2RIOA

Structure of the dual enzyme ire1 reveals the basis for catalysis and regulation of non-conventional splicing
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
427
structure length
396
Chain Sequence
b'NFEQSLKNLVVSEKILGYGSSGTVVFQGSFQGRPVAVKRMLIDFCDIALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESKYNPISLLRQIASGVAHLHSLKIIHRDLKPQNILVSTSSRFTADQQTGAENLRILISDFGLCKKLDSTSGWRAPELLEESNNLQTKRRLTRSIDIFSMGCVFYYILSKGKHPFGDKYSRESNIIRGIFSLDEMKCLHDRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPPSALLMKFDAGSDFVIPSGDWTVKFDKTFMDRKYHSSKLMDLLRALRNKYHHFMDLPEDIAELMGPVPDGFYDYFTKRFPNLLIGVYMIVKENLSDDQILREFLYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase/endoribonuclease IRE1
publication title Structure of the dual enzyme ire1 reveals the basis for catalysis and regulation in nonconventional RNA splicing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase, transferase
total genus 114
structure length 396
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06479 Ribonuc_2-5A Ribonuclease 2-5A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2rioA02
1.20.1440.180 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2rioA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2rioA01
2PZ5A 4O0VA 4E4MA 3GC8A 4JDJA 1P14A 2VGOA 4V05A 4FL3A 4GK4A 1OKYA 1OKVA 3COIA 3U9NA 2REIA 5HNBA 3GXLA 5HBJA 2H9VA 2UW9A 3O50A 2CMWA 2WPAA 5FTOA 5L6WL 4F70A 3EN4A 2UZOA 4KNBA 1OITA 4FC0A 3PA5A 2YDJA 4O7LA 4U41A 4BDKA 3DXQA 4N6ZA 5IH4A 3AT3A 3O7LB 1BKXA 5D7AA 3EQCA 4JI9A 4IW0A 4UZDA 5E90A 5IU2A 1LUFA 5KKRB 4S33A 2DYLA 3VUHA 4GRBA 4BI0A 3EQDA 2YCQA 5KO1A 3DQWA 2ZM3A 5A46A 3PP1A 2Z60A 3OT8A 3MSSA 2Z02A 5I9UA 4FT3A 2E9VA 1GZOA 3KXNA 4QPAA 2VTAA 1WBSA 3P9JA 3ROCA 3FY2A 1UVRA 4ZIMA 4CKIA 2WTDA 4C57A 4FV6A 3VBQA 5HG8A 4FG9A 4E6QA 2YM3A 4I24A 3OTVA 5ANEA 3R28A 4QMXA 3NUXA 1RQQA 5E9EA 5JFWA 3IOKA 5TF9A 4CD0A 3CTQA 4C37A 4NIFB 3MH0A 3EN7A 2J9MA 2JDTA 1JLUE 2R7IA 3OF0A 3ELJA 4HOKA 1HCKA 4WUAA 5CEKA 3PSBA 2G2FA 3P4KA 3QTWA 2HOGA 4FKSA 2WIPA 3TIYA 3UQCA 3PDTA 4OW8A 2XIRA 4ANNA 4D2PA 3TACA 3P23A 5JFVA 4RWKA 4FSYA 3UQFA 4U79A 4RQVA 3CD8A 5CXZA 1UKIA 3NSZA 1XKKA 4XBRA 3TG1A 4C3FA 2WMUA 5BMMA 4C7TA 2GFCA 4ZS0A 3MW1A 1BLXA 4AZVA 3UYSA 3GCPA 3EMGA 1BUHA 2X8IA 4IWQA 3Q3BA 5E8VA 2R2PA 3HL7A 2R3KA 4DEGA 2BFYA 3PY0A 2PMIA 3NUNA 4QMNA 2HWOA 3WIKA 5M06A 1UWHA 3VUTA 5K5XA 2J51A 2BMCA 2F2UA 2PVNA 4TWCA 2PL0A 2XNPA 3OC1A 3SXSA 4WSYA 3O23A 4F7NA 5CSPA 3NNWA 3NVKI 1Q24A 4FGBA 2Q0BA 4DITA 3HV5A 1QL6A 4IE9A 3R8PA 2CLQA 1CTPE 2YZAA 4L52A 4F9YA 1W82A 3DY7A 5BYLA 5KMKA 2WTKB 2CCHA 3PIZA 5BVWA 1Z5MA 3LQ5A 3U4UA 2XJ1A 4EHVA 4EYJA 2XKDA 2ONLA 1XHAA 2Z7QA 2UZVA 4UZHA 4EJNA 4XP0A 2CGVA 3CD3A 2UVXA 2IVVA 3H4JA 4XH6A 4G9RA 1OIUA 4AFJA 3MVMA 1W84A 4YPDA 4FL1A 5K3YA 3K3IA 4UY9A 5LOHA 4DINA 4Q5HA 4O0RA 2ZV2A 4DEDA 1G5SA 1OBDA 3IPHA 4V04A 3KCKA 5KMNA 3OG7A 2ITOA 1ZY5A 5AR5A 4LM5A 4I3ZA 4AN2A 3B8RA 3QYWA 4I5HA 2UZBA 2JBOA 4EUTA 5HIEA 3FI3A 3QD0A 1U54A 4JLCA 4LI5A 4CT2A 1OZ1A 4KB8A 2R3IA 3CGOA 5FBOA 2OK1A 5CQWA 2WAJA 4YSJA 5HGIA 2Y7JA 5M09A 4CRSA 3G5DA 4S2ZA 4UWYA 4XUFA 3PPJA 4M15A 2XS0A 5C26A 3SW7A 4ANBA 2GHGA 2QU6A 4JAJA 3RAHA 4CKJA 2HXQA 4EONA 1OBGA 2XJ0A 3TL8A 2VNWA 4QNAA 2C3KA 4CQGA 4EK6A 3ORXA 4Y46A 5TOZA 3E8NA 4FZAB 3DBEA 5H9BA 4PWNA 3GCVA 4KSPA 5EQYA 4DTBA 3CC6A 2XNMA 3QC9A 4CYIA 2BTSA 3HRFA 4ZAUA 3AMYA 4QP7A 2ITYA 4FX3A 2C6MA 5LMBA 4DT9A 3FKLA 5BUEA 3V5PA 2G2IA 4D4VA 3ZO3A 3F3WA 5BYYA 1GOLA 2B55A 2YJRA 4H58A 3O8TA 4QMLA 3OY1A 4TYJA 2ITXA 5LMKA 1P5EA 1GIJA 5HD7A 5ACBC 4D28A 3SVVA 4X3FC 3TUDA 3KXZA 3S3IA 1R1WA 4CNHA 4I94A 5M55A 5IMEA 4WSQA 1M2RA 2UW5A 2C0IA 3MIYA 4U3ZA 4H1MA 4AZSA 4BN1A 5EYDA 4X2GA 3IK3A 4IVCA 2Y6OA 3EFJA 3BU5A 3ZTXA 5HOAA 4EOOA 3GNIB 2XK8A 4JBPA 1H25A 2OICA 3EFKA 2IW9A 5L6OA 3QX4A 3V8SA 5HEZA 3II5A 4I21A 5M4IA 2B1PA 2RFNA 3C0HA 4EOMA 4RLLA 4DFNA 3BU3A 4AOJA 3D5UA 5HIBA 3HMMA 4KSQA 4Y83A 3KULB 4O2PA 4BTJA 3AD5A 2RG6A 2RFDA 3FC1X 5IMXA 2OW3A 2R7BA 3VN9A 4ZSAA 3LLAA 4LGGA 2YLEA 3MPTA 3EQBA 1IRKA 2EB2A 3D4QA 3M42A 5IA0A 3D9VA 3IW6A 4CZUA 1KOBA 4LMUA 4D5KA 5CSHA 2OZAA 1PHKA 4H3BA 2ITNA 2VWUA 3VS5A 4CXAA 2ZMDA 4Y8DA 3CTJA 4GKIA 2F49A 3D2IA 4BBFA 4WG4A 4GG5A 4ZS4A 3NLBA 4EHZA 2C5NA 3QTRA 3IKAA 4HGEA 4J1RA 1J1BA 5I0BA 1Y6BA 3TCPA 3ENHA 2ITWA 3F3ZA 3RTPA 3ZLXA 3MFTA 3VUIA 2P2HA 5M07A 1APME 4XYFA 4O7TA 3TXOA 2OIBA 5IKWA 5J9LA 3Q4UA 4ZP5A 3HV6A 4FIGA 4RFZA 4USDA 5TT7A 3AOXA 3EQPA 3I6WA 2IW8A 3RPSA 2W1EA 2E9PA 2ETRA 4D1SA 4EYMA 2QCSA 4OAVB 4XOZA 1PYXA 5HKMA 4EOLA 1O6LA 3R7OA 4TL0A 4U7ZA 2W4OA 5LVMA 5TE0A 3AT4A 5GZAA 2B9FA 4BY9E 4BDJA 1QCFA 3LCDA 4QT1A 3BYOA 3ZOSA 4E3CA 4ANOA 4YU2A 3AT2A 1ZWSA 2A4LA 2X8DA 5HD4A 4A9YA 3QQJA 4OGRA 2X39A 4DG2E 1YOMA 3MFSA 3SOCA 2BRMA 3EL7A 1YOJA 4FIIA 4XOYA 3ID6C 4MQ2A 4DFXE 4F0FA 4D5HA 3NYXA 4FTNA 2X6EA 4F64A 2C6OA 3QLFA 4ZSJA 3ORIA 3O2MA 4C61A 3FJQE 1VYWA 2WD1A 2FO0A 1FPUA 4WG3A 5CVHA 3NW5A 4W8EA 2NP8A 1SMHA 3NW6A 4KIKA 2EVAA 3MVLA 2RL5A 3FQHA 5DG5A 3ORKA 1NVRA 4AOIA 4IBMA 4IM0A 1OKZA 2X4ZA 3VS4A 4AZFA 3QTXA 1REKA 2JLDA 3G6GA 4IZYA 3FLNC 4IQ6A 1FMKA 3T3UA 3ZRMA 1CKJA 2B9IA 4X6RA 5CEIA 2IVUA 3ZLSA 3MH3A 4NKAA 4NYEA 