2RI7A

Crystal structure of phd finger-linker-bromodomain y17e mutant from human bptf in the h3(1-9)k4me2 bound state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
168
structure length
168
Chain Sequence
b'TKLYCICKTPEDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome-remodeling factor subunit BPTF
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
total genus 58
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2ri7A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ri7A01
4I7DA 5EA1A 5II2A 1LDJB 4Q0OA 3U5OA 1HYJA 4UITA 4NUDA 1WESA 1WFKA 2VNFA 2E7OA 2OXQC 2VPGA 5I1QA 3SVHA 2MT5A 5ENFA 4UYGA 4L7XA 4NYVA 5KH9A 4C9ZA 4NR9A 4HXSA 1WIMA 5JI8A 5DYUA 3O37A 4YBMA 3RPGC 4KV1A 4LJNA 4NR8A 3C6WA 5D3NA 4O70A 4OGIA 3ZVZB 4LZSA 5HFRA 4QSTA 4LDFA 5LJ0A 4C66A 1WILA 2I8NA 5F25A 4AYCB 4ALGA 3O35A 4Z1SA 3U5JA 4IR4A 5BT3A 5F61A 2YYNA 5EYAF 4QR5A 5DKCA 5D26A 4FLPA 5L99A 4TZ8A 3M63A 4XI1A 4AP4A 5FFWA 2RO1A 3ASLA 2YYRA 5CQTA 4J0RA 4Q0NA 5D3HA 1WEMA 4N4IA 2GRCA 5DW1A 4XUBA 5ENJA 2CKLB 4QSSA 5TRBA 4A9LA 3SOXA 3GG3A 5HM0A 4HBYA 3HMHA 4UYHA 4FJCA 5EICA 2LV9A 4WHUA 4YY6A 5JWMA 2F6NA 3MULA 1RMDA 3PUQA 5EPRA 4QSXA 4HBVA 5DBMA 5HQ5A 5I86A 2JMJA 3GV4A 5A5NA 4IC2A 5H1UA 2DATA 5KO4A 4NXJA 4HBXA 5EV9A 2YSJA 4QC3A 5IBNA 4NRAA 2ECJA 5I7XA 4YYNA 2KWNA 4C67A 2MNYA 4GNDA 1K2FA 4NS5A 5FG6A 5FBXA 5B79A 1IYMA 3DQVR 4UP5A 5DKDA 4Z6HA 2FUUA 5KH3A 1JM7A 5FH7A 4YH3A 5HRXA 1Z60A 4YATA 1F68A 2C2LA 3N9QA 5CGPA 5L97A 2PUYA 4GNFA 1WEUA 3MUKA 2L0BA 2RI7A 4FIPA 3FKMX 4PY6A 4WA6A 4R7EA 1JM4B 5B78A 5LCWB 5I80A 5J3XA 5CP5A 4A9EA 1CHCA 2KE1A 5DINA 2K4DA 2L43A 5J0DA 5FFYA 4UP0A 4KCXA 5F2PA 5L8TA 3JVJA 2L75A 4DONA 5G0FA 5CQ7A 4AKNA 3HCSA 2I50A 4MR4A 5DY7A 5E7DA 5HQ6A 4N4HA 4LZRA 2RS9B 4O7EA 4A4CA 2OO1A 3P5OA 4CFLA 3HCUA 3LQIA 5I89A 4YADA 1E4UA 2VPBA 4MEPA 4S3OB 4MR5A 5EGUA 3FL2A 4QF3A 3RTRB 4YABA 4TU4A 5CQ3A 2R0SA 5E9VA 4NRBA 4CCGX 4O7CA 3JVLA 4YK0A 2UZGA 4HXOA 4NUEA 5EP7A 5IGLA 4HBWA 4NR4A 2KWKA 2YHOA 2KWJA 4QR4A 4UYFB 4A9FA 1JM7B 3UV2A 2KGIA 5IGMA 4GNEA 2E7NA 2I7KA 4LZ2A 4LADB 4PCIA 3N9PA 4YYIA 3EB6A 4IOQA 4BHWA 4NN2A 4BW2A 3N9OA 5HENA 4ZC9A 1X0JA 2RFJA 5BT4A 5EPSA 4WHWA 2LGLA 5C89A 4J3IA 3U5MA 4QBMA 4O72A 5H85A 4F3IA 2MJVB 5FH6A 4CUQA 2G45A 4IR5A 4HXMA 2YEKA 2F6JA 5HELA 4Z93A 2KIZA 5B77A 1BORA 3JVKA 5AMFA 4UIXA 4NYWA 5DKHA 4WZ3B 2BAYA 5EQ1A 3S91A 4NR6A 5E0RA 2NAAA 2XEUA 4B86C 1FP0A 4UIZA 3N9MA 2OSSA 1VD4A 2F42A 3IU6A 2L84A 5FE6A 4A0CD 5KU3A 3D7CA 2YDWA 2NXBA 4Z1QA 4A9MA 2YSMA 3P1FA 4UIVA 3UV5A 5E3GA 4Q6FA 5B8DA 5AD3A 1ZS5A 3LJWA 4XUAA 3S92A 2YU4A 3ZTGA 4I7BA 2VJFA 3MQMA 3IHPA 5I7YA 2QIZA 2ECVA 4B7YC 3O33A 3Q2FA 4QB3A 5CQ8A 2DX8A 4IR6A 4X2IA 2H0DB 2DVQA 3T6RA 2M1RA 5HQ7A 4GB0A 5FE4A 5AMEA 5KTWA 2E6RA 4TS8A 5FH8A 5LUUA 5KHMA 2EODA 5G4SA 5D3PA 4NRCA 1JSPB 4HXNA 5A82A 4N3WA 2R0VA 5D7XA 5E9YA 5FE5A 2HYED 4UYEA 3VK6A 4A9KA 2C2VS 5HLSA 4PCEA 3O7AA 4OUFA 5F5ZA 4MEOA 5L96A 5LKUA 3ZYUA 2KYUA 4QY4A 4L58A 5AD2A 2MA5A 3RPGB 1WEEA 1E6IA 5CQ5A 4UIUA 2EA6A 3U5NA 4QUUA 2CSYA 2M85A 4QSWA 3ZNIA 3I2DA 3HMFA 4LYSA 3SOWA 4MVTA 3U5KA 3UV4A 5E9LA 4A49A 5B76A 5CPEA 4PTBA 3HTKC 5FB0A 5ENIA 2KFTA 4O71A 4QF2A 5DFCA 4IOOA 5CQ4A 5HCLA 5H1VA 3MHHA 2VP7A 4OGJA 1U6GB 2VJFB 5HRVA 4GPJA 3N9NA 4BW4A 2D8SA 5CFWA 5A5RA 4TT4A 2R10A 3V43A 4YYDA 4TKPB 4TZ2A 5A5SA 5CS8A 4YYHA 4YYKA 5LKZA 2YELA 3P1DA 2DKWA 4LC2A 5II1A 3UW9A 5LKTA 4P5OB 4LYIA 2YQLA 3KQIA 4KV4A 4MR3A 4QYDA 3LRQA 4IR3A 3P1CA 4RVRA 5D3TA 5IIDA 4NUCA 4QEUA 5F1LA 5H1TA 2CT2A 2ZETC 5FE2A 4S3OC 4FO9A 2YHNA 4PPEA 5DFBA 4E96A 2YQMA 2WP2A 3IU5A 2M6MA 4LYWA 4N4GA 5G4RA 5E9IA 5CUBA 2WP1A 5D3LA 4BJXA 5HFQA 2KU3A 4QYLA 1T1HA 5FE9A 2L80A 2LGKA 3HMEA 5EWWA 2AN6A 4O78A 4QSPA 5ENEA 4QEVA 2XB1A 3EB5A 3SOUA 5I83A 4J0SA 3PURA 5CY9A 5EVAA 1HYIA 5A7CA 4BW1A 5ENBA 1WEQA 4AUQB 1FBVA 4TU6A 1Z6UA 4QC1A 5TDWA 5A83A 4MR6A 1VYXA 5K29A 4QSRA 4NQNA 2Y43A 3NG2A 2JMIA 4I7CA 5EWHA 4A9OA 4O7BA 2RNWA 5CQ6A 2RNYA 2K16A 3T7LA 1V87A 4BBQA 4NQMA 5CTLA 4WZ0A 4TT2A 5DYAA 2RNXA 5EK9A 4XY8A 4HXRA 5D3JA 4HXLA 2VPEA 5D0CA 2VJEA 4YBTA 4PKLA 4YBSA 4TQNA 5I88A 5D1KB 2K17A 4QSVA 5C11A 5LJ2A 3SHBA 1MM3A 5C85A 5HJCA 2ECWA 3MXFA 2MD7B 3ONIA 5ENCA 5E9KA 5FB1A 5A85A 4CURA 4HXPA 4XY9A 4CUPA 2VPDA 3KNVA 5F60A 2MIQA 2ECTA 5LKXA 4O75A 5KTXA 2KREA 5EISA 3SVFA 1WEWA 2JMDA 1DVPA 4CUTA 4R2YA 3JVMA 3UVDA 4V3KC 2HDPA 5TB6A 4ZDTA 5EPBA 2ECGA 5CU8A 2K1JA 2FUIA 2LXHC 3ZYQA 5ACYA 5ENGA 5TBNA 4V3LC 3LXJA 1WEPA 4YYGA 2FSAA 2ECNA 5FE3A 5E73A 4A9IA 5FERA 2EGPA 4MSXA 2KR4A 4GNGA 4CA1A 4O76A 4A9NA 2IDAA 4QR3A 5EI4A 2DVSA 4A9HA 4F52B 2YQDA 2VJEB 4QEWA 5CQAA 2ECIA 4TT6A 5EWCA 5TCMA 4UI9B 5E74A 3M62A 1F62A 4O7AA 5AITA 5F1HA 5F3AA 4MENA 5L8UA 5D1LB 4ZW1A 3ZPV1 5CUEA 1JOCA 1X4UA 3C5KA 5F63A 4NR5A 3DWYA 5D1MB 5IG6A 3U5PA 2E3KA 4PS5A 5A5QA 5CRMA 4LK9A 3MB4A 1WE9A 2YW8A 5D3SA 3I3JA 4ALHA 2KTBB 2YT5A 2YEMA 5IGNA 4O64A 1G25A 2D82A 2LXPC 5DFDA 2LN0A 4A9JA 1N87A 5D25A 5EWDA 3AADA 2E6SA 1X4JA 4WIVA 1WENA 4Z6IA 4N4FA 4UYDA 2CSZA 5ETBA 4CL9A 4NR7A 4QSUA 3N9LA 3ZPVE 5E9MA 2YUCA 4IC3A 4BW3A 5F36A 2N9GA 2DWWA 4FK5A 1N72A 5ETDA 5DW2A 5CUCA 5DLZA 4YH4A 2YREA 3SVGA 1XWHA 1EQFA 3LQHA 5D3RA 1WEVA 2KWOA 2M3HA 4WZ2A 4X3GA 5DKAA 3ZVYA 5C13A 5DYCA 3L1XA 4O7FA 4QUTA 3UVYA 4YYJA 4LKAA 2YW5A 1ZBDB 3MB3A 5I3LA 5FE1A 3KV5A 3TLPA 5A5PA 5TDRA 3MHSA 4XYAA 5C8GA 4LLBA 5C87A 2QJ0A 4O74A 2KGGA 5E3DA 4UYFA 5C7NA 3QZSA 5FE8A 3L1ZB 5TABA 3K2JA 2JRJA 3Q2EA 3KV6A 3M99A 3O34A 5EM3A 4ZUXU 3O36A 4O77A 4TTEA 2OUOA 5A81A 5G05B 4HXKA 2LGVA 5DLXA 5A5OA 4R8PK 4YAXA 1VFYA 5LJ1A 5COIA 5DX4A 4MEQA 3AQAA 5AIUA 2QICA 3DAIA 4QSQA 5CRZA 4CUUA 5FG4A 5EU1A 3UVXA 5HRWA 5IGKA 3LQJA 2LDRA 2MNZA 3L11A 3NXBA 2Y1NA 4Y03A 4J1PA 2LSPB 3PHDA 3GL6A 3DPLR 5FEYA 2YURA 2DVVA 2Y1MA 1WUGA 2LQ6A 2MD8C 5FE7A 4IORA 1MM2A 4W4UA 5KTUA 5JG6A 5F62A 2PNXA 5H9MA 4AVXA 1WUMA 1Z2QA 1WGMA 2MUMA 2D9EA 2MA6A 5EWVA 5G04B 4NYXA 4CUSA 3QZVA 5CUGA 4CLBA 4A4BA 5LVQA 5C4QA 4UIYA 4ZQLA 5CUDA 5CUAA 2RSDA 5D24A 4LR6A 3P1EA 1X4IA 5I29A 2LGGA 2H60A 5FE0A 1LDKC 2DVRA 4LRGA 4UIWA 4AYCA 2L5EA 4YYMA 2G6QA 5LVRA 5B75A 4QNSA 5ENHA 5KH7A 2L85A 2R0YA 3QZTA 2H0DA 3RCWA 4YC9A 3U5LA 2L5UA 5L98A 2G43A 5FG5A 3G0LA 5CZGA 5I40A 2CKLA 5FFVA 3O70A 2LRIC 4CFKA 4TYLA 1WEOA 3G0JA 4QZSA 3UVWA 4YY4A 5HEMA 2G4AA 5FDZA 3HCTA 5BT5A 5DYXA
