ZB 5ETBA 5D3HA 1FP0A 1CHCA 5CPEA 4O7AA 4Q0NA 3P5OA 5IGLA 2D9EA 5LJ2A 5DYAA 4I7DA 5CUAA 4HXLA 5HQ7A 3RPGC 5KH7A 4BHWA 5KH9A 2ECGA 2C2LA 3T6RA 5A81A 3HCTA 5G0FA 4ZQLA 5DYUA 5D25A 5C11A 5EU1A 1BORA 4IOQA 3U5PA 2ECJA 4LYSA 5DLZA 4YYGA 4WZ0A 4NQMA 4Y03A 5FB1A 5DKCA 5DFCA 4YYNA 4FIPA 4IR3A 3HMFA 4IR5A 4QF2A 3UVWA 3ZTGA 4AP4A 5HFRA 5H1VA 2M1RA 5C7NA 4Z93A 5HCLA 4LDFA 4IR4A 4YBTA 2VJEA 4F52B 3MUKA 3U5JA 5ENIA 4S3OB 5IIDA 3DQVR 5COIA 1X0JA 5CU8A 5DINA 4GPJA 1IYMA 2F6NA 2NXBA 5CUDA 5HFQA 2OXQC 4TU4A 2ECVA 3HCSA 5E7DA 5ACYA 3S91A 4NN2A 2RI7A 4YABA 3ZNIA 3U5KA 2K4DA 5I89A 4AKNA 3AQAA 4L58A 4LR6A 5DLXA 4GNFA 2LGVA 5KTUA 5HM0A 3SOWA 5EYAF 4XY9A 5HJCA 5KHMA 1FBVA 4IC3A 5LJ1A 3G0JA 4UIYA 4O71A 3U5OA 2QIZA 4TTEA 5ENJA 4UYHA 5HRWA 4PCIA 2KU3A 2ECWA 4MR6A 4TKPB 2KREA 4HBXA 5E9IA 4NRAA 5D26A 5EPSA 1X4IA 3ZPVE 4PY6A 2I7KA 2VPEA 2L0BA 4QUTA 4QF3A 5F1LA 3T7LA 2KFTA 3EB6A 4UYFA 3LJWA 5F5ZA 4FJCA 5TABA 5ENCA 3PUQA 5E0RA 3DWYA 2DWWA 4F3IA 1WESA 4ZUXU 3SVGA 2K1JA 4NUDA 4TT6A 4MR5A 5LKXA 1WEPA 2MA5A 4YC9A 5DW2A 4YBSA 4TZ2A 5EWWA 1U6GB 2VJFA 4WZ3B 5B77A 3DPLR 4QZSA 5FE0A 3P1CA 4PPEA 5FG5A 4TS8A 5D3NA 5F1HA 5C89A 4A9HA 3UV2A 1VD4A 3FKMX 2YW8A 4NYXA 4YK0A 3UVDA 1WEVA 4I7CA 5CQAA 4OGJA 5AITA 4A9KA 3SOUA 2MIQA 5BT4A 3I3JA 5DYXA 4NR5A 1WILA 1Z6UA 3UVXA 5I40A 2YSMA 5II1A 4BW4A 4IOOA 1ZS5A 3C6WA 5H1TA 2KWJA 4NQNA 4LJNA 5ENGA 2KR4A 1JM7B 4C9ZA 5J3XA 1WUGA 3JVLA 4J0SA 3SVFA 5D3LA 4MR4A 2CKLB 1Z2QA 4MEPA 2RNXA 4UIWA 5AMEA 4CLBA 5I80A 4UYDA 3N9MA 4FK5A 2FSAA 1EQFA 5IGNA 4AUQB 4LYWA 5FE7A 3GG3A 4QR4A 4V3LC 2YHOA 3JVMA 5HRXA 3O36A 4LK9A 4NUEA 2M6MA 5B76A 2CT2A 5CUGA 5G04B 4YYKA 3GV4A 4QR3A 3MQMA 4FLPA 5B79A 5EI4A 3IHPA 2DVRA 4N3WA 4BJXA 2DKWA 5A5QA 4YY4A 4WHWA 3PHDA 4TT4A 5FE3A 4CUSA 2LN0A 3U5LA 5FEYA 2KTBB 3PURA 4UYGA 2YQMA 4W4UA 4O7EA 4Q0OA 5EK9A 4ZDTA 4LYIA 4O75A 1WUMA 2E6SA 5JWMA 2PNXA 5II2A 2JRJA 2LDRA 4UP0A 2ECIA 4YH3A 5D0CA 3RTRB 2RFJA 5A82A 2LGGA 2EGPA 4CURA 4MVTA 3KV6A 4CUQA 2KE1A 2Y1NA 5EVAA 5IG6A 1VFYA 5FB0A 2L5UA 4HBWA 1WEQA 2C2VS 4YADA 5AD3A 2MD7B 4XI1A 5L8UA 5I29A 2Y43A 3SOXA 5ENBA 5CQ5A 4I7BA 4N4FA 4NYWA 4NS5A 3UV5A 2VJFB 4BW2A 5CTLA 5FE4A 4QY4A 2YEMA 4ALHA 3SHBA 5I88A 4WIVA 5TDRA 4ALGA 3MULA 5LKUA 4QSPA 3LXJA 2CKLA 2KGGA 2G45A 3I2DA 1X4UA 4ZC9A 5DX4A 4QEUA 4A9LA 4UYFB 5E3DA 2MJVB 5HLSA 4YYIA 2H60A 5EWHA 3UVYA 3M63A 4QEWA 5EISA 2I8NA 2VPDA 3EB5A 5FFWA 5G4RA 2DATA 3IU5A 5CUEA 4QSVA 5F36A 1X4JA 5EQ1A 1WENA 2LGKA 3ZYUA 5LCWB 4E96A 4OGIA 3N9NA 3QZTA 5D1MB 4YYDA 4LLBA 4LZRA 4HXOA 3P1FA 5IGKA 4QSQA 3KQIA 4TZ8A 2YHNA 3SVHA 2RNWA 2WP1A 4LZ2A 1WEEA 4QYLA 5C4QA 4CUUA 5EA1A 2OUOA 5E73A 2VP7A 4QB3A 5JI8A 4MSXA 5CGPA 4GNDA 1JSPB 4QSTA 4NUCA 5DYCA 5LJ0A 2HDPA 2L80A 3LQJA 4XYAA 5KTXA 4Z1SA 4MENA 4O7CA 4QR5A 5L99A 4NRBA 5F3AA 4N4IA 4IR6A 4TYLA 4WA6A 3RPGB 5DFDA 5LVRA 5FH7A 1WEMA 5AD2A 4FO9A 3AADA 4WHUA 4J1PA 2KWOA 5FDZA 2DVSA 2PUYA 5E9YA 5EWCA 5FE9A 5CFWA 3D7CA 4A4BA 4BBQA 2YSJA 3L11A 4A9NA 5FBXA 4LKAA 4C67A 5C8GA 2VNFA 1V87A 3ZYQA 5TDWA 4HXPA 4QC1A 2LRIC 3M99A 2JMDA 5FE6A 5A5OA 1VYXA 5H9MA 2AN6A 5LUUA 4AYCB 4HBYA 5F63A 4A9OA 3KNVA 5B8DA 4TQNA 4Z6HA 5DKAA 5FFYA 5CQ3A 2JMJA 2RS9B 2XB1A 3V43A 1JM7A 3HMHA 5D1KB 4UI9B 5D3TA 5E9KA 3MB4A 4YYHA 4UYEA 5IGMA 4AYCA 4XUBA 4J0RA 2VJEB 4XUAA 2L43A 2E7NA 3N9LA 5EPBA 1XWHA 5A5NA 5HQ6A 3P1DA 5I86A 2JMIA 3ZPV1 2KYUA 2R10A 2YEKA 5IBNA 5LKTA 4UIUA 1HYJA 4UIXA 5CUBA 5F60A 3ZVYA 1WGMA 5B78A 3LQIA 5L8TA 4QC3A 5H85A 3MHSA 5H1UA 1JOCA 3JVKA 2YELA 4O70A 4R7EA 2WP2A 1JM4B 5A5RA 3U5MA 4V3KC 2DVVA 2CSZA 4CUPA 1G25A 4UP5A 5TRBA 2YT5A 4CUTA 3N9PA 5EWVA 4PKLA 4NR9A 5DFBA 5CRMA 2ZETC 4QBMA 5DKHA 5HEMA 5CQ6A 5EICA 4QSXA 5ENHA 3HCUA 3Q2EA 5C13A 3N9OA 4KV4A 4B7YC 4KV1A 1MM3A 2FUIA 2L5EA 5F61A 2MD8C 4HXSA 1WFKA 3O7AA 5HQ5A 4N4GA 4A9JA 1DVPA 2YW5A 4Z1QA 1T1HA 3NG2A 3ASLA 3MXFA 4PTBA 1WEUA 3C5KA 4UIZA 2OSSA 4CL9A 2LGLA 4O64A 3QZVA 4B86C 2L84A 5CS8A 3O70A 5KH3A 2YREA 5KTWA 5KU3A 3JVJA 3GL6A 4A9EA 5D3SA 1Z60A 5I83A 4O76A 