2RIYA

B-specific-1,3-galactosyltransferase (gtb)+h-antigen acceptor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
284
structure length
275
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title ABO(H) blood group A and B glycosyltransferases recognize substrate via specific conformational changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 275
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2007-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2riyA00
1OQMB 1ZI5A 3JUKA 3PKQA 2MZBA 4B4GA 2RJ9A 3V0MA 1IIMA 1H5RB 2XMEA 1SS9A 2VSHA 4AAWA 2Y4KA 1LL0A 3OAMA 2VS3A 1G2VA 2P6WA 1R81A 4D48A 1EYRA 5IDTA 1MP4A 1G95A 1XZ6A 4KT7A 2FYBA 2FYDB 1R82A 1H5TA 1JYKA 1S4PA 1H4CA 2ZU9A 1NKHB 1R7UA 4Y7GA 1TVYA 2D7RA 4C2SA 1VZXA 2WVLA 4D0TA 2DPWA 4KNRA 1H3MA 1VH3A 1Z90A 2RIYA 2WE9A 1INJA 4DECA 1W77A 4KXOA 2JCJA 3I0CA 1YP4A 1PZYB 5C3AA 1HV9A 2X60A 2Y4JA 3SXAA 2QGIA 3SXDA 1HJJA 5CQOA 5I1FA 3I0IX 2AM3A 3IOIA 2X5SA 3U2XA 2FY7A 1TZFA 2APCA 2RJ7A 2I5EA 4B5BA 3U0XA 2OEFA 3BCVA 3R3IA 1VGWA 2VFZA 1K4VA 3TZTA 1KWSA 4B3UA 1H5RA 1ZCVA 3QVBA 3ZF8A 3E26A 5C8RA 1ZDGA 3ZGGA 3FOQA 1G1LA 1HM8A 2UX8A 1HM0A 2FYAA 4FRHA 1VPAA 4B2XA 2RIXA 3V0LA 5L6SA 2D7IA 2X65A 2YQSA 4P00A 4NANA 4XWIA 1H7TA 2XWLA 4HCQA 3ZLKA 1H5SA 5FTSA 5C3BA 4EEMA 1LVWA 2VXMA 1TW1A 2YQHA 1LZ7A 1ZI4A 2RJ1A 4ARWA 5FTVA 4EE4A 3V0NA 1EZIA 3T7NA 5C1GA 2I7BA 5CQNX 2AE7A 4FRDA 5EIYA 1ZJPA 1ZIZA 3LW6A 4M2BA 2OEGA 3T7MA 1S4OA 2Z86A 2V0LA 2Q4JA 1WVCA 3SXGA 4NALA 3CGXA 5C4FA 2YQCA 1H5SC 4M28A 2OI6A 3PKPA 3RSBA 3SXEA 2WVKA 3JUJA 5CMIA 1MC3A 1O7QA 2P73A 2RIZA 1TW5A 1MP5A 1VGZA 1I52A 1FGGA 3SXBA 1R80A 5FU8A 3R2WA 4ZDQA 1ON8A 1FG5N 1JV3A 3D8VA 2YC5A 1LZ0A 1GQ9A 2V0IA 4CVHA 3U2WA 4FCUA 2FFVA 1JYLA 1NMMB 4M2AA 4ASYA 4EE3A 3PNNA 4ECMA 3F1YA 2Y6PA 1GX4A 2QH5A 2Z87A 5C47A 5IFYA 1FGXA 1H4DA 4HO0A 4LW3A 3OH3A 4FQWA 1W55A 2CU2A 3HL3A 5CMHA 1G23A 4B4BA 2WAWA 2RJ5A 3DK5A 3DUVA 5C3DA 4HO4A 1G93A 2O1HA 4FRAA 3OGZA 3SXCA 1FWYA 1ZHJA 2AESA 4BQHA 1R7XA 4D11A 1YP2A 4CJBA 1GWVA 4KRVA 1GX0A 4FRBA 1G8OA 3IOJA 4MYBA 1YROB 4HO3A 1FOAA 5BXCA 1LL3A 2V0JA 2XMHA 1H7QA 2VD4A 3K8DA 3I0EA 1HM9A 3I0GA 4G87A 2ICXA 4B42A 1QGQA 3D5NA 1H7HA 1VH1A 3O3PA 1JV1A 