5AR3A 3KB7A 1L8TA 5K4JA 4F6SA 5M44A 3OOMA 5LCJA 4R77A 3IW5A 1J1CA 3F7ZA 3QGWA 1YXTA 2Y9QA 5KKRC 1NW1A 2OF2A 3HRCA 4BZOA 3OWKA 3GUBA 4C34A 3JPVA 4WNOA 3R9HA 4TYHA 3ERKA 3SQQA 4QMWA 3LLTA 5JGBA 4TWNA 2R5TA 4BL1A 4TY1A 3R8UA 4O6LA 5LMAA 2QKWB 1E9HA 1SNUA 4AT5A 3OBGA 5D11A 2C5VA 3OD6X 4QP3A 3LPBA 3OTUA 4UYAA 1H1QA 4MHAA 3OXZA 4UYNA 3PLSA 4WRGA 2VTRA 1AQ1A 4FKOA 1CSNA 3FSKA 2BHHA 5EDRA 5L8KA 3L8XA 4OTPA 1RW8A 5FEQA 3OMVA 4O82A 1RJBA 4HGSA 2WU7A 3HMOA 2DQ7X 2C69A 5DR9A 4MNEA 3R7IA 4EH2A 3C51A 2XBJA 2OI4X 4AU8A 4C4JA 5AA9A 4FICA 5L8LA 1KE9A 4RJ7A 4YZBA 2LAVA 2YM5A 5CX9A 3TKUA 2PVHA 4EKKA 4FGRA 5EHLA 1IG1A 1QPJA 2B4SB 3PIXA 2QO7A 2CKQA 4KKGA 2YDKA 5EW9A 2C5XA 3DFAA 3GU6A 5AP6A 3VO3A 3ZM9A 3KFAA 4RIWB 1P2AA 2XCHA 2RG5A 1Y8GA 5GJFA 4AW5A 3GT8A 4C2WA 3BHHA 4DFUA 2I0EA 2RKUA 3O96A 4EQMA 3QHRA 3W16A 1YRPA 5AP2A 3TZ9A 4KBAA 1XR1A 3UJGA 3QXPA 4AUAA 4FKTA 1KWPA 2VTMA 3L9PA 5D7VA 3VS0A 2OSCA 3LFCA 5M57A 2X0GA 4FTCA 4GW8A 5L6PA 3WE8A 3DAJA 4TYEA 3OCBA 4Q9SA 4X2FA 2EXEA 3NRMA 5AR4A 4GK2A 4C3PA 4CT1A 3VW8A 3DV3A 4L53A 2PVYA 5A54A 5KZIA 1ZYLA 1E1XA 3TZMA 4FNWA 4FIFA 3LM0A 4K8AA 3PXKA 4ZMEA 2C6LA 3CQEA 3ORLA 1FQ1B 4J7BA 4QYHA 3ATTA 4R7HA 5IUGA 4JIAA 4EWHA 2GS2A 3NYVA 3CY2A 5DMZA 4A9UA 4D2RA 4YURA 2ITZA 2JGZA 2WOUA 4AG8A 3SG9A 3C5UA 4L43A 4GS6A 3Q53A 2IJMA 3F6XA 1XH8A 5AUXA 3U54A 2EXMA 4PDOA 5CWZA 3LCOA 5I9VA 4ORKA 2C6KA 4D0WA 5E8WA 1UWJA 3PPKA 2X2LA 3QKMA 2GCDA 4GVAA 2J7TA 3R63A 4YJVA 1K9AA 3CEKA 1ZZ2A 3HV3A 3BV2A 4IZ7A 4CKRA 1WBWA 4FSWA 3GBZA 3MBLA 3PXRA 3QCYA 5EDQA 3W1FA 1NVQA 2YERA 5HCZA 4GMYA 4HNFA 1P4OA 3ORTA 5CZHA 4O7NA 1M17A 4K6ZA 4W4VA 4CRLA 3GEQA 5A14A 2C4GA 1PXPA 1TQPA 2R3MA 1H01A 2PK9A 3RPRA 5ETAA 1YI6A 4AGDA 3Q96A 4A9RA 4K9YA 5JT2A 3NNVA 4D4YA 5HQ0A 3IG7A 4OTHA 3UODA 3RINA 3S95A 3UVRA 1KSWA 5FLFA 3PVGA 3MN3A 1OECA 1H1SA 3C0GA 3OXIA 3LCTA 1P4FA 2OWBA 3R1SA 1CKPA 4FV7A 4ACDA 4M69A 2KULA 1H0WA 3GU7A 2OH4A 2QOHA 3DCVA 3EZVA 4EOSA 2IZUA 2Z7RA 3MGYA 4A06A 3AG9A 2R3OA 3HEGA 4PV0A 3VBTA 2BDJA 4OTGA 4KS7A 3BLHA 3FQSA 3L8VA 1XBAA 3P1AA 2W5HA 3A8XA 5HLWA 3AD6A 3MESA 5FDPA 4G3CA 2Y4PA 2J0LA 1ZYSA 4ZTRA 3R0TA 3E62A 3PJ2A 4OTRA 4XG7A 2JC6A 1E1VA 1OIRA 2OJ9A 5G1XA 4IC7A 4JR3A 2XA4A 4AFEA 4HVGA 3DLSA 3EQRA 5AJQA 5AV3A 5I3OA 3FPQA 3N4TA 1H4LA 2QOCA 3OZ6A 3UIBA 2VO7A 2CKEA 2FH9A 3VRZA 3OT3A 2BCJA 3NUPA 4F7LA 1GZ8A 4ZLOA 2JFMA 3L8SA 4RX9A 2BZHB 2G2HA 2J0IA 4FK3A 4L44A 2CN8A 4NEUA 5CALA 4BDFA 1UNLA 2HZIA 3N4VA 4H05A 3DKGA 4TYIA 2WMSA 4I23A 3CGFA 4HVHA 3PY3A 3BE2A 3I7BA 4LUDA 1JVPP 2XEYA 4HYHA 4YHJA 4C62A 4EZ5A 4IMYA 3ZXTA 4DH1A 3DB8A 4F9CA 2HAKA 3ALNA 3OW3A 4ACGA 3QAME 4KBCA 3A99A 3GB2A 3K3JA 3BGZA 4PX6A 5AMNA 2EWAA 1V0PA 1J7UA 3E7OA 4IX5A 4NM3A 5BNJA 3ZZWA 4OTFA 3GU5A 4GJ3A 2NO3A 2F7XE 2E9NA 4L3JA 2QO9A 4FSZA 4MK0A 4GUEA 3DNDA 3JUHA 4PL4A 3TZ8A 3ZLWA 4B8MA 3ATSA 3DXPA 1F5QA 3EKNA 1WVXA 1H08A 4FKVA 3QBNA 2C0OA 2RSVA 2DWBA 2FSMX 2C6IA 2VTJA 4L3LA 3S2PA 3UNJA 4FSMA 4XV3A 4CMOA 4XEYA 4BR3A 4DA5A 4LG4A 5IISA 3ACKA 4WRSA 2EU9A 2GS6A 4F09A 4FK6A 4YHTA 4GCJA 4M7IA 3FMJA 2IN6A 1O6KA 4MQ1A 4U43A 4XLIA 5F95A 5DIAA 3FLYA 2OU7A 3PYYA 3PVWA 2FSOX 2YITA 3HMIA 3A4PA 3UO6A 3D7TB 5HZNA 4X3FA 5FP5A 4RA5A 4RMZA 1ZZLA 4H3QA 1ND4A 3PJ1A 4QTDA 1PKGA 3R2BA 2ITPA 3BWJA 3KQ7A 3LIJA 4AAAA 5I9ZA 2BRBA 3RBWA 4IVAA 2AC3A 4PNIA 1F3MC 5ETCA 3VS2A 1RE8A 1SZMA 4QMPA 5IQGA 2YZLA 3RPOA 3ULIA 4USEA 3MB6A 4WOVA 4ANQA 3E5AA 3NNXA 1ZARA 4QYFA 2PE1A 4K77A 4BDDA 3R1YA 3PZEA 4IZAA 4AZTA 5H8GA 3H9FA 4O81A 2WTIA 4GU6A 1OPJA 2A1AB 2BVAA 2V22A 1L3RE 3AC3A 3EZRA 4FSTA 4G6OA 1R0EA 4ITJA 2OIQA 1WMKA 4K18A 5EDPA 5AP7A 2OIDA 4TZRA 1OKWA 2WO6A 4ALWA 1J7LA 1A9UA 2BAQA 4IVDA 4PL3A 1Q8WA 2BKZA 3ZBFA 3DJ6A 1B38A 2ZJWA 3F3UA 3HLLA 3U4WA 1H28A 5LXMA 2A19B 4WIHA 2I0VA 3S4QA 4I0TA 3UVQA 4XJ0A 2UZLA 4I6FA 4E1ZA 2B9HA 3UIMA 3QQKA 4Q2AA 2OF4A 3BZ3A 4IAFA 4EK5A 3I81A 4EL9A 3KCFA 1W8CA 4DFZE 4LRJA 2BIYA 4MTAA 4EOQA 1VZOA 5AX3A 5BUJA 5M4FA 4DFBA 4XG8A 2VTNA 2QHMA 4IAYA 1JWHA 3E92A 5F1ZA 3ZDUA 2W05A 4JX7A 5C4KA 2XNNA 4HPTE 4RWJA 3TDVA 5AFVA 4TPTA 5BQ0A 3WZJA 4AOTA 1H0VA 3LXLA 4J96A 2OFVA 2PMOX 3REPA 3SRVA 4O7YA 2AYPA 5K0KA 2YIXA 2GQSA 4OUCA 3V5WA 4EOIA 1X8BA 4EQCA 2ZM4A 3U55A 3H0ZA 4FTLA 5EI6A 3UZPA 4B99A 3TJDA 4FEXA 4YC8A 4IFCA 3OHTA 2WHBA 5FXRA 4GG7A 3NYOA 4Y85A 4IB5A 1WFCA 2ITVA 3DK7A 3Q5IA 3KL8A 3KVXA 3QF9A 4LGDA 4MD8E 4XLVA 3EQGA 4QMTA 3Q5ZA 3CY3A 5IQCA 1Q4LA 3QRUA 2WQMA 5KMMA 4K11A 4BDGA 3W2CA 2YIQA 4FT9A 5BVDA 4R1VA 1GZNA 2QR7A 3I0QA 5HO6A 4D2TA 4PTGA 3DA6A 3FZTA 4QQ5A 3IOPA 3WI6A 3V6RA 4XG3A 5HBEA 2E2BA 3EQIA 4LRMA 4ZY5A 3RK7A 3FLWA 4NT4A 4Y5HA 4CYJA 3EN5A 4LGHA 5AEPA 3FHRA 4M12A 3FL4A 3E88A 4J8NA 4DGMA 3P86A 5GNKA 3TNQB 4BDIA 4FIEA 3WZDA 2J5FA 5AP1A 3QRIA 4BTFA 4FMQA 5I3RA 4U97A 3ZONA 4FV4A 5EW3A 2UVYA 3KXGA 5L2TA 2GU8A 3CLYA 2O0UA 5FRIA 4RPVA 2LGCA 2PSQA 4FV5A 2X7FA 4MXXA 3ZXZA 4S32A 4QPSA 4F7SA 3NNUA 3EHAA 4KKEA 5C27A 4E6AA 5GZ8A 3BQCA 4ZY4A 2G01A 3BQRA 4L46A 4YJNA 4AP7A 1UA2A 2HENA 3FDNA 2ZMCA 4IEBA 4O6EA 3Q52A 3D0EA 4M0ZA 4ZTMA 4YZ9A 3MV5A 4MBIA 4JNWA 3ORNA 5FQDC 4E7WA 3OWJA 3FKNA 4G3GA 3BELA 4ALUA 2OXDA 1S9IA 3C4FA 5C9CA 1G3NA 3TTJA 3MTFA 3OUNB 1UKHA 4Q9ZA 3HAVA 2ZV8A 2O2UA 1JAMA 5DWRA 