2YQLA 2NAAA 4N4HA 2K16A 5JG6A 4UIVA 4O78A 4O77A 2RO1A 4NR4A 5E9VA 5D24A 1N72A 2XEUA 2DX8A 5L97A 4LZSA 5AMFA 2R0SA 5DBMA 4GB0A 2BAYA 4CFKA 4YATA 5A83A 4NRCA 3N9QA 5LKZA 3HTKC 5KO4A 4PS5A 2RNYA 5CQ4A 5EGUA 3O37A 4QSRA 4IORA 3O34A 4BW3A 2CSYA 2K17A 5E9LA 5TBNA 2R0VA 2GRCA 2YQDA 5I3LA 1RMDA 2DVQA 4YYMA 2H0DB 1E6IA 4A9IA 3FL2A 4A4CA 5F62A 2MT5A 4YAXA 5CRZA 3VK6A 3TLPA 5I7XA 4NR7A 4IC2A 2Y1MA 4WZ2A 4NXJA 5ETDA 2LV9A 4C66A 4O7FA 3DAIA 5A85A 5I1QA 2KWNA 4GNGA 2L75A 5AIUA 4MEOA 5F2PA 5L98A 4HXRA 4P5OB 2M3HA 5FH8A 3U5NA 3O35A 1WEOA 5G05B 3ZVZB 1WIMA 2E3KA 5DY7A 2M85A 4XY8A 4NR6A 5A5SA 5EV9A 3UV4A 2KWKA 5CQ8A 5LVQA 4OUFA 4A49A 1LDKC 2QICA 4LRGA 5D7XA 5A5PA 4S3OC 5FE1A 5EPRA 5HRVA 4UITA 4HBVA 2MA6A 4DONA 4KCXA 5FE5A 1F68A 2G6QA 3RCWA 2LXHC 3Q2FA 4CA1A 3G0LA 2YU4A 3M62A 2L85A 2MUMA 5E74A 5C85A 2KIZA 4HXMA 4QSWA 5DKDA 4L7XA 5EWDA 5D3PA 3K2JA 4R8PK 2IDAA 5ENEA 5ENFA 4AVXA 2EA6A 3IU6A 4O72A 5CY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9G A;  4QYD A;  5CUC A;  5FH6 A;  4CCG X;  5D3J A;  4QNS A;  3S92 A;  5FE2 A;  4A9M A;  2H0D A;  4BW1 A;  4YBM A;  2G43 A;  2VPB A;  4TU6 A;  5DW1 A;  4RVR A;  1MM2 A;  1E4U A;  4GNE A;  4LAD B;  3LRQ A;  4TT2 A;  5FE8 A;  3MB3 A;  5K29 A;  2UZG A;  5CQ7 A;  3ONI A;  5CZG A;  2YYR A;  2YUC A;  2I50 A;  3L1X A;  4MR3 A;  4O74 A;  3UW9 A;  2FUU A;  5FG4 A;  2KGI A;  2MNZ A;  2LQ6 A;  5J0D A;  2RSD A;  5FER A;  5TCM A;  3O33 A;  1WE9 A;  4QUU A;  3NXB A;  1ZBD B;  2F6J A;  1K2F A;  2MNY A;  5L96 A;  1WEW A;  4Z6I A;  2E7O A;  5HEL A;  5FG6 A;  4LC2 A;  4YH4 A;  2ECN A;  2LSP B;  5D3R A;  5FFV A;  4A9F A;  2G4A A;  5CQT A;  4NR8 A;  2YUR A;  5G4S A;  2EOD A;  1LDJ B;  4MEQ A;  3HME A;  4X2I A;  5D1L B;  4CFL A;  4HXN A;  1N87 A;  2VPG A;  4YY6 A;  2D82 A;  4R2Y A;  3P1E A;  5C87 A;  3LQH A;  2ECT A;  4HXK A;  1F62 A;  5E9M A;  2YDW A;  4QEV A;  4X3G A;  4Q6F A;  5EM3 A;  5TB6 A;  5F25 A;  4A0C D;  4QSU A;  3QZS A;  4YYJ A;  3KV5 A;  5EP7 A;  5A7C A;  4O7B A;  2R0Y A;  5B75 A;  5E3G A;  2OO1 A;  2D8S A;  2F42 A;  1HYI A;  2YYN A;  4NYV A;  3MHH A;  5I7Y A;  4QSS A;  5BT3 A;  5HEN A;  2QJ0 A;  4ZW1 A;  4PCE A;  2E6R A;  5BT5 A;  5CP5 A;  2HYE D;  2LXP C;  4J3I A;  3L1Z B;  5ETB A;  5D3H A;  1FP0 A;  1CHC A;  5CPE A;  4O7A A;  4Q0N A;  3P5O A;  5IGL A;  2D9E A;  5LJ2 A;  5DYA A;  4I7D A;  5CUA A;  4HXL A;  5HQ7 A;  3RPG C;  5KH7 A;  4BHW A;  5KH9 A;  2ECG A;  2C2L A;  3T6R A;  5A81 A;  3HCT A;  5G0F A;  4ZQL A;  5DYU A;  5D25 A;  5C11 A;  5EU1 A;  1BOR A;  4IOQ A;  3U5P A;  2ECJ A;  4LYS A;  5DLZ A;  4YYG A;  4WZ0 A;  4NQM A;  4Y03 A;  5FB1 A;  5DKC A;  5DFC A;  4YYN A;  4FIP A;  4IR3 A;  3HMF A;  4IR5 A;  4QF2 A;  3UVW A;  3ZTG A;  4AP4 A;  5HFR A;  5H1V A;  2M1R A;  5C7N A;  4Z93 A;  5HCL A;  4LDF A;  4IR4 A;  4YBT A;  2VJE A;  4F52 B;  3MUK A;  3U5J A;  5ENI A;  4S3O B;  5IID A;  3DQV R;  5COI A;  1X0J A;  5CU8 A;  5DIN A;  4GPJ A;  1IYM A;  2F6N A;  2NXB A;  5CUD A;  5HFQ A;  2OXQ C;  4TU4 A;  2ECV A;  3HCS A;  5E7D A;  5ACY A;  3S91 A;  4NN2 A;  2RI7 A;  4YAB A;  3ZNI A;  3U5K A;  2K4D A;  5I89 A;  4AKN A;  3AQA A;  4L58 A;  4LR6 A;  5DLX A;  4GNF A;  2LGV A;  5KTU A;  5HM0 A;  3SOW A;  5EYA F;  4XY9 A;  5HJC A;  5KHM A;  1FBV A;  4IC3 A;  5LJ1 A;  3G0J A;  4UIY A;  4O71 A;  3U5O A;  2QIZ A;  4TTE A;  5ENJ A;  4UYH A;  5HRW A;  4PCI A;  2KU3 A;  2ECW A;  4MR6 A;  4TKP B;  2KRE A;  4HBX A;  5E9I A;  4NRA A;  5D26 A;  5EPS A;  1X4I A;  3ZPV E;  4PY6 A;  2I7K A;  2VPE A;  2L0B A;  4QUT A;  4QF3 A;  5F1L A;  3T7L A;  2KFT A;  3EB6 A;  4UYF A;  3LJW A;  5F5Z A;  4FJC A;  5TAB A;  5ENC A;  3PUQ A;  5E0R A;  3DWY A;  2DWW A;  4F3I A;  1WES A;  4ZUX U;  3SVG A;  2K1J A;  4NUD A;  4TT6 A;  4MR5 A;  5LKX A;  1WEP A;  2MA5 A;  4YC9 A;  5DW2 A;  4YBS A;  4TZ2 A;  5EWW A;  1U6G B;  2VJF A;  4WZ3 B;  5B77 A;  3DPL R;  4QZS A;  5FE0 A;  3P1C A;  4PPE A;  5FG5 A;  4TS8 A;  5D3N