chains in the Genus database with same CATH superfamily
4I7DA 5EA1A 5II2A 1LDJB 4Q0OA 3U5OA 1HYJA 4UITA 4NUDA 1WESA 1WFKA 2VNFA 2E7OA 2OXQC 2VPGA 5I1QA 3SVHA 2MT5A 5ENFA 4UYGA 4L7XA 4NYVA 5KH9A 4C9ZA 4NR9A 4HXSA 1WIMA 5JI8A 5DYUA 3O37A 4YBMA 3RPGC 4KV1A 4LJNA 4NR8A 3C6WA 5D3NA 4O70A 4OGIA 3ZVZB 4LZSA 5HFRA 4QSTA 4LDFA 5LJ0A 4C66A 1WILA 2I8NA 5F25A 4AYCB 4ALGA 3O35A 4Z1SA 3U5JA 4IR4A 5BT3A 5F61A 2YYNA 5EYAF 4QR5A 5DKCA 2CONA 5D26A 4FLPA 5L99A 4TZ8A 3M63A 4XI1A 4AP4A 5FFWA 2RO1A 3ASLA 2YYRA 5CQTA 4J0RA 4Q0NA 5D3HA 1WEMA 4N4IA 2GRCA 5DW1A 4XUBA 5ENJA 2CKLB 4QSSA 5TRBA 4A9LA 3SOXA 3GG3A 5HM0A 4HBYA 3HMHA 4UYHA 4FJCA 5EICA 2LV9A 4WHUA 4YY6A 5JWMA 2F6NA 3MULA 1RMDA 3PUQA 5EPRA 4QSXA 4HBVA 5DBMA 5HQ5A 5I86A 2JMJA 3GV4A 3LJUX 2KKYA 5A5NA 4IC2A 5H1UA 2DATA 5KO4A 4NXJA 4HBXA 5EV9A 2YSJA 4QC3A 5IBNA 4NRAA 2ECJA 5I7XA 4YYNA 2KWNA 4C67A 2MNYA 4GNDA 1K2FA 4NS5A 5FG6A 5FBXA 3FAOA 5B79A 1IYMA 4AI6A 4AKIA 3DQVR 4UP5A 5DKDA 4Z6HA 2FUUA 5KH3A 2IQJA 3D1BA 1JM7A 5SVYA 5FH7A 4YH3A 5HRXA 1Z60A 4YATA 1F68A 2C2LA 3N9QA 5CGPA 5L97A 2PUYA 4GNFA 1WEUA 3MUKA 2L0BA 2RI7A 4FIPA 1MBMA 3FKMX 4PY6A 4WA6A 4R7EA 1JM4B 5B78A 5LCWB 5I80A 5J3XA 5CP5A 4A9EA 1CHCA 2KE1A 5DINA 2K4DA 2L43A 5J0DA 5FFYA 3FANA 4UP0A 4KCXA 5F2PA 5L8TA 3JVJA 2L75A 3FEHA 3LDYA 4DONA 5G0FA 5CQ7A 4AKNA 2LAUA 3HCSA 2I50A 4MR4A 5DY7A 5E7DA 5HQ6A 4N4HA 4LZRA 2CSVA 2RS9B 4O7EA 4A4CA 2OO1A 3P5OA 4CFLA 3HCUA 2OWAA 3LQIA 5I89A 1ZKRA 4YADA 2XOCA 1E4UA 2VPBA 4MEPA 4S3OB 4MR5A 5EGUA 3FL2A 4QF3A 3RTRB 4YABA 4TU4A 5CQ3A 2R0SA 5E9VA 4NRBA 4H9DA 4CCGX 4O7CA 3JVLA 4YK0A 2UZGA 4HXOA 4NUEA 5EP7A 5IGLA 4HBWA 4NR4A 2KWKA 2YHOA 2KWJA 4QR4A 4UYFB 4A9FA 1JM7B 3UV2A 2KGIA 5IGMA 4GNEA 2E7NA 2I7KA 4LZ2A 4LADB 4PCIA 3N9PA 4YYIA 3EB6A 4Z0OA 4IOQA 4BHWA 4NN2A 4BW2A 3N9OA 5HENA 4ZC9A 1X0JA 2RFJA 5BT4A 5EPSA 4WHWA 2LGLA 2JM3A 5C89A 4J3IA 3U5MA 4QBMA 2FFWA 4O72A 5H85A 3JUEA 3FM8C 4F3IA 2MJVB 5FH6A 4CUQA 2G45A 4IR5A 4HXMA 2YEKA 2F6JA 5HELA 4Z93A 2KIZA 5B77A 1BORA 3JVKA 5AMFA 2EGMA 4UIXA 4NYWA 5DKHA 4WZ3B 2BAYA 5EQ1A 3S91A 4NR6A 5E0RA 2NAAA 2XEUA 4B86C 1FP0A 4UIZA 3N9MA 2OSSA 1VD4A 2F42A 3IU6A 2L84A 2CRRA 5FE6A 4A0CD 5KU3A 3D7CA 2YDWA 2NXBA 4Z1QA 3DWDA 4A9MA 2YSMA 3P1FA 4UIVA 3UV5A 5E3GA 4Q6FA 2L7PA 5B8DA 5AD3A 1ZS5A 3LJWA 4XUAA 3S92A 2YU4A 3ZTGA 3MDBC 4I7BA 2VJFA 4AKGA 3MQMA 3IHPA 5I7YA 2QIZA 2ECVA 4B7YC 2RR4A 3O33A 3Q2FA 3ERRA 4QB3A 5CQ8A 2DX8A 4IR6A 4X2IA 2H0DB 2DVQA 3VKGA 3Q1DA 3T6RA 2M1RA 5HQ7A 4GB0A 5FE4A 5AMEA 5KTWA 2E6RA 4TS8A 5FH8A 5LUUA 2XOYA 5KHMA 2EODA 5G4SA 5D3PA 4NRCA 1JSPB 4HXNA 5A82A 4N3WA 2R0VA 5D7XA 5E9YA 5FE5A 2HYED 4UYEA 3VK6A 4A9KA 2C2VS 5HLSA 4PCEA 3O7AA 4OUFA 5F5ZA 4MEOA 5L96A 5LKUA 3ZYUA 2KYUA 4QY4A 4L58A 5AD2A 2MA5A 3RPGB 1WEEA 1E6IA 5CQ5A 3O47A 4UIUA 2EA6A 4O62A 3U5NA 4QUUA 2CSYA 2M85A 4QSWA 3ZNIA 3I2DA 3HMFA 4LYSA 3SOWA 4MVTA 5DKAA 3U5KA 3UV4A 5E9LA 4A49A 5B76A 3D1DA 5CPEA 4PTBA 3HTKC 5FB0A 5ENIA 2KFTA 4O71A 4QF2A 5DFCA 4IOOA 5CQ4A 5HCLA 5H1VA 3LVRE 2VP7A 4OGJA 1U6GB 2VJFB 5HRVA 4GPJA 3MHHA 3N9NA 4BW4A 2D8SA 5CFWA 5A5RA 4TT4A 2R10A 3V43A 4YYDA 2KKXA 4TKPB 4TZ2A 5A5SA 5CS8A 4YYHA 4YYKA 5LKZA 2YELA 3P1DA 2DKWA 4LC2A 5II1A 3UW9A 2B0OE 5LKTA 4P5OB 4LYIA 2YQLA 3KQIA 4KV4A 4MR3A 4QYDA 3LRQA 3LVQE 3KDEC 4IR3A 3P1CA 3T9KA 4RVRA 5D3TA 5IIDA 4NUCA 4QEUA 5F1LA 5H1TA 2CT2A 2ZETC 5FE2A 4S3OC 5SVXA 4FO9A 2YHNA 4PPEA 5DFBA 4E96A 2YQMA 2WP2A 3IU5A 2M6MA 4LYWA 4N4GA 5G4RA 5E9IA 5CUBA 2WP1A 3E2DA 5D3LA 4BJXA 5HFQA 2KU3A 4QYLA 1T1HA 5FE9A 2L80A 2LGKA 2XOZA 3M7KA 3HMEA 5EWWA 2AN6A 4O78A 4QSPA 5ENEA 4QEVA 2JUNA 2EJNA 2M13A 5I83A 2XB1A 3EB5A 3SOUA 3VKHA 4J0SA 3PURA 5CY9A 5EVAA 1HYIA 5A7CA 4BW1A 5ENBA 1WEQA 1PUOA 4AUQB 1FBVA 4TU6A 1Z6UA 4QC1A 5TDWA 5A83A 4MR6A 1VYXA 5K29A 4QSRA 4NQNA 2Y43A 3NG2A 2JMIA 4I7CA 5EWHA 4A9OA 4O7BA 2RNWA 5CQ6A 2RNYA 2CRWA 2K16A 3T7LA 1V87A 4BBQA 4OGCA 4NQMA 5CTLA 2D8UA 4WZ0A 4TT2A 5DYAA 2RNXA 5EK9A 4XY8A 5K3QA 4HXRA 5D3JA 4HXLA 2VPEA 5D0CA 2VJEA 4YBTA 4PKLA 4YBSA 4TQNA 5I88A 5D1KB 2K17A 4QSVA 5C11A 5LJ2A 3SHBA 1MM3A 5C85A 5HJCA 2ECWA 3MXFA 2MD7B 3ONIA 3H7HA 5ENCA 5E9KA 5FB1A 5A85A 4CURA 4HXPA 3PLWA 4XY9A 4CUPA 4Z0RA 2VPDA 3KNVA 5F60A 2MIQA 2ECTA 5LKXA 4O75A 5KTXA 2KREA 5EISA 3FJUB 3SVFA 1WEWA 2JMDA 1DVPA 4CUTA 4R2YA 3JVMA 3UVDA 4V3KC 2HDPA 5TB6A 4ZDTA 5EPBA 2ECGA 5CU8A 2K1JA 2FUIA 2LXHC 3ZYQA 5ACYA 5ENGA 5TBNA 3SUBA 4V3LC 3LXJA 1WEPA 4YYGA 2FSAA 2ECNA 5FE3A 5E73A 2E61A 4A9IA 5FERA 2EGPA 4MSXA 2KR4A 4GNGA 4CA1A 4O76A 4A9NA 2IDAA 4QR3A 5EI4A 2DVSA 4A9HA 4F52B 2YQDA 4OGEA 2VJEB 4QEWA 2XP0A 5CQAA 2ECIA 4TT6A 5EWCA 5TCMA 4UI9B 5E74A 3M62A 1F62A 4O7AA 2DSMA 5F1HA 5F3AA 4MENA 5L8UA 5AITA 5D1LB 4ZW1A 3ZPV1 5CUEA 1JOCA 1X4UA 3C5KA 5F63A 4NR5A 3DWYA 5D1MB 5SVIA 5IG6A 3U5PA 2E3KA 4PS5A 5A5QA 5CRMA 4LK9A 3MB4A 1WE9A 2YW8A 5D3SA 3I3JA 4ALHA 2P57A 2KTBB 2YT5A 2YEMA 5IGNA 4O64A 1G25A 2D82A 2LXPC 5DFDA 2LN0A 4A9JA 1N87A 5D25A 5EWDA 3AADA 2E6SA 1X4JA 4WIVA 1WENA 4Z6IA 4N4FA 4UYDA 2CSZA 5ETBA 4CL9A 4NR7A 4F1PA 4QSUA 3N9LA 3ZPVE 5E9MA 2YUCA 4IC3A 4BW3A 5F36A 