4CEGA 1YW2A 4C4IA 5CF8A 5M53A 3Q2MA 5DI1A 5HG9A 4A7CA 4QQJA 4UEUA 5AM6A 1UU7A 2F7EE 3E7VA 4IB3A 3M2WA 4MF0A 3QU0A 4NIFA 4PPBA 4TKSA 2W17A 3MH1A 4IACA 1TVOA 4R5SA 3UYTA 4KBKA 1Q8UA 3W8QA 3U8WA 4FSNA 1R3CA 3ORPA 3RNIA 1WBVA 4OR5A 4DEBA 1YKRA 4G17A 2P33A 4S31A 4J99A 2OO8X 3LJ2A 3FZOA 2VTQA 4F63A 3I4BA 1XO2B 3DBQA 3ANQA 5AIRA 3ZFYA 4O7ZA 1FVTA 3UNZA 2J0JA 2O63A 4HGLA 5ETFA 4C4HA 3G2FA 5AP4A 3IONA 4F1OA 4PNKA 2B53A 3RHKA 4FEVA 3ZUTA 1YOLA 4GKHA 3AXWA 2P0CA 4ZZOA 3OP5A 1CM8A 3HNGA 5DE2A 3QQLA 4YLKA 3TT0A 4ZZNA 2W06A 2WEIA 4XMOA 3ZC6A 3HECA 3LJ0A 2PVFA 4II5A 3S00A 4GYIA 5A4CA 4X7QA 4FI1A 1IR3A 2XKCA 4O0SA 3L8PA 3P7BA 3D5VA 5CF5A 4BCFA 3QL8A 4CCBA 2HW6A 1SVEA 2VWIA 3EOCA 3BHTA 4AA4A 2A0CX 3HMNA 4JX3A 4FTAA 1PW2A 4JJRA 4N4SA 4W4YA 4W9XA 5E8YA 2ACXA 2O64A 3O71A 2H34A 4I1ZA 3VBVA 5C1QB 3FAAA 3JVSA 2ERZE 2YN8A 4ACHA 4YJSA 4G6LA 5ANGA 4D2VA 4GU9A 3VBXA 4WNMA 3VULA 4KS8A 1YXVA 4G5PA 5IA1A 2PUUA 3W2SA 4LL5A 1ZYCA 3DFCB 1IAHA 2HELA 4ZOGA 3T9TA 2GNJA 3U51A 4DBNA 1FGIA 2BILB 3RI1A 1B6CB 3PA4A 4MCVA 3PJ8A 3VUDA 3PTGA 4BCNA 5JFXA 1XH6A 4L42A 4XV1A 2JIIA 1ZAOA 2Y8OA 3CXWA 3GCQA 3NCZA 3ZMMA 4DF3A 4NFMA 3DDPA 5KMOA 3PRIA 3VNTA 5AA8A 3TV7A 2BZIB 3E8EA 4FT0A 3PJCA 4MEDA 2XBAA 2VWZA 4DH5A 3BYVA 1Y57A 4WG5A 2OFUA 2XMYA 4WKQA 1OIQA 2JDOA 4FVRA 5E91A 3NX8A 5FD2A 5HESA 2WQEA 4BGQA 3QUDA 3C50A 2CPKE 3NYNA 4FYNA 4JBVA 4L3PA 2F4JA 4L7SA 5IQFA 3HAMA 4PMPA 3TUBA 4IJPA 2VTLA 4EBWA 2J0KA 4GFGA 5EQPA 2VGPA 4FTJA 3NAYA 3F5GA 4IX6A 3PZHA 2IO6A 4BWKA 5JQ5A 2NPQA 4OTQA 2OGVA 3HKOA 4GJ2A 2B9JA 2WTWA 4JQEA 4QOXA 3I6UA 5K4IA 5DPVA 3KREA 2YLFA 4FNZA 4UWBA 2FB8A 3SLSA 4DTKA 3Q4ZA 3FHIA 3GP0A 5LJJA 1BYGA 4E4XA 3A8WA 1FINA 4GIHA 4ZJVA 4NZWB 4E26A 4MKCA 4ZLZA 4QRCA 1H1PA 3MJ2A 4BTKA 2W5BA 4NK9A 4G9CA 4AGUA 4KD1A 3B2TA 3C7QA 2UW6A 1QPEA 3F7WA 3NCGA 5EHOA 4NH1A 4CFXA 3R2YA 3NUSA 4EK8A 5C8KA 4Y5QA 3GOPA 2VU3A 4CTCA 2PZYA 3ANRA 2A27A 1UV5A 2JDRA 4J53A 3P78A 3TNPC 1YDRE 2WOTA 5KHWA 2C30A 4JG8A 2VTTA 4UXLA 4O27B 3HDMA 3R01A 4UXQA 5FDXA 4MNFA 1LEZA 4AACA 3L9NA 4XBUA 3LJ1A 3LAUA 5AR8A 1MRYA 3MDYA 3RM7A 4A4OA 3H9RA 5L4QA 3KULA 4BCMA 1TKIA 2EXCX 1OPLA 3TNHA 3LCSA 2R3FA 4LOOA 3RGFA 5EK7A 4IXPA 4I4EA 4O86A 3H10A 4AS0A 4AW0A 2C3LA 2GNIA 3IDPA 5JZNA 3F69A 3LFFA 4XHKB 3TDWA 4EH6A 3TIZA 1W83A 3COHA 3UG1A 4HPUE 3C0IA 1DAWA 4KIOA 3WOWA 3ZYAA 4BHZA 5JN2A 5LWMA 4ZMFA 5CYIA 4C58A 3FZSA 2WB8A 2O8YA 1YI4A 4FTTA 5HHWA 5HTCA 1OI9A 3P08A 4DBXA 4YTIA 4C02A 4MXZA 3VS3A 2C6DA 4FVQA 3LFEA 5DRDA 5HLPA 1AD5A 2BZKB 4QTAA 4UMUA 4U6RA 4CFFA 4O84A 1OVEA 2PZRA 2W9ZB 3HZTA 3F3TA 2X2MA 1VYZA 4NL0A 1PMUA 2XYNA 3H3CA 4UMTA 3DKFA 1WBTA 4RBLA 4LOQA 4E8AA 4EQUA 5DVRA 3KXHA 4YJOA 4ARKA 5KHXA 2C0TA 3FZPA 1H00A 1OUYA 3PFQA 4BDEA 4RIYB 5E1SA 4U81A 5EG3A 4EH3A 3LQ8A 4QMZA 4RZWA 5M4CA 5IQHA 5FM2A 3RALA 3F66A 4RX5A 3RCDA 3EWHA 4QO9A 3FMMA 3WF7A 4Z9LA 1JKSA 3I1AA 3LXKA 4ZZMA 1I44A 3KRRA 4RZVA 3PXZA 4FUXA 3DAKA 5AUWA 3SGCA 3Q9WA 3PRFA 4UWCA 4X3JA 4B8LA 4DHFA 3TNIA 4YO6A 4GVJA 2V7AA 4J8MA 2J2IB 5AR7A 5J95A 3RMFA 5DT3A 3VWAA 3UNKA 1DS5A 3VIDA 4FSUA 1EH4A 4KKHA 5F4NA 5JRSA 4RJ5A 3KN5A 3RCJA 4W4XA 4FTMA 4TTHB 5CF4A 5JGAA 4XV2A 1U59A 2GDOA 2Y4IB 1YQJA 3T3VA 2XF0A 3NW7A 4PTCA 5IDPA 4JDIA 5HVKA 5CASA 1MUOA 4QMSA 4DN5A 3M11A 4D2SA 5FTGA 4CTBA 3OROA 5T68A 3EIDA 3R8ZA 4BIBA 2GPHA 2WGJA 5ICPA 2GFSA 4C4GA 3FMDA 1SVGA 4XRLA 5DT4A 2C3IB 4K2RA 2G1TA 1MQBA 2HCKA 2W1DA 1OL6A 2YEXA 2PMNX 4F6WA 2BDWA 4HCUA 4OBQA 3WZUA 2IG7A 4H3PA 3CPCA 4EOKA 2W4JA 4JQ7A 5E92A 5K5NA 3F3VA 4FG8A 4QMYA 4YTCA 4CGAA 2VTSA 2YAAA 2GHLA 4D4SA 4OAUC 1OB3A 2FSTX 1UNHA 4RJ4A 4U5JA 4IAKA 2FSLX 4LRKA 2VRXA 4L6QA 4M66A 2XNOA 3ZU7A 2JD5A 3DDQA 3TKIA 2BDFA 3HV4A 3JVRA 4FKQA 3BEGA 5FGKA 4BZNA 2H8HA 3V5JA 5HE0A 4BDAA 5CEOA 2CJMA 4PPAA 4OT5A 4FE2A 2UZNA 3LE6A 4PDSA 5AUTA 5FP6A 3ORMA 4CVAA 3A7HA 4C33A 4IAAA 3DNEA 3VS1A 2PUIA 1FGKA 4TNDA 4M8TA 3VW6A 4O91A 3N9XA 3UQGA 4P5ZA 2WQNA 1ZRZA 4WHZA 4BDHA 2I0HA 3I0OA 5AV0A 2W96B 2YWVA 3R1QA 4FV2A 3V6SA 4GT5A 4C38A 2QLQA 1PRYA 4YJRA 1WBPA 1TQMA 4KAOA 5CY3A 4O0XA 4C3RA 4RIWA 4F0IA 3I5ZA 2GQGA 4AE9A 4C8BA 3FLZA 4JDKA 5CT0A 1YXSA 4O7RA 4FUYA 4RJ3A 1Q3DA 3RAWA 3FZRA 3QTSA 5A4EA 3PXQA 3QZGA 4XCUA 1OL7A 3GVUA 4DEAA 3V04A 3VS6A 5M56A 3TV6A 2PVLA 3MY0A 4IDTA 3E3BX 4YTHA 5EH0A 3IW4A 2WMWA 3L9LA 4FSRA 4RIXB 3KVWA 2BTRA 4IM2A 4TWOA 5L8JA 4JQ8A 1YDSE 2PUPA 4RVMA 4RVTA 4G1WA 3FSFA 4ZK5A 4EUUA 2B54A 3MFUA 3PSDA 4EWQA 3UPXA 1OL1A 3QHWA 4EH5A 3VUGA 5M51A 2P3GX 1WBOA 3U6HA 3ZO2A 4TW9A 1WBNA 3TKHA 2UV2A 2Y0AA 3DZQA 4P5QA 4I6QA 1PMNA 3OXTA 5HU9A 2Z7SA 1ZOGA 4PF4A 3LXNA 1W7HA 1JNKA 2OLCA 2VX0A 5HE1A 5D41A 4LV8A 5CS6A 3ZC5A 5DFPA 2XUUA 3RWQA 5LCKA 3BBTB 3QZHA 4JG6A 3A61A 3OWLA 3FXXA 4FT7A 5EI8A 4YZMA 3KU2A 1JPAA 2XRWA 4NJ3A 4FG7A 4GUBA 4HZRA 2XH5A 5H2UA 4D0XA 2OXXA 2ZOQA 4FKGA 4R1YA 3UDBA 4YLJA 3RNYA 4FSQA 1LP4A 5B2KA 2UZUE 5KCVA 4G3DA 5B0XA 5LQFA 5AV1A 4XG2A 5IUIA 1JSTA 4EH7A 3LHJA 4OBOA 4MBJA 4DAWA 2C1BA 3F5PA 3B8QA 4I92A 4APPA 4IDVA 1KV1A 1Q8ZA 1IASA 4O7VA 3DU8A 2UUEA 5FEEA 4BIDA 4L68A 3ZEWA 4FA2A 3JS2A 4D4RA 4HYUA 3DKOA 3QRKA 5EQEA 4I6HA 4X0MA 4G34A 1DI8A 2AUHA 4ZTSA 4O83A 1CKIA 4FKRA 4X2JA 2F2CB 5AAEA 5BVKA 3NUUA 4JIKA 4TN6A 3RPVA 