5CQMX 4IRPA 4E1KA 4AYJA 1FR9A 4J18A 2WVMA 2VXLA 3OC9A 4KPXA 1ZCTA 4FRQA 2ZU8A 4HO5A 2XWMA 1VGUA 1H4EA 2BO6A 2WGZA 2YESA 2RITA 3BRKX 1JVGA 3V8ZA 4FRLA 4Y7TA 3TQDA 3Q4SA 3CKNA 4AYLA 5CMJA 4Y7FA 1OMXA 1LZJA 5C49A 4G3SA 5DDTA 2A8UA 2OI5A 5C4EA 4EE5A 3Q80A 1G0RA 1INIA 4KPZA 5J49A 3CU0A 4L41C 2P72A 1H7GA 3Q7UA 2A8WA 4BMAA 2RJ0A 3JTJA 1H5SD 3K8EA 3V8YA 1HJLA 3DJ4A 4FRPA 1V82A 3E25A 4FROA 1ZJOA 4Y62A 3U2UA 4K6RA 2W0VA 1V84A 3USRA 3V0OA 1ZCYA 1R7YA 2AGDA 2Y4LA 2GGQA 1ZI1A 4R7PA 2Y4MA 1WT3A 4ASJA 4FREA 3OH0A 3FWWA 2D0JA 2E8BA 4B2WA 3RMWA 3ZGFA 4HO6A 5CMFX 1ON6A 5C1HA 3T7OA 4HOCA 5CQLX 1GWWA 4NAKA 4DE7A 2JCKA 2GGOA 1V83A 3U0YA 3V0PA 3U2VA 5C36A 1XHBA 4FCEA 1ZI3A 4NAIA 5AJPA 5C4DA 2Y7AA 2PGVA 5C48A 4EEAA 1G3LA 5CMGX 4GBPA 3OKRA 1QGSA 3V90A 5C4BA 3SX8A 1FRWA 4Y64A 4CJ8A 2VS5A 4KC4A 5C38A 1ZJ0A 4AC3A 1R7TA 4Y63A 4P02A 1NWGB 1FR8A 3I0HA 3USQA 3NGWA 2BO8A 1O23B 2I5KA 2ZU7A 5C4CA 3POLA 1WT1A 2PA4A 5CQPA 4KC1A 3ZLLA 1H7EA 4G3PA 4KC2A 2V0HA 4EEGA 2E3DA 4D0ZA 1FXOA 2VSIA 1ZJ3A 5L6VA 1FZWA 4Y6NA 4IRQA 1H5SB 2BO4A 1NF5B 2YQJA 1ZCUA 5FYEA 1R7VA 1H7LA 3I0JA 1LL2A 4D11C 1PZTA 3CKOA 2O1FA 4KNXA 4LW6A 2AECA 1WT2A 2W0WA 1WSZA 1S4NA 3SPTA 1VICA 1QG8A 4HO9A 3V0QA 3I0KA 4HO8A 2ICYA 1FO9A 1O0RA 2NXVA 4M4KA 1NQIB 2YC3A 3F1CA 3SX7A 1ZJ1A 4CJCA 2FFUA 3U2TA 2BO7A 1JVDA 3I0FA 1VM8A 4UEGA 1ZDFA 5JQQA 5HS2A 1OMZA 1WT0A 3IOHA 2X5ZA 1LZIA 3KIAA 5AJOA 3OH1A 1GA8A 1E5KA 4MNDA 3RMVA 2RJ4A 3CKJA 2QKXA 2V0KA 4FRMA 2WEEA 2JCOA 1IINA 2AM4A 5DDVA 1H5TB 3D98A 4JD0A 1O7OA 4DDZA 2PGYA 5AJNA 5FU0A 1NHEB 3SX5A 3ST8A 3I0LA 1W57A 4Y7VA 5EJZA 1FO8A 4HO2A 5C1LA 2RJ8A 3N9WA 3OH2A 4KQLA 4JISA 1YP3A 3I0DA 5IDSA 2RJ6A 2AH9A 2OI7A 4HG6A 4Y9XA 5EJ1A 1VZUA 2YCMA 3CKQA 3CKVA 3GUEA 2O1GA 1VGTA 2XWNA 5FV9A 2PX7A 4B4MA 3SX3A 3V91A 4YS8A 1GQCA 1FXJA 2AM5A 1QWJA 1ZJ2A 3EE5A 4Y7UA 5FUHA 1G97A 1MP3A 4Y6UA 1H7FA 4G3QA 4EVWA 3OH4A 1VZTA 2FYCB 4EEOA 2JCLA 2VS4A 1G9RA
chains in the Genus database with same CATH superfamily