2N9GA 2DWWA 4FK5A 1N72A 5ETDA 5DW2A 5CUCA 5DLZA 4YH4A 2YREA 3SVGA 1XWHA 1EQFA 3LQHA 5D3RA 1WEVA 2KWOA 2M3HA 4WZ2A 4X3GA 4AKHA 3ZVYA 5C13A 5DYCA 3L1XA 4O7FA 4QUTA 3UVYA 4YYJA 4LKAA 2YW5A 1ZBDB 3MB3A 5I3LA 5FE1A 3KV5A 3TLPA 5A5PA 5TDRA 3MHSA 4XYAA 5SVIB 5C8GA 4LLBA 5C87A 2QJ0A 4O74A 2KGGA 5E3DA 4UYFA 5C7NA 3QZSA 5FE8A 3L1ZB 5TABA 3K2JA 2JRJA 3Q2EA 3KV6A 3M99A 3O34A 5EM3A 2EXUA 4ZUXU 3O36A 4O77A 4TTEA 2OUOA 5A81A 5G05B 4QQ4A 4HXKA 2LGVA 5DLXA 5A5OA 4R8PK 4YAXA 1VFYA 5LJ1A 5COIA 5DX4A 4MEQA 3AQAA 5AIUA 2QICA 3DAIA 4QSQA 5CRZA 4CUUA 2MKEA 5FG4A 5EU1A 3UVXA 5HRWA 5IGKA 3LQJA 2FD4A 2LDRA 2MNZA 3L11A 3NXBA 2Y1NA 4Y03A 4J1PA 2LSPB 3PHDA 3GL6A 3DPLR 5FEYA 2YURA 2DVVA 2Y1MA 1WUGA 2LQ6A 2MD8C 5FE7A 4IORA 1MM2A 4W4UA 5KTUA 5JG6A 5F62A 2PNXA 5H9MA 4AVXA 1WUMA 1Z2QA 1WGMA 2MUMA 2D9EA 2MA6A 5EWVA 5G04B 4NYXA 4CUSA 3QZVA 5CUGA 4CLBA 4A4BA 5LVQA 5C4QA 4UIYA 4ZQLA 5CUDA 5CUAA 2RSDA 5D24A 4LR6A 3P1EA 1X4IA 5I29A 2LGGA 2H60A 5FE0A 1LDKC 2DVRA 3DDTA 2YVRA 4LRGA 4UIWA 4AYCA 2L5EA 4YYMA 2G6QA 5LVRA 5B75A 4QNSA 5ENHA 5KH7A 2L85A 2R0YA 3QZTA 2H0DA 3RCWA 4YC9A 3U5LA 2L5UA 2DJAA 5L98A 2G43A 5FG5A 3G0LA 5CZGA 5I40A 2CKLA 5FFVA 3O70A 2LRIC 4CFKA 4TYLA 1WEOA 3G0JA 4QZSA 3UVWA 1DCQA 4YY4A 5HEMA 2G4AA 5FDZA 3HCTA 5BT5A 5DYXA
chains in the Genus database with same CATH topology
4I7DA 5EA1A 5II2A 1LDJB 4Q0OA 3U5OA 1HYJA 4UITA 4NUDA 1WESA 1WFKA 2VNFA 2E7OA 2OXQC 2VPGA 5I1QA 3SVHA 2MT5A 5ENFA 4UYGA 4L7XA 4NYVA 5KH9A 4C9ZA 4NR9A 4HXSA 1WIMA 5JI8A 5DYUA 3O37A 4YBMA 3RPGC 4KV1A 4LJNA 4NR8A 3C6WA 5D3NA 4O70A 4OGIA 3ZVZB 4LZSA 5HFRA 4QSTA 4LDFA 5LJ0A 4C66A 1WILA 2I8NA 5F25A 4AYCB 4ALGA 3O35A 4Z1SA 3U5JA 4IR4A 5BT3A 5F61A 2YYNA 5EYAF 4QR5A 5DKCA 5D26A 4FLPA 5L99A 4TZ8A 3M63A 4XI1A 4AP4A 5FFWA 2RO1A 3ASLA 2YYRA 5CQTA 4J0RA 4Q0NA 5D3HA 1WEMA 4N4IA 2GRCA 5DW1A 4XUBA 5ENJA 2CKLB 4QSSA 5TRBA 4A9LA 3SOXA 3GG3A 5HM0A 4HBYA 3HMHA 4UYHA 4FJCA 5EICA 2LV9A 4WHUA 4YY6A 5JWMA 2F6NA 3MULA 1RMDA 3PUQA 5EPRA 4QSXA 4HBVA 5DBMA 5HQ5A 5I86A 2JMJA 3GV4A 5A5NA 4IC2A 5H1UA 2DATA 5KO4A 4NXJA 4HBXA 5EV9A 2YSJA 4QC3A 5IBNA 4NRAA 2ECJA 5I7XA 4YYNA 2KWNA 4C67A 2MNYA 4GNDA 1K2FA 4NS5A 5FG6A 5FBXA 5B79A 1IYMA 3DQVR 4UP5A 5DKDA 4Z6HA 2FUUA 5KH3A 1JM7A 5FH7A 4YH3A 5HRXA 1Z60A 4YATA 1F68A 2C2LA 3N9QA 5CGPA 5L97A 2PUYA 4GNFA 1WEUA 3MUKA 2L0BA 2RI7A 4FIPA 3FKMX 4PY6A 4WA6A 4R7EA 1JM4B 5B78A 5LCWB 5I80A 5J3XA 5CP5A 4A9EA 1CHCA 2KE1A 5DINA 2K4DA 2L43A 5J0DA 5FFYA 4UP0A 4KCXA 5F2PA 5L8TA 3JVJA 2L75A 4DONA 5G0FA 5CQ7A 4AKNA 3HCSA 2I50A 4MR4A 5DY7A 5E7DA 5HQ6A 4N4HA 4LZRA 2RS9B 4O7EA 4A4CA 2OO1A 3P5OA 4CFLA 3HCUA 3LQIA 5I89A 4YADA 1E4UA 2VPBA 4MEPA 4S3OB 4MR5A 5EGUA 3FL2A 4QF3A 3RTRB 4YABA 4TU4A 5CQ3A 2R0SA 5E9VA 4NRBA 4CCGX 4O7CA 3JVLA 4YK0A 2UZGA 4HXOA 4NUEA 5EP7A 5IGLA 4HBWA 4NR4A 2KWKA 2YHOA 2KWJA 4QR4A 4UYFB 4A9FA 1JM7B 3UV2A 2KGIA 5IGMA 4GNEA 2E7NA 2I7KA 4LZ2A 4LADB 4PCIA 3N9PA 4YYIA 3EB6A 4IOQA 4BHWA 4NN2A 4BW2A 3N9OA 5HENA 4ZC9A 1X0JA 2RFJA 5BT4A 5EPSA 4WHWA 2LGLA 5C89A 4J3IA 3U5MA 4QBMA 4O72A 5H85A 4F3IA 2MJVB 5FH6A 4CUQA 2G45A 4IR5A 4HXMA 2YEKA 2F6JA 5HELA 4Z93A 2KIZA 5B77A 1BORA 3JVKA 5AMFA 4UIXA 4NYWA 5DKHA 4WZ3B 2BAYA 5EQ1A 3S91A 4NR6A 5E0RA 2NAAA 2XEUA 4B86C 1FP0A 4UIZA 3N9MA 2OSSA 1VD4A 2F42A 3IU6A 2L84A 5FE6A 4A0CD 5KU3A 3D7CA 2YDWA 2NXBA 4Z1QA 4A9MA 2YSMA 3P1FA 4UIVA 3UV5A 5E3GA 4Q6FA 5B8DA 5AD3A 1ZS5A 3LJWA 4XUAA 3S92A 2YU4A 3ZTGA 4I7BA 2VJFA 3MQMA 3IHPA 5I7YA 2QIZA 2ECVA 4B7YC 3O33A 3Q2FA 4QB3A 5CQ8A 2DX8A 4IR6A 4X2IA 2H0DB 2DVQA 3T6RA 2M1RA 5HQ7A 4GB0A 5FE4A 5AMEA 5KTWA 2E6RA 4TS8A 5FH8A 5LUUA 5KHMA 2EODA 5G4SA 5D3PA 4NRCA 1JSPB 4HXNA 5A82A 4N3WA 2R0VA 5D7XA 5E9YA 5FE5A 2HYED 4UYEA 3VK6A 4A9KA 2C2VS 5HLSA 4PCEA 3O7AA 4OUFA 5F5ZA 4MEOA 5L96A 5LKUA 3ZYUA 2KYUA 4QY4A 4L58A 5AD2A 2MA5A 3RPGB 1WEEA 1E6IA 5CQ5A 4UIUA 2EA6A 3U5NA 4QUUA 2CSYA 2M85A 4QSWA 3ZNIA 3I2DA 3HMFA 4LYSA 3SOWA 4MVTA 3U5KA 3UV4A 5E9LA 4A49A 5B76A 5CPEA 4PTBA 3HTKC 5FB0A 5ENIA 2KFTA 4O71A 4QF2A 5DFCA 4IOOA 5CQ4A 5HCLA 5H1VA 3MHHA 2VP7A 4OGJA 1U6GB 2VJFB 5HRVA 4GPJA 3N9NA 4BW4A 2D8SA 5CFWA 5A5RA 4TT4A 2R10A 3V43A 4YYDA 4TKPB 4TZ2A 5A5SA 5CS8A 4YYHA 4YYKA 5LKZA 2YELA 3P1DA 2DKWA 4LC2A 5II1A 3UW9A 5LKTA 4P5OB 4LYIA 2YQLA 3KQIA 4KV4A 4MR3A 4QYDA 3LRQA 4IR3A 3P1CA 4RVRA 5D3TA 5IIDA 4NUCA 4QEUA 5F1LA 5H1TA 2CT2A 2ZETC 5FE2A 4S3OC 4FO9A 2YHNA 4PPEA 5DFBA 4E96A 2YQMA 2WP2A 3IU5A 2M6MA 4LYWA 4N4GA 5G4RA 5E9IA 5CUBA 2WP1A 5D3LA 4BJXA 5HFQA 2KU3A 4QYLA 1T1HA 5FE9A 2L80A 2LGKA 3HMEA 5EWWA 2AN6A 4O78A 4QSPA 5ENEA 4QEVA 2XB1A 3EB5A 3SOUA 5I83A 4J0SA 3PURA 5CY9A 5EVAA 1HYIA 5A7CA 4BW1A 5ENBA 1WEQA 4AUQB 1FBVA 4TU6A 1Z6UA 4QC1A 5TDWA 5A83A 4MR6A 1VYXA 5K29A 4QSRA 4NQNA 2Y43A 3NG2A 2JMIA 4I7CA 5EWHA 4A9OA 4O7BA 2RNWA 5CQ6A 2RNYA 2K16A 3T7LA 1V87A 4BBQA 4NQMA 5CTLA 4WZ0A 4TT2A 5DYAA 2RNXA 5EK9A 4XY8A 4HXRA 5D3JA 4HXLA 2VPEA 5D0CA 2VJEA 4YBTA 4PKLA 4YBSA 4TQNA 5I88A 5D1KB 2K17A 4QSVA 5C11A 5LJ2A 3SHBA 1MM3A 5C85A 5HJCA 2ECWA 3MXFA 2MD7B 3ONIA 5ENCA 5E9KA 5FB1A 5A85A 4CURA 4HXPA 4XY9A 4CUPA 2VPDA 3KNVA 5F60A 2MIQA 2ECTA 5LKXA 4O75A 5KTXA 2KREA 5EISA 3SVFA 1WEWA 2JMDA 1DVPA 4CUTA 4R2YA 3JVMA 3UVDA 4V3KC 2HDPA 5TB6A 4ZDTA 5EPBA 2ECGA 5CU8A 2K1JA 2FUIA 2LXHC 3ZYQA 5ACYA 5ENGA 5TBNA 4V3LC 3LXJA 1WEPA 4YYGA 2FSAA 2ECNA 5FE3A 5E73A 4A9IA 5FERA 2EGPA 4MSXA 2KR4A 4GNGA 4CA1A 4O76A 4A9NA 2IDAA 4QR3A 5EI4A 2DVSA 4A9HA 4F52B 2YQDA 2VJEB 4QEWA 5CQAA 2ECIA 4TT6A 5EWCA 5TCMA 4UI9B 5E74A 3M62A 1F62A 4O7AA 5AITA 5F1HA 5F3AA 4MENA 5L8UA 5D1LB 4ZW1A 3ZPV1 5CUEA 1JOCA 1X4UA 3C5KA 5F63A 4NR5A 3DWYA 5D1MB 5IG6A 3U5PA 2E3KA 4PS5A 5A5QA 5CRMA 4LK9A 3MB4A 1WE9A 2YW8A 5D3SA 3I3JA 4ALHA 2KTBB 2YT5A 