3TV4A 4RWIA 4E6DA 4MD7E 2XCKA 4GIIA 4E4LA 1ZOHA 2GSFA 3LFBA 4HCVA 4TNBA 3MYGA 4YJTA 5JFSA 4MBLA 3THBA 2GTMA 4CV9A 4QQTA 3AC8A 2QVSE 4RX7A 3WILA 4ZSLA 3NR9A 2JITA 5LWNA 2HIWA 1CMKE 4CG9A 3UZRA 3WYXA 4YP8A 5IA2A 5IQIA 3QUEA 2R3HA 5CAPA 3F9NA 2W1FA 1OM1A 5CEQA 2WTVA 2J4ZA 4RVLA 1JOWB 3WIGA 3ZEPA 2XIKA 5GIOE 2X4FA 1A06A 3DXNA 5E7RA 4YBKA 4DLJA 5ANOA 5FUTA 4LL0A 5HO7A 4IHPA 4FZFB 4R8QA 4A07A 3FE3A 4O1OA 4EOPA 5AM7A 4Z7HA 5DEWA 2UW0A 5IEYA 4I22A 2YAKA 3QWJA 4I5MA 2YCSA 2ZV7A 3MB7A 1PYEA 4EH8A 3AMBA 3EFWA 4NTTA 3UOLA 5HBHA 4I5CA 5E8ZA 4JR7A 5AUVA 2XEZA 3HV7A 4RJ6A 5IH6A 1ZLTA 3GU4A 3RM6A 3V5LA 1B39A 2BALA 5CU6A 1VJYA 1FBNA 4HJOA 5CTPA 4XG4A 3WARA 3IECA 4B4LA 2JAMA 3HDNA 4WUNA 2RIOA 4FTRA 4AZEA 2WFYA 4NW5A 4MXAA 4KWPA 5HNGA 3MJ1A 2J50A 3BV3A 4YSMA 4WA9A 3PE2A 3PUPA 3LW0A 4CMUA 5AUUA 3F2NA 1ZYJA 2ITUA 4MX9A 5EKNA 1Z57A 3SAYA 5F9EA 2QC6A 2Y6MA 3MI9A 1TQIA 2V62A 3OCTA 3O7LD 4CLIA 5AADA 3VJOA 4FOBA 3R30A 3IQ7A 3FWQA 4WBBB 4EJ7A 3IW8A 5AP3A 3OCGA 1ZY4A 3GC0A 4RLKA 1JSVA 3DAEA 4P2KA 4X2NA 4PQNA 2OH0E 2W9FB 2QR8A 3KN6A 3QQGA 4DLIA 4UN0C 2J5EA 4QD6A 5HTBA 4FTUA 4M97A 4XP2A 4IC8A 2BR1A 2CHLA 4RC2A 3ZFXA 2VTOA 1Q99A 2V5QA 2XNBA 2RGPA 4NUSA 3R8MA 3ZLYA 3LVPA 2VAGA 4E5AX 3R1NA 3R83A 3ZCLA 1U4DA 2W1HA 3Q04A 2G9XA 3E87A 2JIVA 4DC2A 2XRUA 3L1SA 3ODZX 3D7TA 1M14A 5LVPA 2XKFA 4M67A 1YHSA 3DPKA 1Q5KA 2PVJA 3ZM4A 5K0XA 3G15A 3ZBXA 4LFIA 4BYJA 5ANDA 4E73A 5JEBA 1G8SA 5M4UA 3RKBA 4Y95A 2R3QA 1JSUA 1LEWA 4G3FA 4ZJIA 2ZB1A 3AGLA 5I9WA 5ITAA 3U6JA 2PY3A 1ZYDA 2BAKA 2QOOA 3HX4A 1I09A 3R7EA 4Y73A 3GOKA 4RT7A 3FV8A 3TWJA 5D12A 3FXWA 4KIPA 4K33A 2P55A 3KRJA 3A2CA 4PDPA 4O38A 3GFEA 1PMEA 2JAVA 3RZFA 3MTLA 3PY1A 4IX4A 3KRXA 3RWPA 5IDNA 2Y4IC 4AA5A 4O22A 4UB7A 4RJ8A 5CI7A 2VUWA 2PVMA 3HRBA 2CGUA 4AZWA 2WMBA 2B52A 4BDBA 5I5ZA 4DH3A 2VZ6A 3ACJA 2Z7LA 3HA6A 3CQUA 5BX0A 4ALVA 1DM2A 3R6XA 4O0TA 5AAGA 5E4HA 3IDBA 3KC3A 5CU2A 1T46A 2QNJA 1OPKA 3VUMA 1ZMVA 4Q5EA 4F1MA 2PPQA 2YABA 1YXUA 4QMVA 5JRQA 1PXOA 4YGAA 4PMTA 3QQUA 4FTQA 4HYSA 4B0GA 3LM5A 2PYWA 2WEVA 4FKIA 3PXFA 4IAZA 3R9OA 3UC3A 3WE4A 2E9UA 3HGKA 1Q41A 5LVLA 1K3AA 5CI6A 3ZO4A 4O7SA 4BKZA 3OBJA 5B2LA 3NGAA 4CV8A 4V0GB 1Q62A 2GNLA 3A7JA 3PA3A 3R9DA 2YIYA 3V8TA 4ZY6A 4PL5A 4ZSEA 4DGNA 4QMMA 3VC4A 2H96A 2UW3A 1JBPE 3KMUA 3F61A 2W0JA 5J5SA 3IGGA 4IB1A 3QZIA 3UOJA 2BAJA 3AQVA 3LZBA 2R3JA 1OGUA 1STCE 3BHVA 5H8EA 4PDYA 3C4CA 1XWSA 5CXHA 4HGTA 4CFUA 1O9UA 2CKOA 2I40A 2BRHA 3FQEA 2BHEA 3SG8A 3MPMA 3KF7A 4XG9A 4QQCA 4YJPA 3QA0A 4BGHA 4YHFA 5I9YA 3ZSGA 4G3EA 3G90X 1W0XC 4RG0A 3RK9A 4W9WA 3KMWA 3FMNA 5ANJA 5HO8A 4E20A 5CNOA 3PWDA 4P4CA 3DJ7A 4ZLYA 2FYSA 2IZTA 4CLJA 3U6IA 4QP9A 3V3VA 3NUYA 4KABA 3P7CA 4L9IA 4NU1A 3I7CA 2X6DA 1J7IA 2Q83A 2GMXA 2JDSA 4KUJA 4XG6A 3FLSA 2GS7A 5CANA 2WQOA 5HIDA 2CGXA 4IFGA 3TN8A 4MF1A 4BF2A 4R7IA 5IQDA 5EW8A 4Z7GA 3UP7A 4EKLA 3IGOA 3PLAE 3WYYA 2VD5A 3CQWA 4L01A 3BIZA 4QP1A 2B7AA 2XZSA 3AC4A 4RRVA 3EYHA 4FZ6A 3CPBA 4JG7A 4F4PA 2J0MB 2WTCA 2V0DA 3A62A 5EYMA 4ENXA 4PMSA 3NIZA 3DKCA 2DUVA 5EM5A 3EL8A 1WVYA 5E8TA 5A4TA 4XS2A 3R04A 1M52A 3MVHA 3NWWA 4FNYA 4IH8A 4ERWA 2IPXA 2WTJA 1M7QA 4U80A 5DNRA 4UX9A 4RFMA 4EOJA 4MH7A 3JY9A 2XJ2A 5AR2A 4BCHA 3W2QA 3ZZEA 4E5WA 5EYKA 1BL6A 4IM3A 4AXAA 2QURA 4DCEA 3KMMA 4RQKA 4JAIA 2W1CA 4RFYA 3UGCA 3KRLA 3DB6A 1VR2A 4BVUA 1BMKA 3R7UA 4BHNA 4MYGA 1T45A 3KEXA 4G2FA 2WU6A 4FTIA 3TUCA 3R7VA 1WCCA 2F7ZE 3RK5A 4BDCA 4O2ZA 3QCQA 3MVJA 4YZNA 3SX9A 5CAVA 2YISA 4YTFA 4KIQA 3VVHA 1Y91A 2CNUA 4K1BA 4QTEA 3PJ3A 2XYUA 2JKOA 3OCSA 4C36A 2PHKA 2WQBA 4EK3A 3FBVA 2XK3A 5LARA 3E64A 4HVSA 5IA5A 1NY3A 2X9FA 3W55A 3E8DA 3L9MA 4R3RA 3C5IA 4CZTA 3UIXA 3AC5A 4BKJA 1J91A 4FKWA 2VTHA 5KBQA 4IJ9A 1RDQE 1UU8A 2WNTA 3BCEA 4OTIA 5L2QA 3DBCA 3QRTA 4PP9A 3HVCA 3R9RA 4F0GA 5AP5A 3WF9A 5H8BA 5DBXA 2I1MA 4O0WA 4I20A 3KKVA 5CVFA 1SYKA 2ETMA 5CSWA 5GJDA 2X9EA 2PULA 1W98A 4RC4A 3TTIA 3VJNA 3KA0A 4IVBA 2RFSA 3MPAA 3GQLA 3RHXA 3CJGA 2PMLX 4QMOA 4AA0A 1AGWA 3IW7A 3LFQA 4NWMA 5HG5A 4YO4A 3A7IA 4FOCA 3R73A 4X2KA 5JH6A 3UO5A 3NIEA 4Z55A 3Q6UA 5FBNC 3F5XA 4UMRA 1LR4A 1H1RA 4G6NA 5EI2A 3VQUA 4ENYA 5KMLA 5CAQA 2O5KA 3BI6A 4WNKA 4DEHA 3TM0A 2CSNA 5BVFA 5GIPE 4BCIA 4I93A 4EI4A 5KNJA 5IG1A 2QOIA 1SM2A 4BI1A 4YMJA 3PVUA 4WNPA 3BRBA 1PF8A 2O3PA 1KE6A 2X1NA 4PP7A 2VNYA 1PJKA 1REJA 3ROYA 2R3RA 4A4XA 3EKKA 4H1JA 4OTWA 4ZTQA 4BCPA 1FVVA 5CSXA 4CG8A 3LFDA 5ANKA 3BX5A 2VWVA 2WMXA 3MY1A 5H3QA 1DAYA 2FVDA 2VWYA 4GK3A 3W33A 2R0UA 3TZ7A 3QTIA 5J7BA 4RSSA 4BZDA 4DG3E 3N4UA 4LYNA 2WZJA 4EK4A 5IUHA 2PE2A 5FG8A 4FEWA 3ODYX 2C6EA 3QGYA 3MIAA 4U42A 2PU8A 3E3PA 3U9CA 1KV2A 2IWIA 3Q32A 4M0YA 4D9UA 2BFXA 3RP9A 5DHJA 1ZMUA 2ZV9A 1H07A 4G16A 2J6MA 3JXWA 5AUYA 4P7EA 5DLSA 2GQRA 2OJIA 2JKKA 3BWFA 2W5AA 4GH2A 4CFVA 5HNIX 1G8AA 2QOLA 2VX3A 3P5KA 4NCTC 3POZA 2YACA 5EYCA 3O8PA 3BLRA 4QTBA 5F20A 5AX9A 3VQHA 4FKUA 4IX3A 2R0IA 4MXYA 2XNEA 4TRLA 1H24A 3LQ3A 1IEPA 4F7JA 4FV1A 4B6LA 3QKKA 3QA8A 5AV4A 5DYJA 4FIHA 3AC2A 4FR4A 4ERKA 2W7XA 3FMHA 3B2WA 2QKRA 4P90A 2UW7A 3COMA 3ET7A 4BCOA 4AW1A 4EC8A 5DA3A 3SW4A 4A9SA 4FZ7A 5IEXA 3VHKA 3A7GA 2FUMA 4NKSA 3QTUA 3EB0A 4YC3A 4AN9A 3Q9YA 4FV3A 3DK6A 2BIKB 2XB7A 4RWLA 4XV9A 3ZRKA 1H1WA 3BHYA 2WMRA 