A;  5F1H A;  5C89 A;  4A9H A;  3UV2 A;  1VD4 A;  3FKM X;  2YW8 A;  4NYX A;  4YK0 A;  3UVD A;  1WEV A;  4I7C A;  5CQA A;  4OGJ A;  5AIT A;  4A9K A;  3SOU A;  2MIQ A;  5BT4 A;  3I3J A;  5DYX A;  4NR5 A;  1WIL A;  1Z6U A;  3UVX A;  5I40 A;  2YSM A;  5II1 A;  4BW4 A;  4IOO A;  1ZS5 A;  3C6W A;  5H1T A;  2KWJ A;  4NQN A;  4LJN A;  5ENG A;  2KR4 A;  1JM7 B;  4C9Z A;  5J3X A;  1WUG A;  3JVL A;  4J0S A;  3SVF A;  5D3L A;  4MR4 A;  2CKL B;  1Z2Q A;  4MEP A;  2RNX A;  4UIW A;  5AME A;  4CLB A;  5I80 A;  4UYD A;  3N9M A;  4FK5 A;  2FSA A;  1EQF A;  5IGN A;  4AUQ B;  4LYW A;  5FE7 A;  3GG3 A;  4QR4 A;  4V3L C;  2YHO A;  3JVM A;  5HRX A;  3O36 A;  4LK9 A;  4NUE A;  2M6M A;  5B76 A;  2CT2 A;  5CUG A;  5G04 B;  4YYK A;  3GV4 A;  4QR3 A;  3MQM A;  4FLP A;  5B79 A;  5EI4 A;  3IHP A;  2DVR A;  4N3W A;  4BJX A;  2DKW A;  5A5Q A;  4YY4 A;  4WHW A;  3PHD A;  4TT4 A;  5FE3 A;  4CUS A;  2LN0 A;  3U5L A;  5FEY A;  2KTB B;  3PUR A;  4UYG A;  2YQM A;  4W4U A;  4O7E A;  4Q0O A;  5EK9 A;  4ZDT A;  4LYI A;  4O75 A;  1WUM A;  2E6S A;  5JWM A;  2PNX A;  5II2 A;  2JRJ A;  2LDR A;  4UP0 A;  2ECI A;  4YH3 A;  5D0C A;  3RTR B;  2RFJ A;  5A82 A;  2LGG A;  2EGP A;  4CUR A;  4MVT A;  3KV6 A;  4CUQ A;  2KE1 A;  2Y1N A;  5EVA A;  5IG6 A;  1VFY A;  5FB0 A;  2L5U A;  4HBW A;  1WEQ A;  2C2V S;  4YAD A;  5AD3 A;  2MD7 B;  4XI1 A;  5L8U A;  5I29 A;  2Y43 A;  3SOX A;  5ENB A;  5CQ5 A;  4I7B A;  4N4F A;  4NYW A;  4NS5 A;  3UV5 A;  2VJF B;  4BW2 A;  5CTL A;  5FE4 A;  4QY4 A;  2YEM A;  4ALH A;  3SHB A;  5I88 A;  4WIV A;  5TDR A;  4ALG A;  3MUL A;  5LKU A;  4QSP A;  3LXJ A;  2CKL A;  2KGG A;  2G45 A;  3I2D A;  1X4U A;  4ZC9 A;  5DX4 A;  4QEU A;  4A9L A;  4UYF B;  5E3D A;  2MJV B;  5HLS A;  4YYI A;  2H60 A;  5EWH A;  3UVY A;  3M63 A;  4QEW A;  5EIS A;  2I8N A;  2VPD A;  3EB5 A;  5FFW A;  5G4R A;  2DAT A;  3IU5 A;  5CUE A;  4QSV A;  5F36 A;  1X4J A;  5EQ1 A;  1WEN A;  2LGK A;  3ZYU A;  5LCW B;  4E96 A;  4OGI A;  3N9N A;  3QZT A;  5D1M B;  4YYD A;  4LLB A;  4LZR A;  4HXO A;  3P1F A;  5IGK A;  4QSQ A;  3KQI A;  4TZ8 A;  2YHN A;  3SVH A;  2RNW A;  2WP1 A;  4LZ2 A;  1WEE A;  4QYL A;  5C4Q A;  4CUU A;  5EA1 A;  2OUO A;  5E73 A;  2VP7 A;  4QB3 A;  5JI8 A;  4MSX A;  5CGP A;  4GND A;  1JSP B;  4QST A;  4NUC A;  5DYC A;  5LJ0 A;  2HDP A;  2L80 A;  3LQJ A;  4XYA A;  5KTX A;  4Z1S A;  4MEN A;  4O7C A;  4QR5 A;  5L99 A;  4NRB A;  5F3A A;  4N4I A;  4IR6 A;  4TYL A;  4WA6 A;  3RPG B;  5DFD A;  5LVR A;  5FH7 A;  1WEM A;  5AD2 A;  4FO9 A;  3AAD A;  4WHU A;  4J1P A;  2KWO A;  5FDZ A;  2DVS A;  2PUY A;  5E9Y A;  5EWC A;  5FE9 A;  5CFW A;  3D7C A;  4A4B A;  4BBQ A;  2YSJ A;  3L11 A;  4A9N A;  5FBX A;  4LKA A;  4C67 A;  5C8G A;  2VNF A;  1V87 A;  3ZYQ A;  5TDW A;  4HXP A;  4QC1 A;  2LRI C;  3M99 A;  2JMD A;  5FE6 A;  5A5O A;  1VYX A;  5H9M A;  2AN6 A;  5LUU A;  4AYC B;  4HBY A;  5F63 A;  4A9O A;  3KNV A;  5B8D A;  4TQN A;  4Z6H A;  5DKA A;  5FFY A;  5CQ3 A;  2JMJ A;  2RS9 B;  2XB1 A;  3V43 A;  1JM7 A;  3HMH A;  5D1K B;  4UI9 B;  5D3T A;  5E9K A;  3MB4 A;  4YYH A;  4UYE A;  5IGM A;  4AYC A;  4XUB A;  4J0R A;  2VJE B;  4XUA A;  2L43 A;  2E7N A;  3N9L A;  5EPB A;  1XWH A;  5A5N A;  5HQ6 A;  3P1D A;  5I86 A;  2JMI A;  3ZPV 1;  2KYU A;  2R10 A;  2YEK A;  5IBN A;  5LKT A;  4UIU A;  1HYJ A;  4UIX A;  5CUB A;  5F60 A;  3ZVY A;  1WGM A;  5B78 A;  3LQI A;  5L8T A;  4QC3 A;  5H85 A;  3MHS A;  5H1U A;  1JOC A;  3JVK A;  2YEL A;  4O70 A;  4R7E A;  2WP2 A;  1JM4 B;  5A5R A;  3U5M A;  4V3K C;  2DVV A;  2CSZ A;  4CUP A;  1G25 A;  4UP5 A;  5TRB A;  2YT5 A;  4CUT A;  3N9P A;  5EWV A;  4PKL A;  4NR9 A;  5DFB A;  5CRM A;  2ZET C;  4QBM A;  5DKH A;  5HEM A;  5CQ6 A;  5EIC A;  4QSX A;  5ENH A;  3HCU A;  3Q2E A;  5C13 A;  3N9O A;  4KV4 A;  4B7Y C;  4KV1 A;  1MM3 A;  2FUI A;  2L5E A;  5F61 A;  2MD8 C;  4HXS A;  1WFK A;  3O7A A;  5HQ5 A;  4N4G A;  4A9J A;  1DVP A;  2YW5 A;  4Z1Q A;  