2YEMA 5IGNA 4O64A 1G25A 2D82A 2LXPC 5DFDA 2LN0A 4A9JA 1N87A 5D25A 5EWDA 3AADA 2E6SA 1X4JA 4WIVA 1WENA 4Z6IA 4N4FA 4UYDA 2CSZA 5ETBA 4CL9A 4NR7A 4QSUA 3N9LA 3ZPVE 5E9MA 2YUCA 4IC3A 4BW3A 5F36A 2N9GA 2DWWA 4FK5A 1N72A 5ETDA 5DW2A 5CUCA 5DLZA 4YH4A 2YREA 3SVGA 1XWHA 1EQFA 3LQHA 5D3RA 1WEVA 2KWOA 2M3HA 4WZ2A 4X3GA 5DKAA 3ZVYA 5C13A 5DYCA 3L1XA 4O7FA 4QUTA 3UVYA 4YYJA 4LKAA 2YW5A 1ZBDB 3MB3A 5I3LA 5FE1A 3KV5A 3TLPA 5A5PA 5TDRA 3MHSA 4XYAA 5C8GA 4LLBA 5C87A 2QJ0A 4O74A 2KGGA 5E3DA 4UYFA 5C7NA 3QZSA 5FE8A 3L1ZB 5TABA 3K2JA 2JRJA 3Q2EA 3KV6A 3M99A 3O34A 5EM3A 4ZUXU 3O36A 4O77A 4TTEA 2OUOA 5A81A 5G05B 4HXKA 2LGVA 5DLXA 5A5OA 4R8PK 4YAXA 1VFYA 5LJ1A 5COIA 5DX4A 4MEQA 3AQAA 5AIUA 2QICA 3DAIA 4QSQA 5CRZA 4CUUA 5FG4A 5EU1A 3UVXA 5HRWA 5IGKA 3LQJA 2LDRA 2MNZA 3L11A 3NXBA 2Y1NA 4Y03A 4J1PA 2LSPB 3PHDA 3GL6A 3DPLR 5FEYA 2YURA 2DVVA 2Y1MA 1WUGA 2LQ6A 2MD8C 5FE7A 4IORA 1MM2A 4W4UA 5KTUA 5JG6A 5F62A 2PNXA 5H9MA 4AVXA 1WUMA 1Z2QA 1WGMA 2MUMA 2D9EA 2MA6A 5EWVA 5G04B 4NYXA 4CUSA 3QZVA 5CUGA 4CLBA 4A4BA 5LVQA 5C4QA 4UIYA 4ZQLA 5CUDA 5CUAA 2RSDA 5D24A 4LR6A 3P1EA 1X4IA 5I29A 2LGGA 2H60A 5FE0A 1LDKC 2DVRA 4LRGA 4UIWA 4AYCA 2L5EA 4YYMA 2G6QA 5LVRA 5B75A 4QNSA 5ENHA 5KH7A 2L85A 2R0YA 3QZTA 2H0DA 3RCWA 4YC9A 3U5LA 2L5UA 5L98A 2G43A 5FG5A 3G0LA 5CZGA 5I40A 2CKLA 5FFVA 3O70A 2LRIC 4CFKA 4TYLA 1WEOA 3G0JA 4QZSA 3UVWA 4YY4A 5HEMA 2G4AA 5FDZA 3HCTA 5BT5A 5DYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7D A;  5EA1 A;  5II2 A;  1LDJ B;  4Q0O A;  3U5O A;  1HYJ A;  4UIT A;  4NUD A;  1WES A;  1WFK A;  2VNF A;  2E7O A;  2OXQ C;  2VPG A;  5I1Q A;  3SVH A;  2MT5 A;  5ENF A;  4UYG A;  4L7X A;  4NYV A;  5KH9 A;  4C9Z A;  4NR9 A;  4HXS A;  1WIM A;  5JI8 A;  5DYU A;  3O37 A;  4YBM A;  3RPG C;  4KV1 A;  4LJN A;  4NR8 A;  3C6W A;  5D3N A;  4O70 A;  4OGI A;  3ZVZ B;  4LZS A;  5HFR A;  4QST A;  4LDF A;  5LJ0 A;  4C66 A;  1WIL A;  2I8N A;  5F25 A;  4AYC B;  4ALG A;  3O35 A;  4Z1S A;  3U5J A;  4IR4 A;  5BT3 A;  5F61 A;  2YYN A;  5EYA F;  4QR5 A;  5DKC A;  5D26 A;  4FLP A;  5L99 A;  4TZ8 A;  3M63 A;  4XI1 A;  4AP4 A;  5FFW A;  2RO1 A;  3ASL A;  2YYR A;  5CQT A;  4J0R A;  4Q0N A;  5D3H A;  1WEM A;  4N4I A;  2GRC A;  5DW1 A;  4XUB A;  5ENJ A;  2CKL B;  4QSS A;  5TRB A;  4A9L A;  3SOX A;  3GG3 A;  5HM0 A;  4HBY A;  3HMH A;  4UYH A;  4FJC A;  5EIC A;  2LV9 A;  4WHU A;  4YY6 A;  5JWM A;  2F6N A;  3MUL A;  1RMD A;  3PUQ A;  5EPR A;  4QSX A;  4HBV A;  5DBM A;  5HQ5 A;  5I86 A;  2JMJ A;  3GV4 A;  5A5N A;  4IC2 A;  5H1U A;  2DAT A;  5KO4 A;  4NXJ A;  4HBX A;  5EV9 A;  2YSJ A;  4QC3 A;  5IBN A;  4NRA A;  2ECJ A;  5I7X A;  4YYN A;  2KWN A;  4C67 A;  2MNY A;  4GND A;  1K2F A;  4NS5 A;  5FG6 A;  5FBX A;  5B79 A;  1IYM A;  3DQV R;  4UP5 A;  5DKD A;  4Z6H A;  2FUU A;  5KH3 A;  1JM7 A;  5FH7 A;  4YH3 A;  5HRX A;  1Z60 A;  4YAT A;  1F68 A;  2C2L A;  3N9Q A;  5CGP A;  5L97 A;  2PUY A;  4GNF A;  1WEU A;  3MUK A;  2L0B A;  2RI7 A;  4FIP A;  3FKM X;  4PY6 A;  4WA6 A;  4R7E A;  1JM4 B;  5B78 A;  5LCW B;  5I80 A;  5J3X A;  5CP5 A;  4A9E A;  1CHC A;  2KE1 A;  5DIN A;  2K4D A;  2L43 A;  5J0D A;  5FFY A;  4UP0 A;  4KCX A;  5F2P A;  5L8T A;  3JVJ A;  2L75 A;  4DON A;  5G0F A;  5CQ7 A;  4AKN A;  3HCS A;  2I50 A;  4MR4 A;  5DY7 A;  5E7D A;  5HQ6 A;  4N4H A;  4LZR A;  2RS9 B;  4O7E A;  4A4C A;  2OO1 A;  3P5O A;  4CFL A;  3HCU A;  3LQI A;  5I89 A;  4YAD A;  1E4U A;  2VPB A;  4MEP A;  4S3O B;  4MR5 A;  5EGU A;  3FL2 A;  4QF3 A;  3RTR B;  4YAB A;  4TU4 A;  5CQ3 A;  2R0S A;  5E9V A;  4NRB A;  4CCG X;  4O7C A;  3JVL A;  4YK0 A;  2UZG A;  4HXO A;  4NUE A;  5EP7 A;  5IGL A;  4HBW A;  4NR4 A;  2KWK A;  2YHO A;  2KWJ A;  4QR4 A;  4UYF B;  4A9F A;  1JM7 B;  3UV2 A;  2KGI A;  5IGM A;  4GNE A;  2E7N A;  2I7K A;  4LZ2 A;  4LAD B;  4PCI A;  3N9P A;  4YYI A;  3EB6 A;  4IOQ A;  4BHW A;  4NN2 A;  4BW2 A;  3N9O A;  5HEN A;  4ZC9 A;  1X0J A;  2RFJ A;  5BT4 A;  5EPS A;  4WHW A;  2LGL A;  5C89 A;  4J3I A;  3U5M A;  4QBM A;  4O72 A;  5H85 A;  4F3I A;  2MJV B;  5FH6 A;  4CUQ A;  2G45 A;  4IR5 A;  4HXM A;  2YEK A;  2F6J A;  5HEL A;  4Z93 A;  2KIZ A;  5B77 A;  1BOR A;  3JVK A;  5AMF A;  4UIX A;  4NYW A;  5DKH A;  4WZ3 B;  2BAY A;  5EQ1 A;  3S91 A;  4NR6 A;  5E0R A;  2NAA A;  2XEU A;  4B86 C;  1FP0 A;  4UIZ A;  3N9M A;  2OSS A;  1VD4 A;  2F42 A;  3IU6 A;  2L84 A;  5FE6 A;  4A0C D;  5KU3 A;  3D7C A;  2YDW A;  2NXB A;  4Z1Q A;  4A9M A;  2YSM A;  3P1F A;  4UIV A;  3UV5 A;  5E3G A;  4Q6F A;  5B8D A;  5AD3 A;  1ZS5 A;  3LJW A;  4XUA A;  3S92 A;  2YU4 A;  3ZTG A;  4I7B A;  2VJF A;  3MQM A;  3IHP A;  5I7Y A;  2QIZ A;  2ECV A;  4B7Y C;  3O33 A;  3Q2F A;  4QB3 A;  5CQ8 A;  2DX8 A;  4IR6 A;  4X2I A;  2H0D B;  2DVQ A;  3T6R A;  2M1R A;  5HQ7 A;  4GB0 A;  5FE4 A;  5AME A;  5KTW A;  2E6R A;  4TS8 A;  5FH8 A;  5LUU A;  5KHM A;  2EOD A;  5G4S A;  5D3P A;  4NRC A;  1JSP B;  4HXN A;  5A82 A;  4N3W A;  2R0V A;  5D7X A;  5E9Y A;  5FE5 A;  2HYE D;  4UYE A;  3VK6 A;  4A9K A;  2C2V S;  5HLS A;  4PCE A;  3O7A A;  4OUF A;  5F5Z A;  4MEO A;  5L96 A;  5LKU A;  3ZYU A;  2KYU A;  4QY4 A;  4L58 A;  5AD2 A;  2MA5 A;  3RPG B;  1WEE A;  1E6I A;  5CQ5 A;  4UIU A;  2EA6 A;  3U5N A;  4QUU A;  2CSY A;  2M85 A;  4QSW A;  3ZNI A;  3I2D A;  3HMF A;  4LYS A;  3SOW A;  4MVT A;  3U5K A;  3UV4 A;  5E9L A;  4A49 A;  5B76 A;  5CPE A;  4PTB A;  3HTK C;  5FB0 A;  5ENI A;  2KFT A;  4O71 A;  4QF2 A;  5DFC A;  4IOO A;  5CQ4 A;  5HCL A;  5H1V A;  3MHH A;  2VP7 A;  4OGJ A;  1U6G B;  2VJF B;  5HRV A;  4GPJ A;  3N9N A;  4BW4 A;  2D8S A;  5CFW A;  5A5R A;  4TT4 A;  2R10 A;  3V43 A;  4YYD A;  4TKP B;  