5IPJA 4GEOA 3K5UA 1BI7A 2CGWA 3OVVA 4GYGA 3BYSA 4IAIA 3VBWA 4BGGA 4GV1A 3WZEA 5GZ9A 4U9AA 2PWLA 3EN6A 4FEQA 4F65A 4H39A 4IADA 5EM6A 3W2RA 4C4EA 4LMNA 1URCA 4W4WA 3R9NA 3SD0A 5ANIA 3W32A 2W4KA 3WBLA 3ALOA 4LQMA 3QD2B 4JBOA 4NW6A 4CFWA 3HUBA 4DFYA 5HU3A 3BKBA 4YR8A 3LFNA 2X7OA 3FC2A 2HYYA 5CLPA 5FEDA 4U44A 4IANA 4F99A 5GJGA 3P79A 3QCXA 4O96A 2XK4A 5CVGA 4AQCA 1PXNA 3MFRA 5J1VA 5CNNA 1Q8YA 3BYUA 3UBDA 3NPCA 3Q9XA 5DRBA 3LCKA 1UU3A 2GNFA 3CBLA 3QXOA 5IA4A 4KINA 3CSVA 4JXFA 5CSVA 3FI2A 2UZWE 4RIYA 3GQIA 4NSTA 3TEIA 5A3XA 2HWPA 3F82A 4BTMA 3WZKA 2YM8A 4BCKA 4BCGA 1XH5A 4EEVA 1YWVA 2X7GA 2QU5A 1U54B 5TO8A 2R64A 3C13A 4JL9A 3A60A 3QZFA 2YFXA 1YDTE 3SA0A 5D9HA 3FLQA 3ZSHA 3P0MA 3QX2A 4BCJA 5TKDA 3W8LA 1K2PA 1PY5A 3PE1A 4PRJA 5JMSA 4CCUA 5HTIA 5DT0A 4BBEA 5IQEA 4BWPA 3C4XA 2J90A 4DCAA 3QC4A 5EOLA 3UIUA 2ZM1A 4JRNA 3SKCA 1UU9A 3F2RA 3Q4CA 2OKRA 3F88A 4Y72A 4ASEA 2IVTA 5CU3A 3AD4A 4F9WA 2P2IA 3V5TA 2UZTA 2XKEA 3DBDA 3KXXA 5FXQA 4BRXA 3LXPA 5G6VA 3TNWA 4S30A 3V01A 2R9SA 1WZYA 2YJSA 4JS8A 1Q3WA 3VAPA 4CMTA 5DN3A 4WD5A 4NM7A 2GTNA 3VS7A 3FZ1A 4CZYB 4CSVA 5CAOA 2WKMA 3V51A 4GFOA 2CKPA 3LMHA 2XIYA 1NA7A 1PKDA 3PG1A 2HY0A 3HP2A 3ZFMA 5C8MA 5HVYA 3FPMA 1O6YA 5BYZA 3C4ZA 2R3NA 3NEWA 4HYIA 1KE8A 3D5WA 2BZJA 3FYKX 4M13A 2DS1A 4FTOA 3AC1A 5HCYA 2W99B 3EJ1A 4MWHA 4QPMA 5BVNA 4CQEA 4FKLA 5CT7A 4AWIA 4QMQA 4ZTNA 3R7YA 5LVOA 1OIYA 2WMAA 4FBXA 4BIEA 3ITZA 2YDIA 4V01A 2JKMA 5E8SA 4FV8A 3OOGA 1Y8YA 1XH4A 1YHWA 3G6HA 5CQUA 1ATPE 4IWOA 5IH5A 2GNHA 5D1JA 2X2KA 4U40A 4M68A 3Q2JA 2PZPA 2YHVA 3C4EA 3DJ5A 1UNGA 4J98A 2R3GA 3RAKA 3AGMA 1YVJA 2YM7A 4BKYA 2RF9A 4IB0A 2NRUA 3RJCA 4X6QC 4H36A 5AUZA 1OL2A 2AC5A 1Y6AA 2JDVA 2OZAB 3RZBA 3ZUVA 3UG2A 3PXYA 4MXCA 3W18A 3O17A 4NM5A 3G0FA 3F5UA 5I9XA 4PUZA 3FL5A 3I79A 4M84A 1M2QA 2R4BA 2OBJA 4YUQA 2ERKA 2OJJA 3UE4A 3SXFA 2XIZA 3DT1A 3DQXA 1U5RA 5HCXA 4AE6A 4AW2A 1MP8A 2PE0A 4USFA 4DEIA 3GU8A 5J1WA 2QOBA 1PXLA 4TXCA 3HP5A 3PVBA 3DTCA 3V8WA 5CAUA 3PPZA 4YPSA 3DLZA 4RIXA 2R3PA 3N51A 5E8XA 1XJDA 2HZNA 2XNGA 3E93A 5GINE 2X8EA 3K2LA 4MVFA 3QQFA 5HX8A 2QQ7A 3BYMA 2ITTA 4DFLA 2I6LA 4QTCA 5CEPA 3CS9A 5I4NA 4AGCA 5CZIA 4I41A 3MA6A 1URWA 4BB4A 2QOKA 1GIHA 4MXOA 4BC6A 5CEMA 4O1PA 2O65A 1PXJA 1H8FA 2ITQA 4L45A 3K5VA 4PY1A 2Z2WA 4Z3VA 4LOPA 2VN9A 1Q8TA 3NUAA 1Q61A 4L8MA 3GC9A 4DYMA 2ZVAA 3R8LA 3C4WA 5FM3A 2CDZA 1KUTA 4UMPA 5J9ZA 3R8VA 3FY0A 2ZAZA 3IO7A 5C03A 2VO0A 2QOFA 4KIKB 1XH7A 4M14A 4PTEA 4I0SA 5DEYA 3TJCA 4E5BA 2B0QA 4QYGA 1NVSA 3Q6WA 2JKQA 1FVRA 3NS9A 3RVGA 3OWPA 4BCQA 1KOAA 4FIJA 3GC7A 5J9YA 1YWRA 3E63A 1GAGA 4RX8A 4TT7A 4C4FA 3RAIA 2C6TA 3WF6A 4NJDA 3OFMA 3SHEA 1LPUA 4OT6A 3R71A 3NZ0A 1FOTA 4I0RA 5D10A 4J95A 5C4LA 3LFSA 3VF8A 4QP4A 4D2WA 1YI3A 3FYJX 4TYHB 3FMLA 4D1ZA 4EHEA 3HYHA 2QONA 3KF4A 1SNXA 5KMJA 2BKKA 4YJUA 2BROA 2HK5A 2QHNA 1YXXA 5HE2A 3RPYA 2F57A 2ZDUA 4PPCA 3GCUA 4A9TA 3E8CA 5CENA 4GT3A 5BVEA 3IDCA 2CNVA 3SOAA 1PXIA 2C68A 3NDMA 3MH2A 5KZ0A 2YIRA 4EC9A 2ZDTA 3BLQA 2QODA 4O0YA 4UALA 4FZDB 4ZJJA 3JY0A 2I7QA 1Q97A 2QG5A 2UZEA 5HG7A 4RA4A 4MNEB 1QPDA 5FWKK 2BUJA 2HY81 4CFNA 3FMEA 5CU0A 1GY3A 2VX1A 4GSBA 3BE9A 4ACCA 2XK6A 4PMMA 3UTOA 2FA2A 5IEVA 4RGJA 1GZKA 4TWPA 3W2PA 1ZMWA 4NM0A 4IIRA 5BMSA 5KBRA 5F94A 3SV0A 4I4FA 3W2OA 5AWMA 5HE3A 4D55A 2UZDA 3ZS5A 4AX8A 5CF6A 4HZSA 4UV0A 3PP0A 4YNOA 5BPYA 2WELA 3HMPA 5E8UA 4C2VA 2YCRA 4FT5A 3QD3A 5JKGA 2IZSA 4LV5A 3ZDIA 2WTKC 3BEAA 1MRVA 4N6YA 1IA8A 5DOSA 4ANSA 4FF8A 4TYGA 3GENA 2IZRA 4EORA 1V0OA 3UZTA 5L3AA 3CP9A 4ZXTA 1XBCA 3FXZA 3BPRA 3VRYA 3D7ZA 3H0YA 1QPCA 3OEFX 5ETIA 1MRUA 3PG3A 4ASZA 3F2AA 4AGWA 5A9UA 3UMXA 4YZCA 2JEDA 2VV9A 5HI2A 4C59A 3CKWA 5K9IA 5C01A 3T9IA 3VBYA 4O21A 4E6CA 3NAXA 3ZHPC 1OMWA 2UW4A 4ITIA 4DH8A 2VWWA 2YM6A 3EH9A 4N0SA 4K0YA 2VO6A 2C47A 3DBFA 3QTQA 3CJFA 3I5NA 4G31A 4R6VA 1OUKA 4ZSGA 5AAFA 3U87A 3Q60A 3LMIA 4GL9A 2HZ0A 2PUNA 4OBPA 1ZOEA 2JIUA 3BBWA 3QD4A 1KE7A 5DR2A 2W1ZA 3UO4A 3UOKA 3G9LX 2OJFE 2P4IA 4XNEA 2ONLC 2XM9A 4DG0E 5A6OA 1JKLA 3FKOA 1XQZA 4J97A 1M2PA 3VF9A 4FTKA 3KK8A 4GFMA 3R02A 4ANLA 4I5PA 2CNQA 4R5YA 2C3JA 4AN3A 3JR1A 4NCTA 4U0IA 2FGIA 2V55A 3QLGA 1BI8A 4CFMA 3G33A 4AT3A 4F6UA 3QYZA 3VHEA 4F9BA 5LVNA 1YHVA 5JGDA 2XM8A 3DTWA 1BL7A 3O51A 5AP0A 4QP8A 3SC1A 2QI8A 3ZH8A 3COKA 3EQHA 3BGPA 3Q4TA 3UPZA 4U8ZA 5FXSA 3CR0A 4A4LA 5TR6A 2PZIA 3KGAA 5BVOA 3NVMB 1GIIA 3R7GA 3CE3A 5T6KA 3A7FA 2YWPA 1CDKA 2R3LA 2CN5A 4JOAA 4BYIA 4JBQA 4QP2A 4OTDA 3FI4A 3BU6A 3K54A 4QNYA 5HICA 3DK3A 1PXMA 3HUCA 4M69B 3QFVA 3R21A 2CCIA 2I0YA 2QLUA 2YIWA 2QG7A 4DE4A 2JFLA 1NXKA 3V5QA 3DS6A 4BBMA 2RFEA 4JT3A 4F1TA 5B2MA 4O7WA 4R3CA 3ETAA 4J71A 2XVDA 4R78A 4LUEA 4EBVA 2H6DA 1U5QA 4N70A 2CLXA 4J52A 4MD9E 2PTKA 2PVRA 3C1XA 2G15A 2VWBA 3O0GA 4EH9A 4HVDA 2WMTA 4DTAA 3WF8A 2HZ4A 2WMQA 5LMKC 2UW8A 1ZXEA 3H9OA 1H27A 1IA9A 2QD9A 5J7HA 5HLNA 4I6BA 5DH3A 2E9OA 4C35A 5JSMA 2VTPA 3PIYA 2EUFB 4UMQA 1SVHA 4ANMA 1V0BA 3CKXA 1HCLA 4YZDA 2YA9A 4RIOA 3H30A 4D1XA 4XRJA 2A2AA 3TI1A 4UBAA 1VEBA 4L00A 5J8IA 4G5JA 4V0GA 5HVJA 2ETKA 3D14A 4W8DA 4ZTLA 4XX9A 4ONAA 5IF1A 3JYAA 3P7AA 3QKLA 5FTQA 4QYEA 4NTSA 2C5OA 4ZEGA 4ID7A 4EHGA 4YBJA 3FUPA 3CCNA 1NT2A 1ERKA 3PSCA 3FMKA 4NFNA 1S9JA 2OJGA 