1T1H A;  3NG2 A;  3ASL A;  3MXF A;  4PTB A;  1WEU A;  3C5K A;  4UIZ A;  2OSS A;  4CL9 A;  2LGL A;  4O64 A;  3QZV A;  4B86 C;  2L84 A;  5CS8 A;  3O70 A;  5KH3 A;  2YRE A;  5KTW A;  5KU3 A;  3JVJ A;  3GL6 A;  4A9E A;  5D3S A;  1Z60 A;  5I83 A;  4O76 A;  2YQL A;  2NAA A;  4N4H A;  2K16 A;  5JG6 A;  4UIV A;  4O78 A;  4O77 A;  2RO1 A;  4NR4 A;  5E9V A;  5D24 A;  1N72 A;  2XEU A;  2DX8 A;  5L97 A;  4LZS A;  5AMF A;  2R0S A;  5DBM A;  4GB0 A;  2BAY A;  4CFK A;  4YAT A;  5A83 A;  4NRC A;  3N9Q A;  5LKZ A;  3HTK C;  5KO4 A;  4PS5 A;  2RNY A;  5CQ4 A;  5EGU A;  3O37 A;  4QSR A;  4IOR A;  3O34 A;  4BW3 A;  2CSY A;  2K17 A;  5E9L A;  5TBN A;  2R0V A;  2GRC A;  2YQD A;  5I3L A;  1RMD A;  2DVQ A;  4YYM A;  2H0D B;  1E6I A;  4A9I A;  3FL2 A;  4A4C A;  5F62 A;  2MT5 A;  4YAX A;  5CRZ A;  3VK6 A;  3TLP A;  5I7X A;  4NR7 A;  4IC2 A;  2Y1M A;  4WZ2 A;  4NXJ A;  5ETD A;  2LV9 A;  4C66 A;  4O7F A;  3DAI A;  5A85 A;  5I1Q A;  2KWN A;  4GNG A;  2L75 A;  5AIU A;  4MEO A;  5F2P A;  5L98 A;  4HXR A;  4P5O B;  2M3H A;  5FH8 A;  3U5N A;  3O35 A;  1WEO A;  5G05 B;  3ZVZ B;  1WIM A;  2E3K A;  5DY7 A;  2M85 A;  4XY8 A;  4NR6 A;  5A5S A;  5EV9 A;  3UV4 A;  2KWK A;  5CQ8 A;  5LVQ A;  4OUF A;  4A49 A;  1LDK C;  2QIC A;  4LRG A;  5D7X A;  5A5P A;  4S3O C;  5FE1 A;  5EPR A;  5HRV A;  4UIT A;  4HBV A;  2MA6 A;  4DON A;  4KCX A;  5FE5 A;  1F68 A;  2G6Q A;  3RCW A;  2LXH C;  3Q2F A;  4CA1 A;  3G0L A;  2YU4 A;  3M62 A;  2L85 A;  2MUM A;  5E74 A;  5C85 A;  2KIZ A;  4HXM A;  4QSW A;  5DKD A;  4L7X A;  5EWD A;  5D3P A;  3K2J A;  4R8P K;  2IDA A;  5ENE A;  5ENF A;  4AVX A;  2EA6 A;  3IU6 A;  4O72 A;  5CY9 A; 
#chains in the Genus database with same CATH topology
 2N9G A;  4QYD A;  5CUC A;  5FH6 A;  4CCG X;  5D3J A;  4QNS A;  3S92 A;  5FE2 A;  4A9M A;  2H0D A;  4BW1 A;  4YBM A;  2G43 A;  2VPB A;  4TU6 A;  5DW1 A;  4RVR A;  1MM2 A;  1E4U A;  4GNE A;  4LAD B;  3LRQ A;  4TT2 A;  1DCQ A;  5FE8 A;  3MB3 A;  5K29 A;  2UZG A;  5CQ7 A;  3ONI A;  5CZG A;  2YYR A;  2B0O E;  2I50 A;  2YUC A;  3L1X A;  4MR3 A;  4O74 A;  3UW9 A;  2FUU A;  5FG4 A;  2KGI A;  2MNZ A;  2LQ6 A;  5J0D A;  2RSD A;  5FER A;  5TCM A;  3O33 A;  1WE9 A;  4QUU A;  3NXB A;  1ZBD B;  2F6J A;  1K2F A;  2MNY A;  5L96 A;  1WEW A;  4Z6I A;  2E7O A;  5HEL A;  4OGC A;  5FG6 A;  4OGE A;  4LC2 A;  4YH4 A;  2ECN A;  2LSP B;  5D3R A;  5FFV A;  4A9F A;  2G4A A;  5CQT A;  4NR8 A;  2YUR A;  5G4S A;  2EOD A;  1LDJ B;  4MEQ A;  3HME A;  4X2I A;  5D1L B;  4CFL A;  4HXN A;  1N87 A;  2LAU A;  2VPG A;  4YY6 A;  2D82 A;  4R2Y A;  3P1E A;  3Q1D A;  5C87 A;  3LQH A;  2ECT A;  5SVY A;  2CRW A;  4HXK A;  1F62 A;  5E9M A;  2YDW A;  4QEV A;  4X3G A;  4Q6F A;  3SUB A;  5EM3 A;  5TB6 A;  5F25 A;  4A0C D;  4QSU A;  3QZS A;  4YYJ A;  3FEH A;  5EP7 A;  3KV5 A;  5A7C A;  4O7B A;  2R0Y A;  5B75 A;  5E3G A;  2OO1 A;  2D8S A;  2F42 A;  1HYI A;  2YYN A;  4NYV A;  3MHH A;  5I7Y A;  4QSS A;  5BT3 A;  5HEN A;  2QJ0 A;  4ZW1 A;  4PCE A;  2E6R A;  5BT5 A;  5CP5 A;  2HYE D;  2LXP C;  4J3I A;  3L1Z B;  5ETB A;  5D3H A;  1FP0 A;  1CHC A;  5CPE A;  4O7A A;  4Q0N A;  3P5O A;  5IGL A;  2D9E A;  5LJ2 A;  2FFW A;  5DYA A;  4I7D A;  5CUA A;  4HXL A;  5HQ7 A;  3RPG C;  5KH7 A;  4BHW A;  5KH9 A;  2ECG A;  2C2L A;  3T6R A;  5A81 A;  3HCT A;  5G0F A;  4ZQL A;  5DYU A;  4H9D A;  5D25 A;  5C11 A;  5EU1 A;  1BOR A;  4IOQ A;  3U5P A;  2ECJ A;  4LYS A;  5DLZ A;  4YYG A;  4WZ0 A;  4NQM A;  4Y03 A;  5FB1 A;  5DKC A;  5DFC A;  4YYN A;  4FIP A;  4IR3 A;  3HMF A;  4IR5 A;  4QF2 A;  3UVW A;  3ZTG A;  3PLW A;  4AP4 A;  5HFR A;  2CON A;  5H1V A;  2M1R A;  5C7N A;  4Z93 A;  5HCL A;  4LDF A;  4IR4 A;  4YBT A;  2VJE A;  4F52 B;  3MUK A;  3U5J A;  5ENI A;  4S3O B;  5IID A;  3DQV R;  5COI A;  1X0J A;  5CU8 A;  5DIN A;  4GPJ A;  1IYM A;  2F6N A;  2NXB A;  5CUD A;  5HFQ A;  2OXQ C;  4TU4 A;  2ECV A;  3HCS A;  5E7D A;  5ACY A;  3S91 A;  4NN2 A;  2RI7 