4TZ2 A;  5A5S A;  5CS8 A;  4YYH A;  4YYK A;  5LKZ A;  2YEL A;  3P1D A;  2DKW A;  4LC2 A;  5II1 A;  3UW9 A;  5LKT A;  4P5O B;  4LYI A;  2YQL A;  3KQI A;  4KV4 A;  4MR3 A;  4QYD A;  3LRQ A;  4IR3 A;  3P1C A;  4RVR A;  5D3T A;  5IID A;  4NUC A;  4QEU A;  5F1L A;  5H1T A;  2CT2 A;  2ZET C;  5FE2 A;  4S3O C;  4FO9 A;  2YHN A;  4PPE A;  5DFB A;  4E96 A;  2YQM A;  2WP2 A;  3IU5 A;  2M6M A;  4LYW A;  4N4G A;  5G4R A;  5E9I A;  5CUB A;  2WP1 A;  5D3L A;  4BJX A;  5HFQ A;  2KU3 A;  4QYL A;  1T1H A;  5FE9 A;  2L80 A;  2LGK A;  3HME A;  5EWW A;  2AN6 A;  4O78 A;  4QSP A;  5ENE A;  4QEV A;  2XB1 A;  3EB5 A;  3SOU A;  5I83 A;  4J0S A;  3PUR A;  5CY9 A;  5EVA A;  1HYI A;  5A7C A;  4BW1 A;  5ENB A;  1WEQ A;  4AUQ B;  1FBV A;  4TU6 A;  1Z6U A;  4QC1 A;  5TDW A;  5A83 A;  4MR6 A;  1VYX A;  5K29 A;  4QSR A;  4NQN A;  2Y43 A;  3NG2 A;  2JMI A;  4I7C A;  5EWH A;  4A9O A;  4O7B A;  2RNW A;  5CQ6 A;  2RNY A;  2K16 A;  3T7L A;  1V87 A;  4BBQ A;  4NQM A;  5CTL A;  4WZ0 A;  4TT2 A;  5DYA A;  2RNX A;  5EK9 A;  4XY8 A;  4HXR A;  5D3J A;  4HXL A;  2VPE A;  5D0C A;  2VJE A;  4YBT A;  4PKL A;  4YBS A;  4TQN A;  5I88 A;  5D1K B;  2K17 A;  4QSV A;  5C11 A;  5LJ2 A;  3SHB A;  1MM3 A;  5C85 A;  5HJC A;  2ECW A;  3MXF A;  2MD7 B;  3ONI A;  5ENC A;  5E9K A;  5FB1 A;  5A85 A;  4CUR A;  4HXP A;  4XY9 A;  4CUP A;  2VPD A;  3KNV A;  5F60 A;  2MIQ A;  2ECT A;  5LKX A;  4O75 A;  5KTX A;  2KRE A;  5EIS A;  3SVF A;  1WEW A;  2JMD A;  1DVP A;  4CUT A;  4R2Y A;  3JVM A;  3UVD A;  4V3K C;  2HDP A;  5TB6 A;  4ZDT A;  5EPB A;  2ECG A;  5CU8 A;  2K1J A;  2FUI A;  2LXH C;  3ZYQ A;  5ACY A;  5ENG A;  5TBN A;  4V3L C;  3LXJ A;  1WEP A;  4YYG A;  2FSA A;  2ECN A;  5FE3 A;  5E73 A;  4A9I A;  5FER A;  2EGP A;  4MSX A;  2KR4 A;  4GNG A;  4CA1 A;  4O76 A;  4A9N A;  2IDA A;  4QR3 A;  5EI4 A;  2DVS A;  4A9H A;  4F52 B;  2YQD A;  2VJE B;  4QEW A;  5CQA A;  2ECI A;  4TT6 A;  5EWC A;  5TCM A;  4UI9 B;  5E74 A;  3M62 A;  1F62 A;  4O7A A;  5AIT A;  5F1H A;  5F3A A;  4MEN A;  5L8U A;  5D1L B;  4ZW1 A;  3ZPV 1;  5CUE A;  1JOC A;  1X4U A;  3C5K A;  5F63 A;  4NR5 A;  3DWY A;  5D1M B;  5IG6 A;  3U5P A;  2E3K A;  4PS5 A;  5A5Q A;  5CRM A;  4LK9 A;  3MB4 A;  1WE9 A;  2YW8 A;  5D3S A;  3I3J A;  4ALH A;  2KTB B;  2YT5 A;  2YEM A;  5IGN A;  4O64 A;  1G25 A;  2D82 A;  2LXP C;  5DFD A;  2LN0 A;  4A9J A;  1N87 A;  5D25 A;  5EWD A;  3AAD A;  2E6S A;  1X4J A;  4WIV A;  1WEN A;  4Z6I A;  4N4F A;  4UYD A;  2CSZ A;  5ETB A;  4CL9 A;  4NR7 A;  4QSU A;  3N9L A;  3ZPV E;  5E9M A;  2YUC A;  4IC3 A;  4BW3 A;  5F36 A;  2N9G A;  2DWW A;  4FK5 A;  1N72 A;  5ETD A;  5DW2 A;  5CUC A;  5DLZ A;  4YH4 A;  2YRE A;  3SVG A;  1XWH A;  1EQF A;  3LQH A;  5D3R A;  1WEV A;  2KWO A;  2M3H A;  4WZ2 A;  4X3G A;  5DKA A;  3ZVY A;  5C13 A;  5DYC A;  3L1X A;  4O7F A;  4QUT A;  3UVY A;  4YYJ A;  4LKA A;  2YW5 A;  1ZBD B;  3MB3 A;  5I3L A;  5FE1 A;  3KV5 A;  3TLP A;  5A5P A;  5TDR A;  3MHS A;  4XYA A;  5C8G A;  4LLB A;  5C87 A;  2QJ0 A;  4O74 A;  2KGG A;  5E3D A;  4UYF A;  5C7N A;  3QZS A;  5FE8 A;  3L1Z B;  5TAB A;  3K2J A;  2JRJ A;  3Q2E A;  3KV6 A;  3M99 A;  3O34 A;  5EM3 A;  4ZUX U;  3O36 A;  4O77 A;  4TTE A;  2OUO A;  5A81 A;  5G05 B;  4HXK A;  2LGV A;  5DLX A;  5A5O A;  4R8P K;  4YAX A;  1VFY A;  5LJ1 A;  5COI A;  5DX4 A;  4MEQ A;  3AQA A;  5AIU A;  2QIC A;  3DAI A;  4QSQ A;  5CRZ A;  4CUU A;  5FG4 A;  5EU1 A;  3UVX A;  5HRW A;  5IGK A;  3LQJ A;  2LDR A;  2MNZ A;  3L11 A;  3NXB A;  2Y1N A;  4Y03 A;  4J1P A;  2LSP B;  3PHD A;  3GL6 A;  3DPL R;  5FEY A;  2YUR A;  2DVV A;  2Y1M A;  1WUG A;  2LQ6 A;  2MD8 C;  5FE7 A;  4IOR A;  1MM2 A;  4W4U A;  5KTU A;  5JG6 A;  5F62 A;  2PNX A;  5H9M A;  4AVX A;  1WUM A;  1Z2Q A;  1WGM A;  2MUM A;  2D9E A;  2MA6 A;  5EWV A;  5G04 B;  4NYX A;  4CUS A;  3QZV A;  5CUG A;  4CLB A;  4A4B A;  5LVQ A;  5C4Q A;  4UIY A;  4ZQL A;  5CUD A;  5CUA A;  2RSD A;  5D24 A;  4LR6 A;  3P1E A;  1X4I A;  5I29 A;  2LGG A;  2H60 A;  5FE0 A;  1LDK C;  2DVR A;  4LRG A;  4UIW A;  4AYC A;  2L5E A;  4YYM A;  2G6Q A;  5LVR A;  5B75 A;  4QNS A;  5ENH A;  5KH7 A;  2L85 A;  2R0Y A;  3QZT A;  2H0D A;  3RCW A;  4YC9 A;  3U5L A;  2L5U A;  5L98 A;  2G43 A;  5FG5 A;  3G0L A;  5CZG A;  5I40 A;  2CKL A;  5FFV A;  3O70 A;  2LRI C;  4CFK A;  4TYL A;  1WEO A;  3G0J A;  4QZS A;  3UVW A;  4YY4 A;  5HEM A;  2G4A A;  5FDZ A;  3HCT A;  5BT5 A;  5DYX A; 
#chains in the Genus database with same CATH topology
 4I7D A;  5EA1 A;  5II2 A;  1LDJ B;  4Q0O A;  3U5O A;  1HYJ A;  4UIT A;  4NUD A;  1WES A;  1WFK A;  2VNF A;  2E7O A;  2OXQ C;  2VPG A;  5I1Q A;  3SVH A;  2MT5 A;  5ENF A;  4UYG A;  4L7X A;  4NYV A;  5KH9 A;  4C9Z A;  4NR9 A;  4HXS A;  1WIM A;  5JI8 A;  5DYU A;  3O37 A;  4YBM A;  3RPG C;  4KV1 A;  4LJN A;  4NR8 A;  3C6W A;  5D3N A;  4O70 A;  4OGI A;  3ZVZ B;  4LZS A;  5HFR A;  4QST A;  4LDF A;  5LJ0 A;  4C66 A;  1WIL A;  2I8N A;  5F25 A;  4AYC B;  4ALG A;  3O35 A;  4Z1S A;  3U5J A;  4IR4 A;  5BT3 A;  5F61 A;  2YYN A;  5EYA F;  4QR5 A;  5DKC A;  2CON A;  5D26 A;  4FLP A;  5L99 A;  4TZ8 A;  3M63 A;  4XI1 A;  4AP4 A;  5FFW A;  2RO1 A;  3ASL A;  2YYR A;  5CQT A;  4J0R A;  4Q0N A;  5D3H A;  1WEM A;  4N4I A;  2GRC A;  5DW1 A;  4XUB A;  5ENJ A;  2CKL B;  4QSS A;  5TRB A;  4A9L A;  3SOX A;  3GG3 A;  5HM0 A;  4HBY A;  3HMH A;  4UYH A;  4FJC A;  5EIC A;  2LV9 A;  4WHU A;  4YY6 A;  5JWM A;  2F6N A;  3MUL A;  1RMD A;  3PUQ A;  5EPR A;  4QSX A;  4HBV A;  5DBM A;  5HQ5 A;  5I86 A;  2JMJ A;  3GV4 A;  3LJU X;  2KKY A;  5A5N A;  4IC2 A;  5H1U A;  2DAT A;  5KO4 A;  4NXJ A;  4HBX A;  5EV9 