4AF3A 2WXVA 5KUPA 3D5XA 5IA3A 3VUKA 4KRDA 4YNEA 1F0QA 4DH7A 2EB3A 4ZTHA 2ESMA 4FV0A 4L67A 3EFLA 4RC3A 4AT4A 4FVPA 3OW4A 4QYYA 2C1AA 5EKOA 3D83A 4F9AA 4C0TA 2SRCA 3O8UA 5JZJA 3M1SA 3GI3A 5AIKA 4E4NA 2XP2A 3KK9A 3LMGA 2YM4A 4EH4A 3UMWA 1J3HA 5CU4A 4FV9A 3BGQA 3W10A 3QQHA 1WAKA 5IZFA 1WVWA 3KRWA 3OY3A 4R3PA 4U3YA 2QO2A 3PWYA 4WT6A 2KTYA 3T8OA 1A48A 4IWPA 3IS5A 4O0UA 5EOBA 3GFWA 1XH9A 4BFMA 3I60A 3CIKA 3ULZA 5KMIA 4WO5A 4DT8A 2OG8A 4U45A 1R78A 5L2SA 1HOWA 3HA8A 3G51A 1IAJA 3QUPA 3SXRA 3POOA 3A4OX 3AMAA 4X3FB 3UVPA 3R22A 2JBPA 5ACKA 5T3QA 4IWDA 4S34A 3EYGA 3FEGA 3ZO1A 2UVZA 4QMUA 4FYOA 4YC6A 4KRCA 1Z9XA 5EM7A 3ZUUA 3R00A 3FI8A 5KE0A 2W1IA 2OZOA 1U46A 4KA3A 4X21A 3Q9ZA 3S0OA 4Z16A 4BWXA 4FODA 4QP6A 4FKJA 4DGOA 5C8NA 3CTHA 4MWIA 5HORA 3NMUF 1MQ4A 4XP3A 1KE5A 1QMZA 4YJQA 4HVIA 2NRYA 1R0PA 4JRVA 1GNGA 4GT4A 4DGGA 4F08A 1V1KA 1YWNA 4BI2A 5IQBA 4R7BA 3QTZA 1DI9A 3GGFA 1M7NA 5B7VA 5JQ8A 5DR6A 1GJOA 3DZOA 2BPMA 2PVKA 2XIXA 4D58A 2HW7A 2C5YA 3OUKA 2YCFA 2QOQA 5DGZA 5IQAA 2GHMA 4DEEA 3QCSA 4D9TA 2IW6A 5EHYA 2Q0NA 2WMVA 2IVSA 3DOGA 5JK3A 3WF5A 3UOHA 4FL2A 5BUIA 4ASXA 3LOKA 1OL5A 2ZYBA 3G0EA 5L2WA 3LFAA 4JVGA 4B7TA 4EZ7A 5A4QA 1JKTA 5J79A 5EFQA 5M08A 3EQFA 3D94A 2HXLA 3ZRLA 4EZ3A 3S1HA 2XK7A 3EN9A 3UC4A 3GCSA 2ZB0A 2WIHA 2GNGA 2OXYA 3ZSIA 1JKKA 5AV2A 4DGLC 2VWXA 3UP2A 5J5TA 4FKPA 4E93A 1H26A 3BHUA 3KXMA 5KX8A 4MAOA 5J87A 3OS3A 1JQHA 2Z8CA 3D15A 4ACMA 3C9WA 4RVKA 4ITHA 4JDHA 4B9DA 3SRVB 3ENMA 3LKMA 1PXKA 3QRJA 1FMOE 4APCA 4OLIA 3G9NA 1R39A 5HX6A 2X81A 3QWKA 5A4LA 5GHVA 3MS9A 3SDJA 3MA3A 2BRGA 2W1GA 3QALE 5A6NA 2BRNA 5L2IA 1PMVA 2VTIA 4HNIA 1BX6A 2F9GA 2V7OA 3KY2A 4BICA 4FEUA 4L7FA 4WBOA 4IZ5A 5E1EA 4ASDA 4HW7A 2VO3A 4HCTA 3D2KA 4YLLA 1XBBA 4N57A 2NNWB 2XK9A 3ORZA 5EM8A 4M3QA 4FNXA 3OEZA 3MY5A 3MWUA 3DGKA
chains in the Genus database with same CATH superfamily
2PZ5A 4O0VA 4E4MA 3UITA 3GC8A 4JDJA 1P14A 2VGOA 4V05A 4FL3A 4GK4A 1OKYA 1OKVA 3COIA 3U9NA 2REIA 5HNBA 3GXLA 5HBJA 2H9VA 2UW9A 1OGYA 3O50A 2CMWA 2WPAA 5FTOA 5L6WL 4F70A 3EN4A 2UZOA 4KNBA 1OITA 4FC0A 3PA5A 2YDJA 4O7LA 4U41A 4BDKA 3DXQA 4N6ZA 5IH4A 3AT3A 3O7LB 1BKXA 5D7AA 3EQCA 4JI9A 4IW0A 4UZDA 5E90A 5IU2A 1LUFA 5KKRB 4S33A 2DYLA 3VUHA 4GRBA 2QGMA 4BI0A 3EQDA 2YCQA 5KO1A 3DQWA 2ZM3A 5A46A 3PP1A 2Z60A 3OT8A 3MSSA 2Z02A 5I9UA 4FT3A 2E9VA 1GZOA 3KXNA 4QPAA 2VTAA 1WBSA 3P9JA 3ROCA 3FY2A 1UVRA 4ZIMA 4CKIA 2WTDA 4C57A 4FV6A 3VBQA 5HG8A 4FG9A 4E6QA 2YM3A 4I24A 3OTVA 5ANEA 3R28A 4QMXA 3NUXA 1RQQA 5E9EA 5JFWA 3IOKA 4DDIA 5TF9A 2XAMA 4CD0A 3CTQA 4C37A 4NIFB 3MH0A 3EN7A 2J9MA 2JDTA 1JLUE 2R7IA 3OF0A 3ELJA 4HOKA 1HCKA 4WUAA 5CEKA 3PSBA 2G2FA 3P4KA 3QTWA 2HOGA 4FKSA 2WIPA 3TIYA 3UQCA 3PDTA 4OW8A 2XIRA 4ANNA 4O4CA 4D2PA 3TACA 3P23A 5JFVA 2XAOA 4RWKA 4FSYA 3UQFA 5LNK1 4U79A 4RQVA 3CD8A 5CXZA 1UKIA 3NSZA 1XKKA 4XBRA 3TG1A 4C3FA 2WMUA 5BMMA 4C7TA 2GFCA 4ZS0A 3MW1A 1BLXA 4AZVA 3UYSA 3GCPA 3EMGA 1BUHA 2X8IA 4IWQA 3Q3BA 5E8VA 2R2PA 3HL7A 2R3KA 4DEGA 2BFYA 3PY0A 2PMIA 3NUNA 4QMNA 2HWOA 3WIKA 2BL7A 5M06A 4AXFA 1UWHA 3VUTA 5K5XA 2J51A 2BMCA 2F2UA 2PVNA 4TWCA 2PL0A 2XNPA 3OC1A 3SXSA 4WSYA 3O23A 4F7NA 5CSPA 4Q9VA 3NNWA 3NVKI 1Q24A 4FGBA 2Q0BA 4DITA 3HV5A 1QL6A 4IE9A 3R8PA 2CLQA 1CTPE 2YZAA 4L52A 4F9YA 1W82A 3DY7A 5BYLA 5KMKA 2WTKB 2CCHA 3PIZA 5BVWA 1Z5MA 3LQ5A 3U4UA 2XJ1A 4EHVA 4EYJA 2XKDA 2ONLA 1XHAA 2Z7QA 2UZVA 4UZHA 4EJNA 4XP0A 2CGVA 3CD3A 2UVXA 2IVVA 3H4JA 4XH6A 4G9RA 1OIUA 4AFJA 3MVMA 1W84A 4YPDA 4FL1A 5K3YA 3K3IA 4UY9A 5LOHA 4DINA 4Q5HA 4O0RA 2ZV2A 4DEDA 1G5SA 1OBDA 3IPHA 4V04A 3KCKA 5KMNA 3OG7A 2ITOA 1ZY5A 5AR5A 4LM5A 4I3ZA 4AN2A 3B8RA 3QYWA 4I5HA 2UZBA 2JBOA 4EUTA 5HIEA 3FI3A 3QD0A 1U54A 4JLCA 4LI5A 4CT2A 1OZ1A 4KB8A 2R3IA 2ZRRA 3CGOA 5FBOA 2OK1A 5CQWA 2WAJA 4YSJA 5HGIA 2Y7JA 5M09A 4CRSA 3G5DA 4S2ZA 4UWYA 4XUFA 3PPJA 4M15A 2XS0A 5C26A 3SW7A 4LDTA 4ANBA 2GHGA 2QU6A 4JAJA 3RAHA 4CKJA 2HXQA 4HFVA 4EONA 1OBGA 2XJ0A 3TL8A 2VNWA 4QNAA 2C3KA 4CQGA 4EK6A 3ORXA 4Y46A 5TOZA 3E8NA 4FZAB 3DBEA 2V6EA 5H9BA 4PWNA 3GCVA 4KSPA 5EQYA 4DTBA 3CC6A 2XNMA 3QC9A 4CYIA 2BTSA 2RADA 3HRFA 4ZAUA 3AMYA 4QP7A 2ITYA 4FX3A 2C6MA 5LMBA 4DT9A 3FKLA 5BUEA 3V5PA 2G2IA 4D4VA 3ZO3A 3F3WA 1G8KA 5BYYA 1GOLA 2B55A 2YJRA 4H58A 3O8TA 4QMLA 3OY1A 4TYJA 2ITXA 5LMKA 1P5EA 1GIJA 5HD7A 5ACBC 4D28A 3SVVA 4X3FC 3TUDA 3KXZA 3S3IA 1R1WA 4CNHA 4I94A 5M55A 5IMEA 2JB3A 4WSQA 1M2RA 2UW5A 2C0IA 3MIYA 4U3ZA 4H1MA 4AZSA 4BN1A 5EYDA 4X2GA 3IK3A 4IVCA 2Y6OA 3EFJA 3BU5A 3ZTXA 5HOAA 4EOOA 3GNIB 2XK8A 4JBPA 1H25A 2OICA 3EFKA 2IW9A 5L6OA 3QX4A 3V8SA 5HEZA 3II5A 4I21A 5M4IA 2B1PA 2RFNA 3C0HA 4EOMA 4RLLA 4DFNA 3BU3A 4AOJA 3D5UA 5HIBA 3HMMA 4KSQA 4Y83A 3KULB 4O2PA 4BTJA 3AD5A 2RG6A 2RFDA 3FC1X 5IMXA 2OW3A 2R7BA 3VN9A 4ZSAA 3LLAA 4LGGA 2YLEA 3MPTA 3EQBA 1IRKA 2EB2A 3D4QA 3M42A 5IA0A 3D9VA 3IW6A 4CZUA 1KOBA 4LMUA 4D5KA 5CSHA 2OZAA 1PHKA 4H3BA 2ITNA 2VWUA 3VS5A 4CXAA 2ZMDA 4Y8DA 3CTJA 2K19A 4GKIA 2F49A 3D2IA 4BBFA 4WG4A 4GG5A 4ZS4A 3NLBA 4EHZA 2C5NA 3QTRA 3IKAA 4HGEA 4J1RA 1J1BA 5I0BA 1Y6BA 3TCPA 3ENHA 2ITWA 3F3ZA 3RTPA 3ZLXA 3MFTA 2X0PA 3VUIA 2P2HA 5M07A 1APME 4XYFA 4O7TA 3TXOA 2OIBA 5IKWA 5J9LA 3Q4UA 4ZP5A 3HV6A 4FIGA 4RFZA 4USDA 5TT7A 3AOXA 3EQPA 3I6WA 