A;  4YAB A;  3ZNI A;  3U5K A;  2K4D A;  5I89 A;  4AKN A;  3AQA A;  4L58 A;  4LR6 A;  5DLX A;  4GNF A;  2EGM A;  2LGV A;  5KTU A;  5HM0 A;  3SOW A;  5EYA F;  3MDB C;  4XY9 A;  5HJC A;  5KHM A;  1FBV A;  4IC3 A;  5LJ1 A;  3G0J A;  4UIY A;  4O71 A;  3U5O A;  2QIZ A;  4TTE A;  5ENJ A;  2RR4 A;  4UYH A;  5HRW A;  4PCI A;  1PUO A;  2ECW A;  4MR6 A;  2KU3 A;  2KRE A;  4TKP B;  4HBX A;  5E9I A;  4NRA A;  5D26 A;  5EPS A;  1X4I A;  3ZPV E;  4PY6 A;  2I7K A;  2VPE A;  2E61 A;  2L0B A;  4QUT A;  4QF3 A;  5F1L A;  3T7L A;  2KFT A;  3EB6 A;  4UYF A;  3LJW A;  5F5Z A;  4FJC A;  5TAB A;  5ENC A;  3PUQ A;  5E0R A;  3DWY A;  2DWW A;  4F3I A;  1WES A;  4ZUX U;  3SVG A;  2K1J A;  4NUD A;  4TT6 A;  4MR5 A;  5LKX A;  1WEP A;  2MA5 A;  4YC9 A;  5DW2 A;  4YBS A;  4TZ2 A;  5EWW A;  1U6G B;  2VJF A;  4WZ3 B;  5B77 A;  3DPL R;  4QZS A;  5FE0 A;  3P1C A;  4PPE A;  5FG5 A;  4TS8 A;  5D3N A;  5F1H A;  5C89 A;  2CSV A;  4A9H A;  3UV2 A;  1VD4 A;  3FKM X;  2YW8 A;  4NYX A;  4YK0 A;  3UVD A;  4AKI A;  1WEV A;  5CQA A;  4OGJ A;  4I7C A;  5AIT A;  4A9K A;  3SOU A;  2EXU A;  2MIQ A;  5BT4 A;  3I3J A;  5DYX A;  4NR5 A;  1WIL A;  1Z6U A;  3UVX A;  5I40 A;  2YSM A;  5II1 A;  4BW4 A;  4IOO A;  1ZS5 A;  3C6W A;  5H1T A;  2KWJ A;  4NQN A;  4LJN A;  5ENG A;  2KR4 A;  1JM7 B;  4C9Z A;  5J3X A;  1WUG A;  3JVL A;  4J0S A;  3SVF A;  5D3L A;  4MR4 A;  2CKL B;  1Z2Q A;  4MEP A;  2RNX A;  4UIW A;  5AME A;  4CLB A;  5I80 A;  4UYD A;  3N9M A;  4FK5 A;  2FSA A;  1EQF A;  5IGN A;  4AUQ B;  2XOY A;  4LYW A;  5FE7 A;  3GG3 A;  4QR4 A;  4V3L C;  2YHO A;  3JVM A;  5HRX A;  3O36 A;  4LK9 A;  4NUE A;  2M6M A;  5B76 A;  2CT2 A;  5CUG A;  5G04 B;  4YYK A;  3GV4 A;  4QR3 A;  3MQM A;  4FLP A;  5B79 A;  5EI4 A;  3IHP A;  2DVR A;  4N3W A;  4BJX A;  2DKW A;  5A5Q A;  4YY4 A;  4WHW A;  3PHD A;  4TT4 A;  5FE3 A;  4CUS A;  2LN0 A;  3U5L A;  5FEY A;  2KTB B;  3PUR A;  4UYG A;  2YQM A;  4W4U A;  4O7E A;  4Q0O A;  5EK9 A;  4ZDT A;  4LYI A;  2KKX A;  4O75 A;  1WUM A;  2E6S A;  5JWM A;  2PNX A;  5II2 A;  2JRJ A;  2LDR A;  4UP0 A;  2ECI A;  4YH3 A;  5D0C A;  3RTR B;  2RFJ A;  5A82 A;  2LGG A;  2EGP A;  4CUR A;  4MVT A;  3KV6 A;  4CUQ A;  2KE1 A;  2Y1N A;  5EVA A;  5IG6 A;  3D1D A;  4F1P A;  1VFY A;  5FB0 A;  2L5U A;  4HBW A;  1WEQ A;  2C2V S;  4YAD A;  5AD3 A;  2MD7 B;  4XI1 A;  5L8U A;  5I29 A;  2Y43 A;  3SOX A;  5ENB A;  5CQ5 A;  4I7B A;  4N4F A;  4NYW A;  4NS5 A;  3UV5 A;  2VJF B;  4BW2 A;  5CTL A;  5FE4 A;  2XOC A;  2M13 A;  4QY4 A;  2YEM A;  4ALH A;  3SHB A;  5I88 A;  4WIV A;  5TDR A;  4ALG A;  3MUL A;  5LKU A;  4QSP A;  3LXJ A;  2CKL A;  4O62 A;  2KGG A;  2G45 A;  3I2D A;  1X4U A;  4ZC9 A;  5DX4 A;  4QEU A;  4A9L A;  4UYF B;  5E3D A;  2MJV B;  5HLS A;  4YYI A;  2H60 A;  5EWH A;  3UVY A;  3M63 A;  4QEW A;  5EIS A;  2I8N A;  2VPD A;  3EB5 A;  5FFW A;  5G4R A;  5K3Q A;  2DAT A;  3IU5 A;  5CUE A;  4QSV A;  5F36 A;  1X4J A;  5EQ1 A;  1WEN A;  2LGK A;  3ZYU A;  2P57 A;  5LCW B;  4E96 A;  4OGI A;  3O47 A;  3N9N A;  3QZT A;  3LJU X;  4YYD A;  4LLB A;  5D1M B;  4LZR A;  4HXO A;  3P1F A;  3M7K A;  5IGK A;  4QSQ A;  3KQI A;  4TZ8 A;  2YHN A;  3SVH A;  2RNW A;  2WP1 A;  3FAO A;  2EJN A;  4LZ2 A;  1WEE A;  4QYL A;  2MKE A;  5C4Q A;  4CUU A;  5EA1 A;  2OUO A;  3T9K A;  5E73 A;  2VP7 A;  3VKG A;  4QB3 A;  5JI8 A;  4MSX A;  5CGP A;  4GND A;  1JSP B;  4QST A;  4NUC A;  5DYC A;  5LJ0 A;  2HDP A;  2L80 A;  3LQJ A;  4XYA A;  5KTX A;  2XP0 A;  4Z1S A;  3JUE A;  4MEN A;  4O7C A;  2KKY A;  4QR5 A;  5L99 A;  4NRB A;  5F3A A;  3E2D A;  4N4I A;  4IR6 A;  2JM3 A;  4TYL A;  4WA6 A;  3RPG B;  5DFD A;  5LVR A;  5FH7 A;  1WEM A;  5AD2 A;  4FO9 A;  3AAD A;  4WHU A;  4J1P A;  2KWO A;  5FDZ A;  2DVS A;  2PUY A;  5E9Y A;  5EWC A;  5FE9 A;  5CFW A;  1MBM A;  3D7C A;  4A4B A;  4BBQ A;  2YSJ A;  3L11 A;  4A9N A;  5FBX A;  4LKA A;  4C67 A;  5C8G A;  2VNF A;  1V87 A;  2D8U A;  2FD4 A;  5SVX A;  