A;  2YSJ A;  4QC3 A;  5IBN A;  4NRA A;  2ECJ A;  5I7X A;  4YYN A;  2KWN A;  4C67 A;  2MNY A;  4GND A;  1K2F A;  4NS5 A;  5FG6 A;  5FBX A;  3FAO A;  5B79 A;  1IYM A;  4AI6 A;  4AKI A;  3DQV R;  4UP5 A;  5DKD A;  4Z6H A;  2FUU A;  5KH3 A;  2IQJ A;  3D1B A;  1JM7 A;  5SVY A;  5FH7 A;  4YH3 A;  5HRX A;  1Z60 A;  4YAT A;  1F68 A;  2C2L A;  3N9Q A;  5CGP A;  5L97 A;  2PUY A;  4GNF A;  1WEU A;  3MUK A;  2L0B A;  2RI7 A;  4FIP A;  1MBM A;  3FKM X;  4PY6 A;  4WA6 A;  4R7E A;  1JM4 B;  5B78 A;  5LCW B;  5I80 A;  5J3X A;  5CP5 A;  4A9E A;  1CHC A;  2KE1 A;  5DIN A;  2K4D A;  2L43 A;  5J0D A;  5FFY A;  3FAN A;  4UP0 A;  4KCX A;  5F2P A;  5L8T A;  3JVJ A;  2L75 A;  3FEH A;  3LDY A;  4DON A;  5G0F A;  5CQ7 A;  4AKN A;  2LAU A;  3HCS A;  2I50 A;  4MR4 A;  5DY7 A;  5E7D A;  5HQ6 A;  4N4H A;  4LZR A;  2CSV A;  2RS9 B;  4O7E A;  4A4C A;  2OO1 A;  3P5O A;  4CFL A;  3HCU A;  2OWA A;  3LQI A;  5I89 A;  1ZKR A;  4YAD A;  2XOC A;  1E4U A;  2VPB A;  4MEP A;  4S3O B;  4MR5 A;  5EGU A;  3FL2 A;  4QF3 A;  3RTR B;  4YAB A;  4TU4 A;  5CQ3 A;  2R0S A;  5E9V A;  4NRB A;  4H9D A;  4CCG X;  4O7C A;  3JVL A;  4YK0 A;  2UZG A;  4HXO A;  4NUE A;  5EP7 A;  5IGL A;  4HBW A;  4NR4 A;  2KWK A;  2YHO A;  2KWJ A;  4QR4 A;  4UYF B;  4A9F A;  1JM7 B;  3UV2 A;  2KGI A;  5IGM A;  4GNE A;  2E7N A;  2I7K A;  4LZ2 A;  4LAD B;  4PCI A;  3N9P A;  4YYI A;  3EB6 A;  4Z0O A;  4IOQ A;  4BHW A;  4NN2 A;  4BW2 A;  3N9O A;  5HEN A;  4ZC9 A;  1X0J A;  2RFJ A;  5BT4 A;  5EPS A;  4WHW A;  2LGL A;  2JM3 A;  5C89 A;  4J3I A;  3U5M A;  4QBM A;  2FFW A;  4O72 A;  5H85 A;  3JUE A;  3FM8 C;  4F3I A;  2MJV B;  5FH6 A;  4CUQ A;  2G45 A;  4IR5 A;  4HXM A;  2YEK A;  2F6J A;  5HEL A;  4Z93 A;  2KIZ A;  5B77 A;  1BOR A;  3JVK A;  5AMF A;  2EGM A;  4UIX A;  4NYW A;  5DKH A;  4WZ3 B;  2BAY A;  5EQ1 A;  3S91 A;  4NR6 A;  5E0R A;  2NAA A;  2XEU A;  4B86 C;  1FP0 A;  4UIZ A;  3N9M A;  2OSS A;  1VD4 A;  2F42 A;  3IU6 A;  2L84 A;  2CRR A;  5FE6 A;  4A0C D;  5KU3 A;  3D7C A;  2YDW A;  2NXB A;  4Z1Q A;  3DWD A;  4A9M A;  2YSM A;  3P1F A;  4UIV A;  3UV5 A;  5E3G A;  4Q6F A;  2L7P A;  5B8D A;  5AD3 A;  1ZS5 A;  3LJW A;  4XUA A;  3S92 A;  2YU4 A;  3ZTG A;  3MDB C;  4I7B A;  2VJF A;  4AKG A;  3MQM A;  3IHP A;  5I7Y A;  2QIZ A;  2ECV A;  4B7Y C;  2RR4 A;  3O33 A;  3Q2F A;  3ERR A;  4QB3 A;  5CQ8 A;  2DX8 A;  4IR6 A;  4X2I A;  2H0D B;  2DVQ A;  3VKG A;  3Q1D A;  3T6R A;  2M1R A;  5HQ7 A;  4GB0 A;  5FE4 A;  5AME A;  5KTW A;  2E6R A;  4TS8 A;  5FH8 A;  5LUU A;  2XOY A;  5KHM A;  2EOD A;  5G4S A;  5D3P A;  4NRC A;  1JSP B;  4HXN A;  5A82 A;  4N3W A;  2R0V A;  5D7X A;  5E9Y A;  5FE5 A;  2HYE D;  4UYE A;  3VK6 A;  4A9K A;  2C2V S;  5HLS A;  4PCE A;  3O7A A;  4OUF A;  5F5Z A;  4MEO A;  5L96 A;  5LKU A;  3ZYU A;  2KYU A;  4QY4 A;  4L58 A;  5AD2 A;  2MA5 A;  3RPG B;  1WEE A;  1E6I A;  5CQ5 A;  3O47 A;  4UIU A;  2EA6 A;  4O62 A;  3U5N A;  4QUU A;  2CSY A;  2M85 A;  4QSW A;  3ZNI A;  3I2D A;  3HMF A;  4LYS A;  3SOW A;  4MVT A;  5DKA A;  3U5K A;  3UV4 A;  5E9L A;  4A49 A;  5B76 A;  3D1D A;  5CPE A;  4PTB A;  3HTK C;  5FB0 A;  5ENI A;  2KFT A;  4O71 A;  4QF2 A;  5DFC A;  4IOO A;  5CQ4 A;  5HCL A;  5H1V A;  3LVR E;  2VP7 A;  4OGJ A;  1U6G B;  2VJF B;  5HRV A;  4GPJ A;  3MHH A;  3N9N A;  4BW4 A;  2D8S A;  5CFW A;  5A5R A;  4TT4 A;  2R10 A;  3V43 A;  4YYD A;  2KKX A;  4TKP B;  4TZ2 A;  5A5S A;  5CS8 A;  4YYH A;  4YYK A;  5LKZ A;  2YEL A;  3P1D A;  2DKW A;  4LC2 A;  5II1 A;  3UW9 A;  2B0O E;  5LKT A;  4P5O B;  4LYI A;  2YQL A;  3KQI A;  4KV4 A;  4MR3 A;  4QYD A;  3LRQ A;  3LVQ E;  3KDE C;  4IR3 A;  3P1C A;  3T9K A;  4RVR A;  5D3T A;  5IID A;  4NUC A;  4QEU A;  5F1L A;  5H1T A;  2CT2 A;  2ZET C;  5FE2 A;  4S3O C;  5SVX A;  4FO9 A;  2YHN A;  4PPE A;  5DFB A;  4E96 A;  2YQM A;  2WP2 A;  3IU5 A;  2M6M A;  4LYW A;  4N4G A;  5G4R A;  5E9I A;  5CUB A;  2WP1 A;  3E2D A;  5D3L A;  4BJX A;  5HFQ A;  2KU3 A;  4QYL A;  1T1H A;  5FE9 A;  2L80 A;  2LGK A;  2XOZ A;  3M7K A;  3HME A;  5EWW A;  2AN6 A;  4O78 A;  4QSP A;  5ENE A;  4QEV A;  2JUN A;  2EJN A;  2M13 A;  5I83 A;  2XB1 A;  3EB5 A;  3SOU A;  3VKH A;  4J0S A;  3PUR A;  5CY9 A;  5EVA A;  1HYI A;  5A7C A;  4BW1 A;  5ENB A;  1WEQ A;  1PUO A;  4AUQ B;  1FBV A;  4TU6 A;  1Z6U A;  4QC1 A;  5TDW A;  5A83 A;  4MR6 A;  1VYX A;  5K29 A;  4QSR A;  4NQN A;  2Y43 A;  3NG2 A;  2JMI A;  4I7C A;  5EWH A;  4A9O A;  4O7B A;  2RNW A;  5CQ6 A;  2RNY A;  2CRW A;  2K16 A;  3T7L A;  1V87 A;  4BBQ A;  4OGC A;  4NQM A;  5CTL A;  2D8U A;  4WZ0 A;  4TT2 A;  5DYA A;  2RNX A;  5EK9 A;  4XY8 A;  5K3Q A;  4HXR A;  5D3J A;  4HXL A;  2VPE A;  5D0C A;  2VJE A;  4YBT A;  4PKL A;  4YBS A;  4TQN A;  5I88 A;  5D1K B;  2K17 A;  4QSV A;  5C11 A;  5LJ2 A;  3SHB A;  1MM3 A;  5C85 A;  5HJC A;  2ECW A;  3MXF A;  2MD7 B;  3ONI A;  3H7H A;  5ENC A;  5E9K A;  5FB1 A;  5A85 A;  4CUR A;  4HXP A;  3PLW A;  4XY9 A;  4CUP A;  4Z0R A;  2VPD A;  3KNV A;  5F60 A;  2MIQ A;  2ECT A;  5LKX A;  4O75 A;  5KTX A;  2KRE A;  5EIS A;  3FJU B;  3SVF A;  1WEW A;  2JMD A;  1DVP A;  4CUT A;  4R2Y A;  3JVM A;  3UVD A;  4V3K C;  2HDP A;  5TB6 A;  4ZDT A;  5EPB A;  2ECG A;  5CU8 A;  2K1J A;  2FUI A;  2LXH C;  3ZYQ A;  5ACY A;  5ENG A;  5TBN A;  3SUB A;  4V3L C;  3LXJ A;  1WEP A;  4YYG A;  2FSA A;  2ECN A;  5FE3 A;  5E73 A;  2E61 A;  4A9I A;  5FER A;  2EGP A;  4MSX A;  2KR4 A;  4GNG A;  4CA1 A;  4O76 A;  4A9N A;  2IDA A;  4QR3 A;  5EI4 A;  2DVS A;  4A9H A;  4F52 B;  2YQD A;  4OGE A;  2VJE B;  4QEW A;  2XP0 A;  5CQA A;  2ECI A;  4TT6 A;  5EWC A;  5TCM A;  4UI9 B;  5E74 A;  3M62 A;  1F62 