2IW8A 3RPSA 2W1EA 2E9PA 2ETRA 4D1SA 4EYMA 2QCSA 4OAVB 4XOZA 1PYXA 5HKMA 4EOLA 1O6LA 3R7OA 4TL0A 4U7ZA 3P5JC 2W4OA 5LVMA 5TE0A 3AT4A 5GZAA 2B9FA 4BY9E 4BDJA 1QCFA 3LCDA 4QT1A 3BYOA 3ZOSA 4E3CA 4ANOA 4YU2A 3AT2A 1ZWSA 2A4LA 2X8DA 5HD4A 4A9YA 3QQJA 4OGRA 2X39A 4DG2E 1YOMA 3MFSA 3SOCA 2BRMA 2X0OA 1YOJA 3EL7A 4FIIA 4XOYA 3ID6C 4MQ2A 4DFXE 4F0FA 4D5HA 3NYXA 4FTNA 2X6EA 4F64A 2C6OA 3QLFA 4ZSJA 3ORIA 3O2MA 4C61A 3FJQE 1VYWA 2WD1A 2FO0A 1FPUA 4WG3A 5CVHA 3NW5A 4W8EA 2NP8A 1SMHA 3NW6A 4KIKA 2EVAA 2F6MB 3MVLA 2RL5A 3FQHA 5DG5A 2JBWA 3ORKA 1NVRA 4AOIA 4IBMA 4IM0A 1OKZA 2X4ZA 3VS4A 4AZFA 3QTXA 1REKA 2JLDA 3G6GA 4IZYA 3FLNC 4IQ6A 1FMKA 3T3UA 3ZRMA 1CKJA 2B9IA 4X6RA 5CEIA 2IVUA 3ZLSA 3MH3A 4NKAA 4NYEA 5AR3A 3KB7A 1L8TA 5K4JA 4F6SA 5M44A 3OOMA 5LCJA 4R77A 3IW5A 1J1CA 3F7ZA 3QGWA 1YXTA 2Y9QA 5KKRC 1NW1A 2OF2A 3HRCA 4BZOA 3OWKA 3GUBA 4C34A 3JPVA 4WNOA 3R9HA 4TYHA 3ERKA 3SQQA 4QMWA 3LLTA 5JGBA 4TWNA 2R5TA 4BL1A 4TY1A 3R8UA 4O6LA 5LMAA 2QKWB 1E9HA 1SNUA 4AT5A 3OBGA 5D11A 2C5VA 3OD6X 4QP3A 3LPBA 3OTUA 4UYAA 1H1QA 4MHAA 3OXZA 4UYNA 3PLSA 4WRGA 2VTRA 1AQ1A 4FKOA 1CSNA 3FSKA 2BHHA 5EDRA 5L8KA 3L8XA 4OTPA 1RW8A 5FEQA 3OMVA 4O82A 1RJBA 4HGSA 2WU7A 3HMOA 2DQ7X 2C69A 5DR9A 4MNEA 3R7IA 4EH2A 3C51A 2XBJA 2OI4X 4AU8A 4C4JA 5AA9A 4FICA 5L8LA 1KE9A 4RJ7A 4YZBA 2LAVA 1ST4A 2YM5A 5CX9A 3TKUA 2PVHA 4EKKA 2XTRA 4FGRA 5EHLA 1IG1A 4AS2A 1QPJA 2B4SB 3PIXA 2QO7A 2CKQA 4KKGA 2YDKA 5EW9A 2C5XA 3DFAA 3GU6A 5AP6A 3VO3A 3ZM9A 3KFAA 4RIWB 1P2AA 2XCHA 2RG5A 1Y8GA 5GJFA 4AW5A 3GT8A 4C2WA 3BHHA 4DFUA 2I0EA 2RKUA 3O96A 4EQMA 3QHRA 3W16A 1YRPA 5AP2A 3TZ9A 4KBAA 1XR1A 3UJGA 3QXPA 4AUAA 4FKTA 1KWPA 2VTMA 3L9PA 5D7VA 3VS0A 2OSCA 3LFCA 5M57A 2X0GA 4FTCA 4GW8A 5L6PA 3WE8A 3DAJA 1TDPA 4TYEA 3OCBA 4Q9SA 4X2FA 2EXEA 3NRMA 5AR4A 4GK2A 4C3PA 4CT1A 3VW8A 3DV3A 4L53A 2PVYA 5A54A 5KZIA 2XTQA 1ZYLA 1E1XA 3TZMA 4FNWA 4FIFA 3LM0A 4K8AA 3PXKA 4ZMEA 2C6LA 3CQEA 3ORLA 1FQ1B 2KKMA 4J7BA 4QYHA 3ATTA 4R7HA 5IUGA 4JIAA 4EWHA 2GS2A 3NYVA 3CY2A 5DMZA 4A9UA 4D2RA 4YURA 2ITZA 2JGZA 2WOUA 4AG8A 3SG9A 3C5UA 4L43A 4GS6A 3Q53A 2IJMA 3F6XA 1XH8A 5AUXA 3U54A 2EXMA 4PDOA 5CWZA 3LCOA 5I9VA 4ORKA 2C6KA 4D0WA 5E8WA 1UWJA 3PPKA 2X2LA 3QKMA 3PUFC 2GCDA 4GVAA 2J7TA 3R63A 4YJVA 1K9AA 3CEKA 3UDSA 1ZZ2A 3HV3A 3BV2A 4IZ7A 4CKRA 1WBWA 4FSWA 3GBZA 3MBLA 3PXRA 3QCYA 5EDQA 3W1FA 1NVQA 2YERA 5HCZA 4GMYA 4HNFA 1P4OA 3ORTA 5CZHA 4O7NA 1M17A 4K6ZA 4W4VA 4CRLA 3GEQA 5A14A 2C4GA 1PXPA 1TQPA 2R3MA 1H01A 2PK9A 3RPRA 5ETAA 1YI6A 4AGDA 3Q96A 4A9RA 4K9YA 5JT2A 3NNVA 4D4YA 5HQ0A 3IG7A 4OTHA 3UODA 3RINA 3S95A 3UVRA 1KSWA 5FLFA 3PVGA 3MN3A 1OECA 1H1SA 3C0GA 3OXIA 3LCTA 1P4FA 2OWBA 3R1SA 1CKPA 4FV7A 4ACDA 4M69A 2KULA 1H0WA 3GU7A 2OH4A 2QOHA 3DCVA 3EZVA 4EOSA 2IZUA 2Z7RA 3MGYA 4A06A 3AG9A 2R3OA 3HEGA 4PV0A 3VBTA 2BDJA 4OTGA 4KS7A 3BLHA 3FQSA 3L8VA 1XBAA 4O4FA 3P1AA 2W5HA 3A8XA 5HLWA 3AD6A 3MESA 5FDPA 2FUG1 4G3CA 2Y4PA 2J0LA 1ZYSA 4ZTRA 3R0TA 3E62A 3PJ2A 4OTRA 4XG7A 2JC6A 1E1VA 1OIRA 2OJ9A 5G1XA 4IC7A 4JR3A 2JB1A 2XA4A 4AFEA 4HVGA 3DLSA 3EQRA 5AJQA 5AV3A 5I3OA 3FPQA 3N4TA 1H4LA 2QOCA 3OZ6A 3UIBA 2FU2A 2VO7A 2CKEA 2FH9A 3VRZA 3OT3A 2BCJA 3NUPA 4F7LA 1GZ8A 4ZLOA 2JFMA 1VLRA 3L8SA 4RX9A 2BZHB 2G2HA 2J0IA 4FK3A 4L44A 2CN8A 4NEUA 5CALA 4BDFA 1UNLA 2HZIA 3N4VA 4H05A 3DKGA 4TYIA 2WMSA 4JMQA 4QDEA 4I23A 3CGFA 4HVHA 3PY3A 3BE2A 3I7BA 4LUDA 1JVPP 2XEYA 4HYHA 4YHJA 4C62A 4EZ5A 4IMYA 3ZXTA 4DH1A 3DB8A 4F9CA 2HAKA 3ALNA 3OW3A 4ACGA 3QAME 4KBCA 3A99A 3GB2A 3K3JA 3BGZA 4PX6A 5AMNA 2EWAA 1V0PA 1J7UA 3E7OA 4IX5A 4NM3A 5BNJA 3ZZWA 4OTFA 3GU5A 4GJ3A 2NO3A 2F7XE 2E9NA 4L3JA 2QO9A 4FSZA 4MK0A 4GUEA 3DNDA 3JUHA 4PL4A 3TZ8A 3ZLWA 4B8MA 3ATSA 3DXPA 1F5QA 3EKNA 1WVXA 1H08A 4FKVA 3QBNA 2C0OA 2RSVA 2DWBA 2FSMX 2C6IA 2VTJA 4L3LA 3S2PA 3UNJA 4FSMA 4XV3A 4CMOA 4XEYA 3W0QA 4BR3A 4DA5A 4LG4A 5IISA 3ACKA 4WRSA 2EU9A 2GS6A 4F09A 4FK6A 4YHTA 4GCJA 4M7IA 3FMJA 2IN6A 1O6KA 4MQ1A 4U43A 4XLIA 5F95A 5DIAA 3FLYA 2OU7A 3PYYA 3PVWA 2FSOX 3DO9A 2YITA 3HMIA 3A4PA 3UO6A 3D7TB 5HZNA 4X3FA 5FP5A 4RA5A 4RMZA 1ZZLA 4H3QA 1ND4A 3PJ1A 4QTDA 1PKGA 3R2BA 2ITPA 3BWJA 3KQ7A 3LIJA 4AAAA 5I9ZA 2BRBA 3RBWA 4IVAA 4DHIB 2AC3A 4PNIA 1F3MC 5ETCA 3VS2A 1RE8A 4I1TA 1SZMA 4QMPA 5IQGA 2YZLA 3RPOA 3ULIA 4USEA 3MB6A 4WOVA 4ANQA 3E5AA 3NNXA 1ZARA 4QYFA 2PE1A 4K77A 4BDDA 3R1YA 3PZEA 4IZAA 4AZTA 5H8GA 3H9FA 4O81A 2WTIA 4GU6A 1OPJA 2A1AB 2BVAA 2V22A 1L3RE 3AC3A 3EZRA 4FSTA 4G6OA 1R0EA 4ITJA 2OIQA 1WMKA 4K18A 5EDPA 5AP7A 4AAYA 2OIDA 4TZRA 1OKWA 2WO6A 4ALWA 1J7LA 1A9UA 2BAQA 4IVDA 4PL3A 1Q8WA 2BKZA 3ZBFA 3DJ6A 1B38A 2ZJWA 3F3UA 3HLLA 3U4WA 1H28A 5LXMA 2A19B 4WIHA 2I0VA 3S4QA 4I0TA 3UVQA 4XJ0A 2UZLA 4I6FA 4E1ZA 2B9HA 3UIMA 3QQKA 4Q2AA 2OF4A 3BZ3A 4IAFA 4EK5A 3I81A 4EL9A 3KCFA 1W8CA 3W0SA 4DFZE 4LRJA 2BIYA 4MTAA 4EOQA 1VZOA 5AX3A 5BUJA 5M4FA 4DFBA 4XG8A 2VTNA 2QHMA 4IAYA 1JWHA 3E92A 5F1ZA 3ZDUA 2W05A 4JX7A 5C4KA 2XNNA 4HPTE 4RWJA 3TDVA 5AFVA 4TPTA 5BQ0A 3WZJA 4AOTA 1H0VA 3LXLA 4J96A 2OFVA 2PMOX 3REPA 3SRVA 4O7YA 2E8GA 2AYPA 5K0KA 2YIXA 2GQSA 4OUCA 3V5WA 4EOIA 1X8BA 4EQCA 2ZM4A 2YFAA 3U55A 3H0ZA 4FTLA 5EI6A 3UZPA 4B99A 3TJDA 4FEXA 4YC8A 4IFCA 3OHTA 2WHBA 5FXRA 4GG7A 3NYOA 4Y85A 4IB5A 1WFCA 