4HXP A;  5TDW A;  3ZYQ A;  4QC1 A;  2LRI C;  3M99 A;  2JMD A;  5FE6 A;  5A5O A;  1VYX A;  5H9M A;  2AN6 A;  5LUU A;  4AYC B;  4HBY A;  5F63 A;  4A9O A;  3KNV A;  5B8D A;  4TQN A;  4Z6H A;  5DKA A;  5FFY A;  5CQ3 A;  2JMJ A;  2RS9 B;  2XB1 A;  3V43 A;  1JM7 A;  3HMH A;  5D1K B;  4UI9 B;  5D3T A;  5E9K A;  2IQJ A;  3MB4 A;  4YYH A;  4UYE A;  5IGM A;  4AYC A;  4XUB A;  4J0R A;  2VJE B;  4XUA A;  2L43 A;  2E7N A;  3N9L A;  5EPB A;  1XWH A;  5A5N A;  5HQ6 A;  5SVI B;  3P1D A;  5I86 A;  2JMI A;  4QQ4 A;  3ZPV 1;  2KYU A;  2R10 A;  3LDY A;  2YEK A;  5IBN A;  5LKT A;  2DJA A;  4UIU A;  3LVQ E;  1HYJ A;  4UIX A;  5CUB A;  5F60 A;  3ZVY A;  1WGM A;  5B78 A;  3LQI A;  5L8T A;  4QC3 A;  5H85 A;  3MHS A;  5H1U A;  1JOC A;  2YVR A;  3JVK A;  2YEL A;  4O70 A;  4R7E A;  2WP2 A;  1JM4 B;  3VKH A;  5A5R A;  3U5M A;  4V3K C;  2DVV A;  4AI6 A;  2CSZ A;  4CUP A;  1G25 A;  3ERR A;  5TRB A;  2YT5 A;  4UP5 A;  4CUT A;  3N9P A;  5EWV A;  4PKL A;  2DSM A;  4NR9 A;  2XOZ A;  5DFB A;  5CRM A;  2ZET C;  4Z0R A;  4QBM A;  5DKH A;  5HEM A;  5CQ6 A;  4QSX A;  5EIC A;  5ENH A;  3FAN A;  3Q2E A;  3HCU A;  5C13 A;  3N9O A;  4KV4 A;  4B7Y C;  4KV1 A;  1MM3 A;  2FUI A;  3DWD A;  2L5E A;  5F61 A;  2MD8 C;  4HXS A;  1WFK A;  3O7A A;  5HQ5 A;  4N4G A;  4A9J A;  1DVP A;  2YW5 A;  4Z1Q A;  1T1H A;  3NG2 A;  3ASL A;  3MXF A;  4PTB A;  1WEU A;  3C5K A;  4UIZ A;  2L7P A;  2OSS A;  4CL9 A;  2LGL A;  4O64 A;  3QZV A;  3KDE C;  4B86 C;  2L84 A;  5CS8 A;  3O70 A;  5KH3 A;  2YRE A;  5KTW A;  5KU3 A;  3JVJ A;  3GL6 A;  5SVI A;  4A9E A;  5D3S A;  1Z60 A;  5I83 A;  4O76 A;  2YQL A;  2NAA A;  4N4H A;  2K16 A;  5JG6 A;  4UIV A;  4O78 A;  4O77 A;  2RO1 A;  4NR4 A;  5E9V A;  5D24 A;  1N72 A;  2XEU A;  2DX8 A;  5L97 A;  4LZS A;  5AMF A;  3H7H A;  1ZKR A;  2R0S A;  5DBM A;  4GB0 A;  2BAY A;  4CFK A;  3DDT A;  4YAT A;  5A83 A;  4NRC A;  3N9Q A;  4AKG A;  5LKZ A;  3HTK C;  5KO4 A;  4PS5 A;  3D1B A;  2RNY A;  5CQ4 A;  5EGU A;  3O37 A;  3FJU B;  4QSR A;  4IOR A;  3O34 A;  4BW3 A;  2CSY A;  3FM8 C;  2K17 A;  5E9L A;  5TBN A;  2R0V A;  2GRC A;  2YQD A;  5I3L A;  1RMD A;  2DVQ A;  4YYM A;  2H0D B;  1E6I A;  2JUN A;  4A9I A;  3FL2 A;  4A4C A;  5F62 A;  2MT5 A;  4YAX A;  5CRZ A;  3VK6 A;  3TLP A;  5I7X A;  4NR7 A;  4IC2 A;  2Y1M A;  3LVR E;  4WZ2 A;  4NXJ A;  5ETD A;  2LV9 A;  4C66 A;  4O7F A;  3DAI A;  5A85 A;  5I1Q A;  2KWN A;  4GNG A;  2L75 A;  5AIU A;  4MEO A;  5F2P A;  5L98 A;  4HXR A;  4P5O B;  2M3H A;  5FH8 A;  3U5N A;  3O35 A;  1WEO A;  5G05 B;  3ZVZ B;  1WIM A;  2E3K A;  5DY7 A;  2M85 A;  4XY8 A;  4NR6 A;  5A5S A;  5EV9 A;  3UV4 A;  2KWK A;  5CQ8 A;  5LVQ A;  4OUF A;  4A49 A;  1LDK C;  2QIC A;  4LRG A;  5D7X A;  5A5P A;  4S3O C;  5FE1 A;  5EPR A;  5HRV A;  2CRR A;  4UIT A;  4Z0O A;  4HBV A;  2MA6 A;  4DON A;  4KCX A;  5FE5 A;  4AKH A;  1F68 A;  2G6Q A;  3RCW A;  2LXH C;  3Q2F A;  4CA1 A;  3G0L A;  2OWA A;  2YU4 A;  3M62 A;  2L85 A;  2MUM A;  5E74 A;  5C85 A;  2KIZ A;  4HXM A;  4QSW A;  5DKD A;  4L7X A;  5EWD A;  5D3P A;  3K2J A;  4R8P K;  2IDA A;  5ENE A;  5ENF A;  4AVX A;  2EA6 A;  3IU6 A;  4O72 A;  5CY9 A; 
#chains in the Genus database with same CATH homology
 2N9G A;  4QYD A;  5CUC A;  5FH6 A;  4CCG X;  5D3J A;  4QNS A;  3S92 A;  5FE2 A;  4A9M A;  2H0D A;  4BW1 A;  4YBM A;  2G43 A;  2VPB A;  4TU6 A;  5DW1 A;  4RVR A;  1MM2 A;  1E4U A;  4GNE A;  4LAD B;  3LRQ A;  4TT2 A;  5FE8 A;  3MB3 A;  5K29 A;  2UZG A;  5CQ7 A;  3ONI A;  5CZG A;  2YYR A;  2YUC A;  2I50 A;  3L1X A;  4MR3 A;  4O74 A;  3UW9 A;  2FUU A;  5FG4 A;  2KGI A;  2MNZ A;  2LQ6 A;  5J0D A;  2RSD A;  5FER A;  5TCM A;  3O33 A;  1WE9 A;  4QUU A;  3NXB A;  1ZBD B;  2F6J A;  1K2F A;  2MNY A;  5L96 A;  1WEW A;  4Z6I A;  2E7O A;  5HEL A;  5FG6 A;  4LC2 A;  4YH4 A;  2ECN A;  2LSP B;  5D3R A;  5FFV A;  4A9F A;  2G4A A;  5CQT A;  4NR8 A;  2YUR A;  5G4S A;  2EOD A;  1LDJ B;  4MEQ A;  3HME A;  4X2I