A;  4O7A A;  2DSM A;  5F1H A;  5F3A A;  4MEN A;  5L8U A;  5AIT A;  5D1L B;  4ZW1 A;  3ZPV 1;  5CUE A;  1JOC A;  1X4U A;  3C5K A;  5F63 A;  4NR5 A;  3DWY A;  5D1M B;  5SVI A;  5IG6 A;  3U5P A;  2E3K A;  4PS5 A;  5A5Q A;  5CRM A;  4LK9 A;  3MB4 A;  1WE9 A;  2YW8 A;  5D3S A;  3I3J A;  4ALH A;  2P57 A;  2KTB B;  2YT5 A;  2YEM A;  5IGN A;  4O64 A;  1G25 A;  2D82 A;  2LXP C;  5DFD A;  2LN0 A;  4A9J A;  1N87 A;  5D25 A;  5EWD A;  3AAD A;  2E6S A;  1X4J A;  4WIV A;  1WEN A;  4Z6I A;  4N4F A;  4UYD A;  2CSZ A;  5ETB A;  4CL9 A;  4NR7 A;  4F1P A;  4QSU A;  3N9L A;  3ZPV E;  5E9M A;  2YUC A;  4IC3 A;  4BW3 A;  5F36 A;  2N9G A;  2DWW A;  4FK5 A;  1N72 A;  5ETD A;  5DW2 A;  5CUC A;  5DLZ A;  4YH4 A;  2YRE A;  3SVG A;  1XWH A;  1EQF A;  3LQH A;  5D3R A;  1WEV A;  2KWO A;  2M3H A;  4WZ2 A;  4X3G A;  4AKH A;  3ZVY A;  5C13 A;  5DYC A;  3L1X A;  4O7F A;  4QUT A;  3UVY A;  4YYJ A;  4LKA A;  2YW5 A;  1ZBD B;  3MB3 A;  5I3L A;  5FE1 A;  3KV5 A;  3TLP A;  5A5P A;  5TDR A;  3MHS A;  4XYA A;  5SVI B;  5C8G A;  4LLB A;  5C87 A;  2QJ0 A;  4O74 A;  2KGG A;  5E3D A;  4UYF A;  5C7N A;  3QZS A;  5FE8 A;  3L1Z B;  5TAB A;  3K2J A;  2JRJ A;  3Q2E A;  3KV6 A;  3M99 A;  3O34 A;  5EM3 A;  2EXU A;  4ZUX U;  3O36 A;  4O77 A;  4TTE A;  2OUO A;  5A81 A;  5G05 B;  4QQ4 A;  4HXK A;  2LGV A;  5DLX A;  5A5O A;  4R8P K;  4YAX A;  1VFY A;  5LJ1 A;  5COI A;  5DX4 A;  4MEQ A;  3AQA A;  5AIU A;  2QIC A;  3DAI A;  4QSQ A;  5CRZ A;  4CUU A;  2MKE A;  5FG4 A;  5EU1 A;  3UVX A;  5HRW A;  5IGK A;  3LQJ A;  2FD4 A;  2LDR A;  2MNZ A;  3L11 A;  3NXB A;  2Y1N A;  4Y03 A;  4J1P A;  2LSP B;  3PHD A;  3GL6 A;  3DPL R;  5FEY A;  2YUR A;  2DVV A;  2Y1M A;  1WUG A;  2LQ6 A;  2MD8 C;  5FE7 A;  4IOR A;  1MM2 A;  4W4U A;  5KTU A;  5JG6 A;  5F62 A;  2PNX A;  5H9M A;  4AVX A;  1WUM A;  1Z2Q A;  1WGM A;  2MUM A;  2D9E A;  2MA6 A;  5EWV A;  5G04 B;  4NYX A;  4CUS A;  3QZV A;  5CUG A;  4CLB A;  4A4B A;  5LVQ A;  5C4Q A;  4UIY A;  4ZQL A;  5CUD A;  5CUA A;  2RSD A;  5D24 A;  4LR6 A;  3P1E A;  1X4I A;  5I29 A;  2LGG A;  2H60 A;  5FE0 A;  1LDK C;  2DVR A;  3DDT A;  2YVR A;  4LRG A;  4UIW A;  4AYC A;  2L5E A;  4YYM A;  2G6Q A;  5LVR A;  5B75 A;  4QNS A;  5ENH A;  5KH7 A;  2L85 A;  2R0Y A;  3QZT A;  2H0D A;  3RCW A;  4YC9 A;  3U5L A;  2L5U A;  2DJA A;  5L98 A;  2G43 A;  5FG5 A;  3G0L A;  5CZG A;  5I40 A;  2CKL A;  5FFV A;  3O70 A;  2LRI C;  4CFK A;  4TYL A;  1WEO A;  3G0J A;  4QZS A;  3UVW A;  1DCQ A;  4YY4 A;  5HEM A;  2G4A A;  5FDZ A;  3HCT A;  5BT5 A;  5DYX A; 
#chains in the Genus database with same CATH homology
 4I7D A;  5EA1 A;  5II2 A;  1LDJ B;  4Q0O A;  3U5O A;  1HYJ A;  4UIT A;  4NUD A;  1WES A;  1WFK A;  2VNF A;  2E7O A;  2OXQ C;  2VPG A;  5I1Q A;  3SVH A;  2MT5 A;  5ENF A;  4UYG A;  4L7X A;  4NYV A;  5KH9 A;  4C9Z A;  4NR9 A;  4HXS A;  1WIM A;  5JI8 A;  5DYU A;  3O37 A;  4YBM A;  3RPG C;  4KV1 A;  4LJN A;  4NR8 A;  3C6W A;  5D3N A;  4O70 A;  4OGI A;  3ZVZ B;  4LZS A;  5HFR A;  4QST A;  4LDF A;  5LJ0 A;  4C66 A;  1WIL A;  2I8N A;  5F25 A;  4AYC B;  4ALG A;  3O35 A;  4Z1S A;  3U5J A;  4IR4 A;  5BT3 A;  5F61 A;  2YYN A;  5EYA F;  4QR5 A;  5DKC A;  5D26 A;  4FLP A;  5L99 A;  4TZ8 A;  3M63 A;  4XI1 A;  4AP4 A;  5FFW A;  2RO1 A;  3ASL A;  2YYR A;  5CQT A;  4J0R A;  4Q0N A;  5D3H A;  1WEM A;  4N4I A;  2GRC A;  5DW1 A;  4XUB A;  5ENJ A;  2CKL B;  4QSS A;  5TRB A;  4A9L A;  3SOX A;  3GG3 A;  5HM0 A;  4HBY A;  3HMH A;  4UYH A;  4FJC A;  5EIC A;  2LV9 A;  4WHU A;  4YY6 A;  5JWM A;  2F6N A;  3MUL A;  1RMD A;  3PUQ A;  5EPR A;  4QSX A;  4HBV A;  5DBM A;  5HQ5 A;  5I86 A;  2JMJ A;  3GV4 A;  5A5N A;  4IC2 A;  5H1U A;  2DAT A;  5KO4 A;  4NXJ A;  4HBX A;  5EV9 A;  2YSJ A;  4QC3 A;  5IBN A;  4NRA A;  2ECJ A;  5I7X A;  4YYN A;  2KWN A;  4C67 A;  2MNY A;  4GND A;  1K2F A;  4NS5 A;  5FG6 A;  5FBX A;  5B79 A;  1IYM A;  3DQV R;  4UP5 A;  5DKD A;  4Z6H A;  2FUU A;  5KH3 A;  1JM7 A;  5FH7 A;  4YH3 A;  5HRX A;  1Z60 A;  4YAT A;  1F68 A;  2C2L A;  3N9Q A;  5CGP A;  5L97 A;  2PUY A;  4GNF A;  1WEU A;  3MUK A;  2L0B A;  2RI7 A;  4FIP A;  3FKM X;  4PY6 A;  4WA6 A;  4R7E A;  1JM4 B;  5B78 A;  5LCW B;  5I80 A;  5J3X A;  5CP5 A;  4A9E A;  1CHC A;  2KE1 A;  5DIN A;  2K4D A;  2L43 A;  5J0D A;  5FFY A;  4UP0 A;  4KCX A;  5F2P A;  5L8T A;  3JVJ A;  2L75 A;  4DON A;  5G0F A;  5CQ7 A;  4AKN A;  3HCS A;  2I50 A;  4MR4 A;  5DY7 A;  5E7D A;  5HQ6 A;  4N4H A;  4LZR A;  2RS9 B;  4O7E A;  4A4C A;  2OO1 A;  3P5O A;  4CFL A;  3HCU A;  3LQI A;  5I89 A;  4YAD A;  1E4U A;  2VPB A;  4MEP A;  4S3O B;  4MR5 A;  5EGU A;  3FL2 A;  4QF3 A;  3RTR B;  4YAB A;  4TU4 A;  5CQ3 A;  2R0S A;  5E9V A;  4NRB A;  4CCG X;  4O7C A;  3JVL A;  4YK0 A;  2UZG A;  4HXO A;  4NUE A;  5EP7 A;  5IGL A;  4HBW A;  4NR4 A;  2KWK A;  2YHO A;  2KWJ A;  4QR4 A;  4UYF B;  4A9F A;  1JM7 B;  3UV2 A;  2KGI A;  5IGM A;  4GNE A;  2E7N A;  2I7K A;  4LZ2 A;  4LAD B;  4PCI A;  3N9P A;  4YYI A;  3EB6 A;  4IOQ A;  4BHW A;  4NN2 A;  4BW2 A;  3N9O A;  5HEN A;  4ZC9 A;  1X0J A;  2RFJ A;  5BT4 A;  5EPS A;  4WHW A;  2LGL A;  5C89 A;  4J3I A;  3U5M A;  4QBM A;  4O72 A;  5H85 A;  4F3I A;  2MJV B;  5FH6 A;  4CUQ A;  2G45 A;  4IR5 A;  4HXM A;  2YEK A;  2F6J A;  5HEL A;  4Z93 A;  2KIZ A;  5B77 A;  1BOR A;  3JVK A;  5AMF A;  4UIX A;  4NYW A;  5DKH A;  4WZ3 B;  2BAY A;  5EQ1 A;  3S91 A;  4NR6 A;  5E0R A;  2NAA A;  2XEU A;  4B86 C;  1FP0 A;  4UIZ A;  3N9M A;  2OSS A;  1VD4 A;  2F42 A;  3IU6 A;  2L84 A;  5FE6 A;  4A0C D;  5KU3 A;  3D7C A;  2YDW A;  2NXB A;  4Z1Q A;  4A9M A;  2YSM A;  3P1F A;  4UIV A;  3UV5 A;  5E3G A;  