2ITVA 3DK7A 3Q5IA 3KL8A 3KVXA 3QF9A 4LGDA 4MD8E 4XLVA 3EQGA 4QMTA 3Q5ZA 3CY3A 5IQCA 1Q4LA 3QRUA 2WQMA 5KMMA 4K11A 4BDGA 3W2CA 2YIQA 4FT9A 5BVDA 4R1VA 1GZNA 2QR7A 3I0QA 5HO6A 4D2TA 4PTGA 3DA6A 3FZTA 4QQ5A 3IOPA 3WI6A 3V6RA 4XG3A 5HBEA 2E2BA 3EQIA 4LRMA 4ZY5A 3RK7A 3FLWA 4NT4A 4Y5HA 4CYJA 3EN5A 4AXDA 4LGHA 5AEPA 3FHRA 4M12A 3FL4A 3E88A 4J8NA 4DGMA 3P86A 4F78A 5GNKA 4AS3A 3TNQB 4BDIA 4FIEA 3WZDA 2J5FA 5AP1A 3QRIA 4BTFA 4FMQA 5I3RA 4U97A 3ZONA 4FV4A 5EW3A 2UVYA 3KXGA 5L2TA 2GU8A 3CLYA 2O0UA 5FRIA 4RPVA 2LGCA 2PSQA 4FV5A 2X7FA 4MXXA 3ZXZA 4S32A 4QPSA 4F7SA 3NNUA 3EHAA 4KKEA 5C27A 4E6AA 5GZ8A 3BQCA 4ZY4A 2G01A 3BQRA 4L46A 4YJNA 4AP7A 1UA2A 2HENA 3FDNA 2ZMCA 4IEBA 4O6EA 2CAZB 3Q52A 3D0EA 4M0ZA 4ZTMA 4YZ9A 3MV5A 4MBIA 4JNWA 3ORNA 5FQDC 4E7WA 3OWJA 3FKNA 4G3GA 3BELA 4ALUA 2OXDA 1S9IA 3C4FA 5C9CA 1G3NA 3TTJA 3MTFA 3OUNB 1UKHA 4Q9ZA 3HAVA 2ZV8A 2O2UA 1JAMA 2X0QA 5DWRA 1YW2A 4C4IA 4CEGA 5CF8A 5M53A 3Q2MA 5DI1A 5HG9A 4A7CA 4QQJA 4UEUA 3Q8DA 5AM6A 1UU7A 2F7EE 3E7VA 4IB3A 3M2WA 4MF0A 3QU0A 4NIFA 4PPBA 4TKSA 2W17A 3MH1A 4IACA 1TVOA 4R5SA 3UYTA 4KBKA 1Q8UA 3W8QA 2ETDA 3U8WA 4FSNA 1R3CA 3ORPA 3RNIA 1WBVA 4OR5A 4DEBA 1YKRA 4G17A 2P33A 4S31A 4J99A 2OO8X 3LJ2A 3FZOA 2VTQA 4F63A 3I4BA 1XO2B 3DBQA 3ANQA 5AIRA 3ZFYA 4O7ZA 1FVTA 3UNZA 2J0JA 2O63A 4HGLA 5ETFA 4C4HA 3G2FA 5AP4A 3IONA 4F1OA 4PNKA 2B53A 3RHKA 4FEVA 3ZUTA 1YOLA 4GKHA 3AXWA 2P0CA 4ZZOA 3OP5A 1CM8A 3HNGA 5DE2A 3QQLA 4YLKA 3TT0A 4ZZNA 2W06A 2WEIA 4XMOA 3ZC6A 3HECA 3LJ0A 2PVFA 4II5A 3AJFA 3S00A 4GYIA 5A4CA 4X7QA 4FI1A 1IR3A 2XKCA 4O0SA 3L8PA 3P7BA 3D5VA 5CF5A 2A2CA 4BCFA 3QL8A 2JAEA 1W2DA 4CCBA 2HW6A 1SVEA 2VWIA 3EOCA 3BHTA 4AA4A 2A0CX 3HMNA 4JX3A 4FTAA 1PW2A 4JJRA 4N4SA 4W4YA 4W9XA 5E8YA 2ACXA 2O64A 3O71A 2H34A 4I1ZA 3VBVA 5C1QB 3FAAA 3JVSA 2ERZE 2YN8A 4ACHA 4YJSA 4G6LA 5ANGA 4D2VA 4GU9A 3VBXA 4WNMA 3VULA 4KS8A 4DWLA 1YXVA 4G5PA 5IA1A 2PUUA 3W2SA 4LL5A 1ZYCA 3DFCB 1IAHA 2HELA 4ZOGA 3T9TA 2GNJA 3U51A 4DBNA 1FGIA 2BILB 3RI1A 1B6CB 3PA4A 4MCVA 3PJ8A 3VUDA 3PTGA 4BCNA 5JFXA 1XH6A 4L42A 4XV1A 2JIIA 1ZAOA 2Y8OA 3CXWA 3GCQA 3NCZA 3ZMMA 4DF3A 4NFMA 3DDPA 5KMOA 3PRIA 3VNTA 5AA8A 3TV7A 2BZIB 3E8EA 4FT0A 3PJCA 4MEDA 2XBAA 2VWZA 4DH5A 3BYVA 1Y57A 4WG5A 2OFUA 2XMYA 4WKQA 1OIQA 2JDOA 4FVRA 5E91A 3NX8A 5FD2A 5HESA 2WQEA 4BGQA 3QUDA 3C50A 2CPKE 3NYNA 4FYNA 4JBVA 4L3PA 2F4JA 4L7SA 5IQFA 3HAMA 4PMPA 3TUBA 4IJPA 3TYKA 2VTLA 4EBWA 2J0KA 4GFGA 5EQPA 2VGPA 4FTJA 3NAYA 3F5GA 4IX6A 3PZHA 2IO6A 4BWKA 5JQ5A 2NPQA 4OTQA 2OGVA 3HKOA 4GJ2A 2B9JA 2WTWA 4JQEA 4QOXA 3I6UA 5K4IA 5DPVA 3KREA 2YLFA 2YFBA 4FNZA 4UWBA 2FB8A 3SLSA 4DTKA 3Q4ZA 3FHIA 3GP0A 5LJJA 1BYGA 4E4XA 3A8WA 1FINA 4GIHA 4ZJVA 4NZWB 4E26A 4MKCA 4ZLZA 4QRCA 1H1PA 3MJ2A 4BTKA 2W5BA 4NK9A 4G9CA 4AGUA 4KD1A 3B2TA 3C7QA 2UW6A 1QPEA 3F7WA 3NCGA 5EHOA 4NH1A 4CFXA 3R2YA 3NUSA 4EK8A 5C8KA 4Y5QA 2FEFA 3GOPA 2VU3A 4CTCA 2PZYA 3ANRA 2A27A 1UV5A 2JDRA 4J53A 3P78A 3TNPC 1YDRE 2WOTA 5KHWA 2C30A 4JG8A 2VTTA 4UXLA 4O27B 3HDMA 3R01A 4UXQA 5FDXA 4MNFA 1LEZA 4AACA 3L9NA 4XBUA 3LJ1A 3LAUA 5AR8A 1MRYA 3MDYA 3RM7A 4A4OA 3H9RA 5L4QA 3KULA 4BCMA 1TKIA 2EXCX 1OPLA 3TNHA 3LCSA 2R3FA 4LOOA 3RGFA 5EK7A 4IXPA 4I4EA 4O86A 3H10A 4AS0A 4AW0A 2C3LA 2GNIA 3IDPA 5JZNA 3F69A 3LFFA 4XHKB 3ML1A 4EH6A 3TIZA 3TDWA 1W83A 3COHA 3UG1A 4HPUE 3C0IA 1DAWA 4KIOA 3WOWA 3ZYAA 4BHZA 5JN2A 5LWMA 4ZMFA 5CYIA 4C58A 3FZSA 2WB8A 2O8YA 1YI4A 4FTTA 5HHWA 5HTCA 1OI9A 3P08A 4DBXA 4YTIA 4C02A 4MXZA 3VS3A 4FJVA 2C6DA 4FVQA 3LFEA 5DRDA 5HLPA 1AD5A 2BZKB 4QTAA 4UMUA 4U6RA 4CFFA 4O84A 1YO7A 1OVEA 2PZRA 2W9ZB 3HZTA 3F3TA 2X2MA 1VYZA 4NL0A 1PMUA 2XYNA 3H3CA 4UMTA 3DKFA 1WBTA 4RBLA 4LOQA 4E8AA 4EQUA 4AXEA 5DVRA 3KXHA 4YJOA 4ARKA 5KHXA 2C0TA 3FZPA 1H00A 1OUYA 3PFQA 4BDEA 4RIYB 5E1SA 4U81A 5EG3A 4EH3A 3LQ8A 4QMZA 4RZWA 5M4CA 5IQHA 3VONA 5FM2A 3RALA 3F66A 4RX5A 3RCDA 3EWHA 4QO9A 3FMMA 3WF7A 4Z9LA 1JKSA 3I1AA 3LXKA 4ZZMA 1I44A 3KRRA 4RZVA 3PXZA 4FUXA 3DAKA 5AUWA 3SGCA 3Q9WA 3PRFA 4UWCA 4X3JA 4B8LA 4DHFA 3TNIA 4YO6A 4GVJA 2V7AA 4J8MA 2J2IB 5AR7A 5J95A 3RMFA 5DT3A 3VWAA 3UNKA 1DS5A 3VIDA 4FSUA 4G75A 1EH4A 4KKHA 5F4NA 5JRSA 4RJ5A 3KN5A 3RCJA 4W4XA 4FTMA 4TTHB 5CF4A 5JGAA 4XV2A 2A98A 1U59A 2GDOA 2Y4IB 1YQJA 3T3VA 3BLAA 2XF0A 3NW7A 4PTCA 5IDPA 4JDIA 5HVKA 5CASA 1MUOA 4QMSA 4DN5A 3M11A 4D2SA 5FTGA 4CTBA 3OROA 5T68A 3EIDA 3R8ZA 4BIBA 2GPHA 2WGJA 5ICPA 2GFSA 4C4GA 3FMDA 1SVGA 4XRLA 5DT4A 2C3IB 4K2RA 2G1TA 1MQBA 2HCKA 2W1DA 1OL6A 2YEXA 2PMNX 4F6WA 2BDWA 4HCUA 4OBQA 3WZUA 2IG7A 4H3PA 3CPCA 4EOKA 2W4JA 4JQ7A 5E92A 5K5NA 3F3VA 4FG8A 4QMYA 4YTCA 4CGAA 2VTSA 2YAAA 2GHLA 4D4SA 4OAUC 1OB3A 2FSTX 1UNHA 4RJ4A 4U5JA 4IAKA 2FSLX 4LRKA 2VRXA 4L6QA 4M66A 2XNOA 3ZU7A 2JD5A 2RLDA 3DDQA 3TKIA 2BDFA 3HV4A 3JVRA 4FKQA 3BEGA 5FGKA 4BZNA 2H8HA 3V5JA 5HE0A 4BDAA 5CEOA 2CJMA 4PPAA 4OT5A 4FE2A 2UZNA 3LE6A 4PDSA 5AUTA 5FP6A 3ORMA 4CVAA 3A7HA 4C33A 4IAAA 3DNEA 3VS1A 2PUIA 1FGKA 4TNDA 4M8TA 3VW6A 5BV3A 4O91A 3N9XA 3UQGA 4P5ZA 2WQNA 1ZRZA 4WHZA 4BDHA 2I0HA 3I0OA 5AV0A 2W96B 3FVVA 2YWVA 3R1QA 4FV2A 3V6SA 1W3SA 4GT5A 4C38A 2QLQA 1PRYA 4YJRA 1WBPA 1TQMA 4KAOA 5CY3A 4O0XA 4C3RA 4RIWA 4F0IA 3I5ZA 2GQGA 4AE9A 4C8BA 4O4BB 3FLZA 4JDKA 5CT0A 1YXSA 4O7RA