A;  5D1L B;  4CFL A;  4HXN A;  1N87 A;  2VPG A;  4YY6 A;  2D82 A;  4R2Y A;  3P1E A;  5C87 A;  3LQH A;  2ECT A;  4HXK A;  1F62 A;  5E9M A;  2YDW A;  4QEV A;  4X3G A;  4Q6F A;  5EM3 A;  5TB6 A;  5F25 A;  4A0C D;  4QSU A;  3QZS A;  4YYJ A;  3KV5 A;  5EP7 A;  5A7C A;  4O7B A;  2R0Y A;  5B75 A;  5E3G A;  2OO1 A;  2D8S A;  2F42 A;  1HYI A;  2YYN A;  4NYV A;  3MHH A;  5I7Y A;  4QSS A;  5BT3 A;  5HEN A;  2QJ0 A;  4ZW1 A;  4PCE A;  2E6R A;  5BT5 A;  5CP5 A;  2HYE D;  2LXP C;  4J3I A;  3L1Z B;  5ETB A;  5D3H A;  1FP0 A;  1CHC A;  5CPE A;  4O7A A;  4Q0N A;  3P5O A;  5IGL A;  2D9E A;  5LJ2 A;  5DYA A;  4I7D A;  5CUA A;  4HXL A;  5HQ7 A;  3RPG C;  5KH7 A;  4BHW A;  5KH9 A;  2ECG A;  2C2L A;  3T6R A;  5A81 A;  3HCT A;  5G0F A;  4ZQL A;  5DYU A;  5D25 A;  5C11 A;  5EU1 A;  1BOR A;  4IOQ A;  3U5P A;  2ECJ A;  4LYS A;  5DLZ A;  4YYG A;  4WZ0 A;  4NQM A;  4Y03 A;  5FB1 A;  5DKC A;  5DFC A;  4YYN A;  4FIP A;  4IR3 A;  3HMF A;  4IR5 A;  4QF2 A;  3UVW A;  3ZTG A;  4AP4 A;  5HFR A;  5H1V A;  2M1R A;  5C7N A;  4Z93 A;  5HCL A;  4LDF A;  4IR4 A;  4YBT A;  2VJE A;  4F52 B;  3MUK A;  3U5J A;  5ENI A;  4S3O B;  5IID A;  3DQV R;  5COI A;  1X0J A;  5CU8 A;  5DIN A;  4GPJ A;  1IYM A;  2F6N A;  2NXB A;  5CUD A;  5HFQ A;  2OXQ C;  4TU4 A;  2ECV A;  3HCS A;  5E7D A;  5ACY A;  3S91 A;  4NN2 A;  2RI7 A;  4YAB A;  3ZNI A;  3U5K A;  2K4D A;  5I89 A;  4AKN A;  3AQA A;  4L58 A;  4LR6 A;  5DLX A;  4GNF A;  2LGV A;  5KTU A;  5HM0 A;  3SOW A;  5EYA F;  4XY9 A;  5HJC A;  5KHM A;  1FBV A;  4IC3 A;  5LJ1 A;  3G0J A;  4UIY A;  4O71 A;  3U5O A;  2QIZ A;  4TTE A;  5ENJ A;  4UYH A;  5HRW A;  4PCI A;  2KU3 A;  2ECW A;  4MR6 A;  4TKP B;  2KRE A;  4HBX A;  5E9I A;  4NRA A;  5D26 A;  5EPS A;  1X4I A;  3ZPV E;  4PY6 A;  2I7K A;  2VPE A;  2L0B A;  4QUT A;  4QF3 A;  5F1L A;  3T7L A;  2KFT A;  3EB6 A;  4UYF A;  3LJW A;  5F5Z A;  4FJC A;  5TAB A;  5ENC A;  3PUQ A;  5E0R A;  3DWY A;  2DWW A;  4F3I A;  1WES A;  4ZUX U;  3SVG A;  2K1J A;  4NUD A;  4TT6 A;  4MR5 A;  5LKX A;  1WEP A;  2MA5 A;  4YC9 A;  5DW2 A;  4YBS A;  4TZ2 A;  5EWW A;  1U6G B;  2VJF A;  4WZ3 B;  5B77 A;  3DPL R;  4QZS A;  5FE0 A;  3P1C A;  4PPE A;  5FG5 A;  4TS8 A;  5D3N A;  5F1H A;  5C89 A;  4A9H A;  3UV2 A;  1VD4 A;  3FKM X;  2YW8 A;  4NYX A;  4YK0 A;  3UVD A;  1WEV A;  4I7C A;  5CQA A;  4OGJ A;  5AIT A;  4A9K A;  3SOU A;  2MIQ A;  5BT4 A;  3I3J A;  5DYX A;  4NR5 A;  1WIL A;  1Z6U A;  3UVX A;  5I40 A;  2YSM A;  5II1 A;  4BW4 A;  4IOO A;  1ZS5 A;  3C6W A;  5H1T A;  2KWJ A;  4NQN A;  4LJN A;  5ENG A;  2KR4 A;  1JM7 B;  4C9Z A;  5J3X A;  1WUG A;  3JVL A;  4J0S A;  3SVF A;  5D3L A;  4MR4 A;  2CKL B;  1Z2Q A;  4MEP A;  2RNX A;  4UIW A;  5AME A;  4CLB A;  5I80 A;  4UYD A;  3N9M A;  4FK5 A;  2FSA A;  1EQF A;  5IGN A;  4AUQ B;  4LYW A;  5FE7 A;  3GG3 A;  4QR4 A;  4V3L C;  2YHO A;  3JVM A;  5HRX A;  3O36 A;  4LK9 A;  4NUE A;  2M6M A;  5B76 A;  2CT2 A;  5CUG A;  5G04 B;  4YYK A;  3GV4 A;  4QR3 A;  3MQM A;  4FLP A;  5B79 A;  5EI4 A;  3IHP A;  2DVR A;  4N3W A;  4BJX A;  2DKW A;  5A5Q A;  4YY4 A;  4WHW A;  3PHD A;  4TT4 A;  5FE3 A;  4CUS A;  2LN0 A;  3U5L A;  5FEY A;  2KTB B;  3PUR A;  4UYG A;  2YQM A;  4W4U A;  4O7E A;  4Q0O A;  5EK9 A;  4ZDT A;  4LYI A;  4O75 A;  1WUM A;  2E6S A;  5JWM A;  2PNX A;  5II2 A;  2JRJ A;  2LDR A;  4UP0 A;  2ECI A;  4YH3 A;  5D0C A;  3RTR B;  2RFJ A;  5A82 A;  2LGG A;  2EGP A;  4CUR A;  4MVT A;  3KV6 A;  4CUQ A;  2KE1 A;  2Y1N A;  5EVA A;  5IG6 A;  1VFY A;  5FB0 A;  2L5U A;  4HBW A;  1WEQ A;  2C2V S;  4YAD A;  5AD3 A;  2MD7 B;  4XI1 A;  5L8U A;  5I29 A;  2Y43 A;  3SOX A;  5ENB A;  5CQ5 A;  4I7B A;  4N4F A;  4NYW A;  4NS5 A;  3UV5 A;  2VJF B;  4BW2 A;  5CTL A;  5FE4 A;  4QY4 A;  2YEM A;  4ALH A;  3SHB A;  5I88 A;  4WIV A;  5TDR A;  4ALG A;  3MUL A;  5LKU A;  4QSP A;  3LXJ A;  2CKL A;  2KGG A;  2G45 A;  3I2D A;  1X4U A;  4ZC9 A;  5DX4 A;  4QEU A;  4A9L A;  4UYF B;  