4Q6F A;  5B8D A;  5AD3 A;  1ZS5 A;  3LJW A;  4XUA A;  3S92 A;  2YU4 A;  3ZTG A;  4I7B A;  2VJF A;  3MQM A;  3IHP A;  5I7Y A;  2QIZ A;  2ECV A;  4B7Y C;  3O33 A;  3Q2F A;  4QB3 A;  5CQ8 A;  2DX8 A;  4IR6 A;  4X2I A;  2H0D B;  2DVQ A;  3T6R A;  2M1R A;  5HQ7 A;  4GB0 A;  5FE4 A;  5AME A;  5KTW A;  2E6R A;  4TS8 A;  5FH8 A;  5LUU A;  5KHM A;  2EOD A;  5G4S A;  5D3P A;  4NRC A;  1JSP B;  4HXN A;  5A82 A;  4N3W A;  2R0V A;  5D7X A;  5E9Y A;  5FE5 A;  2HYE D;  4UYE A;  3VK6 A;  4A9K A;  2C2V S;  5HLS A;  4PCE A;  3O7A A;  4OUF A;  5F5Z A;  4MEO A;  5L96 A;  5LKU A;  3ZYU A;  2KYU A;  4QY4 A;  4L58 A;  5AD2 A;  2MA5 A;  3RPG B;  1WEE A;  1E6I A;  5CQ5 A;  4UIU A;  2EA6 A;  3U5N A;  4QUU A;  2CSY A;  2M85 A;  4QSW A;  3ZNI A;  3I2D A;  3HMF A;  4LYS A;  3SOW A;  4MVT A;  3U5K A;  3UV4 A;  5E9L A;  4A49 A;  5B76 A;  5CPE A;  4PTB A;  3HTK C;  5FB0 A;  5ENI A;  2KFT A;  4O71 A;  4QF2 A;  5DFC A;  4IOO A;  5CQ4 A;  5HCL A;  5H1V A;  3MHH A;  2VP7 A;  4OGJ A;  1U6G B;  2VJF B;  5HRV A;  4GPJ A;  3N9N A;  4BW4 A;  2D8S A;  5CFW A;  5A5R A;  4TT4 A;  2R10 A;  3V43 A;  4YYD A;  4TKP B;  4TZ2 A;  5A5S A;  5CS8 A;  4YYH A;  4YYK A;  5LKZ A;  2YEL A;  3P1D A;  2DKW A;  4LC2 A;  5II1 A;  3UW9 A;  5LKT A;  4P5O B;  4LYI A;  2YQL A;  3KQI A;  4KV4 A;  4MR3 A;  4QYD A;  3LRQ A;  4IR3 A;  3P1C A;  4RVR A;  5D3T A;  5IID A;  4NUC A;  4QEU A;  5F1L A;  5H1T A;  2CT2 A;  2ZET C;  5FE2 A;  4S3O C;  4FO9 A;  2YHN A;  4PPE A;  5DFB A;  4E96 A;  2YQM A;  2WP2 A;  3IU5 A;  2M6M A;  4LYW A;  4N4G A;  5G4R A;  5E9I A;  5CUB A;  2WP1 A;  5D3L A;  4BJX A;  5HFQ A;  2KU3 A;  4QYL A;  1T1H A;  5FE9 A;  2L80 A;  2LGK A;  3HME A;  5EWW A;  2AN6 A;  4O78 A;  4QSP A;  5ENE A;  4QEV A;  2XB1 A;  3EB5 A;  3SOU A;  5I83 A;  4J0S A;  3PUR A;  5CY9 A;  5EVA A;  1HYI A;  5A7C A;  4BW1 A;  5ENB A;  1WEQ A;  4AUQ B;  1FBV A;  4TU6 A;  1Z6U A;  4QC1 A;  5TDW A;  5A83 A;  4MR6 A;  1VYX A;  5K29 A;  4QSR A;  4NQN A;  2Y43 A;  3NG2 A;  2JMI A;  4I7C A;  5EWH A;  4A9O A;  4O7B A;  2RNW A;  5CQ6 A;  2RNY A;  2K16 A;  3T7L A;  1V87 A;  4BBQ A;  4NQM A;  5CTL A;  4WZ0 A;  4TT2 A;  5DYA A;  2RNX A;  5EK9 A;  4XY8 A;  4HXR A;  5D3J A;  4HXL A;  2VPE A;  5D0C A;  2VJE A;  4YBT A;  4PKL A;  4YBS A;  4TQN A;  5I88 A;  5D1K B;  2K17 A;  4QSV A;  5C11 A;  5LJ2 A;  3SHB A;  1MM3 A;  5C85 A;  5HJC A;  2ECW A;  3MXF A;  2MD7 B;  3ONI A;  5ENC A;  5E9K A;  5FB1 A;  5A85 A;  4CUR A;  4HXP A;  4XY9 A;  4CUP A;  2VPD A;  3KNV A;  5F60 A;  2MIQ A;  2ECT A;  5LKX A;  4O75 A;  5KTX A;  2KRE A;  5EIS A;  3SVF A;  1WEW A;  2JMD A;  1DVP A;  4CUT A;  4R2Y A;  3JVM A;  3UVD A;  4V3K C;  2HDP A;  5TB6 A;  4ZDT A;  5EPB A;  2ECG A;  5CU8 A;  2K1J A;  2FUI A;  2LXH C;  3ZYQ A;  5ACY A;  5ENG A;  5TBN A;  4V3L C;  3LXJ A;  1WEP A;  4YYG A;  2FSA A;  2ECN A;  5FE3 A;  5E73 A;  4A9I A;  5FER A;  2EGP A;  4MSX A;  2KR4 A;  4GNG A;  4CA1 A;  4O76 A;  4A9N A;  2IDA A;  4QR3 A;  5EI4 A;  2DVS A;  4A9H A;  4F52 B;  2YQD A;  2VJE B;  4QEW A;  5CQA A;  2ECI A;  4TT6 A;  5EWC A;  5TCM A;  4UI9 B;  5E74 A;  3M62 A;  1F62 A;  4O7A A;  5AIT A;  5F1H A;  5F3A A;  4MEN A;  5L8U A;  5D1L B;  4ZW1 A;  3ZPV 1;  5CUE A;  1JOC A;  1X4U A;  3C5K A;  5F63 A;  4NR5 A;  3DWY A;  5D1M B;  5IG6 A;  3U5P A;  2E3K A;  4PS5 A;  5A5Q A;  5CRM A;  4LK9 A;  3MB4 A;  1WE9 A;  2YW8 A;  5D3S A;  3I3J A;  4ALH A;  2KTB B;  2YT5 A;  2YEM A;  5IGN A;  4O64 A;  1G25 A;  2D82 A;  2LXP C;  5DFD A;  2LN0 A;  4A9J A;  1N87 A;  5D25 A;  5EWD A;  3AAD A;  2E6S A;  1X4J A;  4WIV A;  1WEN A;  4Z6I A;  4N4F A;  4UYD A;  2CSZ A;  5ETB A;  4CL9 A;  4NR7 A;  4QSU A;  3N9L A;  3ZPV E;  5E9M A;  2YUC A;  4IC3 A;  4BW3 A;  5F36 A;  2N9G A;  2DWW A;  4FK5 A;  1N72 A;  5ETD A;  5DW2 A;  5CUC A;  5DLZ A;  4YH4 A;  2YRE A;  3SVG A;  1XWH A;  1EQF A;  3LQH A;  5D3R A;  1WEV A;  2KWO A;  2M3H A;  4WZ2 A;  4X3G A;  5DKA A;  3ZVY A;  5C13 A;  5DYC A;  3L1X A;  4O7F A;  4QUT A;  3UVY A;  4YYJ A;  4LKA A;  2YW5 A;  1ZBD B;  3MB3 A;  5I3L A;  5FE1 A;  3KV5 A;  3TLP A;  5A5P A;  5TDR A;  3MHS A;  4XYA A;  5C8G A;  4LLB A;  5C87 A;  2QJ0 A;  4O74 A;  2KGG A;  5E3D A;  4UYF A;  5C7N A;  3QZS A;  5FE8 A;  3L1Z B;  5TAB A;  3K2J A;  2JRJ A;  3Q2E A;  3KV6 A;  3M99 A;  3O34 A;  5EM3 A;  4ZUX U;  3O36 A;  4O77 A;  4TTE A;  2OUO A;  5A81 A;  5G05 B;  4HXK A;  2LGV A;  5DLX A;  5A5O A;  4R8P K;  4YAX A;  1VFY A;  5LJ1 A;  5COI A;  5DX4 A;  4MEQ A;  3AQA A;  5AIU A;  2QIC A;  3DAI A;  4QSQ A;  5CRZ A;  4CUU A;  5FG4 A;  5EU1 A;  3UVX A;  5HRW A;  5IGK A;  3LQJ A;  2LDR A;  2MNZ A;  3L11 A;  3NXB A;  2Y1N A;  4Y03 A;  4J1P A;  2LSP B;  3PHD A;  3GL6 A;  3DPL R;  5FEY A;  2YUR A;  2DVV A;  2Y1M A;  1WUG A;  2LQ6 A;  2MD8 C;  5FE7 A;  4IOR A;  1MM2 A;  4W4U A;  5KTU A;  5JG6 A;  5F62 A;  2PNX A;  5H9M A;  4AVX A;  1WUM A;  1Z2Q A;  1WGM A;  2MUM A;  2D9E A;  2MA6 A;  5EWV A;  5G04 B;  4NYX A;  4CUS A;  3QZV A;  5CUG A;  4CLB A;  4A4B A;  5LVQ A;  5C4Q A;  4UIY A;  4ZQL A;  5CUD A;  5CUA A;  2RSD A;  5D24 A;  4LR6 A;  3P1E A;  1X4I A;  5I29 A;  2LGG A;  2H60 A;  5FE0 A;  1LDK C;  2DVR A;  4LRG A;  4UIW A;  4AYC A;  2L5E A;  4YYM A;  2G6Q A;  5LVR A;  5B75 A;  4QNS A;  5ENH A;  5KH7 A;  2L85 A;  2R0Y A;  3QZT A;  2H0D A;  3RCW A;  4YC9 A;  3U5L A;  2L5U A;  5L98 A;  2G43 A;  5FG5 A;  3G0L A;  5CZG A;  5I40 A;  2CKL A;  5FFV A;  3O70 A;  2LRI C;  4CFK A;  4TYL A;  1WEO A;  3G0J A;  4QZS A;  3UVW A;  4YY4 A;  5HEM A;  2G4A A;  5FDZ A;  3HCT A;  5BT5 A;  5DYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...