5E3D A;  2MJV B;  5HLS A;  4YYI A;  2H60 A;  5EWH A;  3UVY A;  3M63 A;  4QEW A;  5EIS A;  2I8N A;  2VPD A;  3EB5 A;  5FFW A;  5G4R A;  2DAT A;  3IU5 A;  5CUE A;  4QSV A;  5F36 A;  1X4J A;  5EQ1 A;  1WEN A;  2LGK A;  3ZYU A;  5LCW B;  4E96 A;  4OGI A;  3N9N A;  3QZT A;  5D1M B;  4YYD A;  4LLB A;  4LZR A;  4HXO A;  3P1F A;  5IGK A;  4QSQ A;  3KQI A;  4TZ8 A;  2YHN A;  3SVH A;  2RNW A;  2WP1 A;  4LZ2 A;  1WEE A;  4QYL A;  5C4Q A;  4CUU A;  5EA1 A;  2OUO A;  5E73 A;  2VP7 A;  4QB3 A;  5JI8 A;  4MSX A;  5CGP A;  4GND A;  1JSP B;  4QST A;  4NUC A;  5DYC A;  5LJ0 A;  2HDP A;  2L80 A;  3LQJ A;  4XYA A;  5KTX A;  4Z1S A;  4MEN A;  4O7C A;  4QR5 A;  5L99 A;  4NRB A;  5F3A A;  4N4I A;  4IR6 A;  4TYL A;  4WA6 A;  3RPG B;  5DFD A;  5LVR A;  5FH7 A;  1WEM A;  5AD2 A;  4FO9 A;  3AAD A;  4WHU A;  4J1P A;  2KWO A;  5FDZ A;  2DVS A;  2PUY A;  5E9Y A;  5EWC A;  5FE9 A;  5CFW A;  3D7C A;  4A4B A;  4BBQ A;  2YSJ A;  3L11 A;  4A9N A;  5FBX A;  4LKA A;  4C67 A;  5C8G A;  2VNF A;  1V87 A;  3ZYQ A;  5TDW A;  4HXP A;  4QC1 A;  2LRI C;  3M99 A;  2JMD A;  5FE6 A;  5A5O A;  1VYX A;  5H9M A;  2AN6 A;  5LUU A;  4AYC B;  4HBY A;  5F63 A;  4A9O A;  3KNV A;  5B8D A;  4TQN A;  4Z6H A;  5DKA A;  5FFY A;  5CQ3 A;  2JMJ A;  2RS9 B;  2XB1 A;  3V43 A;  1JM7 A;  3HMH A;  5D1K B;  4UI9 B;  5D3T A;  5E9K A;  3MB4 A;  4YYH A;  4UYE A;  5IGM A;  4AYC A;  4XUB A;  4J0R A;  2VJE B;  4XUA A;  2L43 A;  2E7N A;  3N9L A;  5EPB A;  1XWH A;  5A5N A;  5HQ6 A;  3P1D A;  5I86 A;  2JMI A;  3ZPV 1;  2KYU A;  2R10 A;  2YEK A;  5IBN A;  5LKT A;  4UIU A;  1HYJ A;  4UIX A;  5CUB A;  5F60 A;  3ZVY A;  1WGM A;  5B78 A;  3LQI A;  5L8T A;  4QC3 A;  5H85 A;  3MHS A;  5H1U A;  1JOC A;  3JVK A;  2YEL A;  4O70 A;  4R7E A;  2WP2 A;  1JM4 B;  5A5R A;  3U5M A;  4V3K C;  2DVV A;  2CSZ A;  4CUP A;  1G25 A;  4UP5 A;  5TRB A;  2YT5 A;  4CUT A;  3N9P A;  5EWV A;  4PKL A;  4NR9 A;  5DFB A;  5CRM A;  2ZET C;  4QBM A;  5DKH A;  5HEM A;  5CQ6 A;  5EIC A;  4QSX A;  5ENH A;  3HCU A;  3Q2E A;  5C13 A;  3N9O A;  4KV4 A;  4B7Y C;  4KV1 A;  1MM3 A;  2FUI A;  2L5E A;  5F61 A;  2MD8 C;  4HXS A;  1WFK A;  3O7A A;  5HQ5 A;  4N4G A;  4A9J A;  1DVP A;  2YW5 A;  4Z1Q A;  1T1H A;  3NG2 A;  3ASL A;  3MXF A;  4PTB A;  1WEU A;  3C5K A;  4UIZ A;  2OSS A;  4CL9 A;  2LGL A;  4O64 A;  3QZV A;  4B86 C;  2L84 A;  5CS8 A;  3O70 A;  5KH3 A;  2YRE A;  5KTW A;  5KU3 A;  3JVJ A;  3GL6 A;  4A9E A;  5D3S A;  1Z60 A;  5I83 A;  4O76 A;  2YQL A;  2NAA A;  4N4H A;  2K16 A;  5JG6 A;  4UIV A;  4O78 A;  4O77 A;  2RO1 A;  4NR4 A;  5E9V A;  5D24 A;  1N72 A;  2XEU A;  2DX8 A;  5L97 A;  4LZS A;  5AMF A;  2R0S A;  5DBM A;  4GB0 A;  2BAY A;  4CFK A;  4YAT A;  5A83 A;  4NRC A;  3N9Q A;  5LKZ A;  3HTK C;  5KO4 A;  4PS5 A;  2RNY A;  5CQ4 A;  5EGU A;  3O37 A;  4QSR A;  4IOR A;  3O34 A;  4BW3 A;  2CSY A;  2K17 A;  5E9L A;  5TBN A;  2R0V A;  2GRC A;  2YQD A;  5I3L A;  1RMD A;  2DVQ A;  4YYM A;  2H0D B;  1E6I A;  4A9I A;  3FL2 A;  4A4C A;  5F62 A;  2MT5 A;  4YAX A;  5CRZ A;  3VK6 A;  3TLP A;  5I7X A;  4NR7 A;  4IC2 A;  2Y1M A;  4WZ2 A;  4NXJ A;  5ETD A;  2LV9 A;  4C66 A;  4O7F A;  3DAI A;  5A85 A;  5I1Q A;  2KWN A;  4GNG A;  2L75 A;  5AIU A;  4MEO A;  5F2P A;  5L98 A;  4HXR A;  4P5O B;  2M3H A;  5FH8 A;  3U5N A;  3O35 A;  1WEO A;  5G05 B;  3ZVZ B;  1WIM A;  2E3K A;  5DY7 A;  2M85 A;  4XY8 A;  4NR6 A;  5A5S A;  5EV9 A;  3UV4 A;  2KWK A;  5CQ8 A;  5LVQ A;  4OUF A;  4A49 A;  1LDK C;  2QIC A;  4LRG A;  5D7X A;  5A5P A;  4S3O C;  5FE1 A;  5EPR A;  5HRV A;  4UIT A;  4HBV A;  2MA6 A;  4DON A;  4KCX A;  5FE5 A;  1F68 A;  2G6Q A;  3RCW A;  2LXH C;  3Q2F A;  4CA1 A;  3G0L A;  2YU4 A;  3M62 A;  2L85 A;  2MUM A;  5E74 A;  5C85 A;  2KIZ A;  4HXM A;  4QSW A;  5DKD A;  4L7X A;  5EWD A;  5D3P A;  3K2J A;  4R8P K;  2IDA A;  5ENE A;  5ENF A;  4AVX A;  2EA6 A;  3IU6 A;  4O72 A;  5CY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...