1OQMB 1ZI5A 2C0NA 3JUKA 3PKQA 2MZBA 4B4GA 2RJ9A 3V0MA 1IIMA 1H5RB 2XMEA 1SS9A 2VSHA 4AAWA 2Y4KA 1LL0A 3OAMA 2VS3A 1G2VA 2P6WA 1R81A 4D48A 1EYRA 5IDTA 1MP4A 1G95A 1XZ6A 4KT7A 2FYBA 2FYDB 1R82A 1H5TA 1JYKA 1S4PA 1H4CA 2ZU9A 4FIXA 1NKHB 1R7UA 4Y7GA 1TVYA 2D7RA 2J0AA 4C2SA 1VZXA 2WVLA 4D0TA 2DPWA 4KNRA 1H3MA 1VH3A 1Z90A 4O6MA 2RIYA 2WE9A 1INJA 4DECA 1W77A 4KXOA 2JCJA 3I0CA 1YP4A 1PZYB 5C3AA 1HV9A 2X60A 2Y4JA 5D92A 3SXAA 2QGIA 3SXDA 1HJJA 5CQOA 5I1FA 3I0IX 2AM3A 3IOIA 2X5SA 3U2XA 2FY7A 1TZFA 2APCA 2RJ7A 2I5EA 4B5BA 3U0XA 2OEFA 3BCVA 3R3IA 1VGWA 2VFZA 1K4VA 3TZTA 1KWSA 4B3UA 1H5RA 1ZCVA 3QVBA 3ZF8A 3E26A 5C8RA 1ZDGA 3ZGGA 3FOQA 1G1LA 1HM8A 2UX8A 1HM0A 2FYAA 4FRHA 1VPAA 4B2XA 2RIXA 3V0LA 5L6SA 2D7IA 2X65A 2YQSA 4P00A 4NANA 4XWIA 1H7TA 2XWLA 4HCQA 3ZLKA 1H5SA 5FTSA 5C3BA 4EEMA 1LVWA 2VXMA 1TW1A 2YQHA 1LZ7A 1ZI4A 2RJ1A 4ARWA 5FTVA 4EE4A 3V0NA 1EZIA 3T7NA 5C1GA 2I7BA 5CQNX 2AE7A 4Q7CA 4FRDA 5EIYA 1ZJPA 1ZIZA 3LW6A 4M2BA 2OEGA 3T7MA 1S4OA 2Z86A 2V0LA 2Q4JA 1WVCA 3SXGA 4NALA 3CGXA 5C4FA 2YQCA 1H5SC 4M28A 2OI6A 3PKPA 3RSBA 3SXEA 2WVKA 3JUJA 5CMIA 1MC3A 1O7QA 2P73A 2RIZA 1TW5A 1MP5A 1VGZA 1I52A 1FGGA 3SXBA 4O6NA 1R80A 5FU8A 3R2WA 4ZDQA 1ON8A 1FG5N 1JV3A 3D8VA 2YC5A 1LZ0A 1GQ9A 2V0IA 4CVHA 3U2WA 4FCUA 2FFVA 1JYLA 1NMMB 4M2AA 4ASYA 4EE3A 3PNNA 4ECMA 3F1YA 2Y6PA 1GX4A 2QH5A 2Z87A 5C47A 5IFYA 1FGXA 1H4DA 4HO0A 4LW3A 3OH3A 4FQWA 1W55A 2CU2A 3HL3A 5CMHA 1G23A 4B4BA 2WAWA 2RJ5A 3DK5A 3DUVA 5C3DA 4HO4A 1G93A 2O1HA 4FRAA 3OGZA 3SXCA 1FWYA 1ZHJA 2AESA 4BQHA 1R7XA 4D11A 1YP2A 4CJBA 1GWVA 4KRVA 1GX0A 4FRBA 1G8OA 3IOJA 4MYBA 1YROB 5D91A 4HO3A 1FOAA 5BXCA 1LL3A 2V0JA 2XMHA 1H7QA 2VD4A 3K8DA 3I0EA 1HM9A 3I0GA 4G87A 2ICXA 4B42A 1QGQA 3D5NA 1H7HA 1VH1A 3O3PA 1JV1A 5CQMX 2VK9A 4IRPA 4E1KA 4AYJA 1FR9A 4J18A 2WVMA 2VXLA 3OC9A 4KPXA 1ZCTA 4FRQA 2ZU8A 4HO5A 2XWMA 1VGUA 1H4EA 2BO6A 2WGZA 2YESA 2RITA 3BRKX 1JVGA 3V8ZA 4FRLA 4Y7TA 3TQDA 3Q4SA 3CKNA 4AYLA 5CMJA 4Y7FA 1OMXA 1LZJA 5C49A 4G3SA 5DDTA 2A8UA 2OI5A 2J0BA 5C4EA 4EE5A 3Q80A 4FIYA 1G0RA 1INIA 4KPZA 5J49A 3CU0A 4L41C 2P72A 1H7GA 3Q7UA 2A8WA 4BMAA 2RJ0A 3JTJA 1H5SD 3K8EA 3V8YA 1HJLA 3DJ4A 4FRPA 1V82A 3E25A 4FROA 1ZJOA 4Y62A 3U2UA 4K6RA 2W0VA 1V84A 3USRA 3V0OA 1ZCYA 1R7YA 2AGDA 2Y4LA 2GGQA 1ZI1A 4R7PA 2Y4MA 1WT3A 4ASJA 4FREA 3OH0A 3FWWA 2D0JA 2E8BA 4B2WA 3RMWA 3ZGFA 4HO6A 5CMFX 1ON6A 5C1HA 3T7OA 4HOCA 5CQLX 1GWWA 4NAKA 4DE7A 2JCKA 2GGOA 1V83A 3U0YA 3V0PA 3U2VA 5C36A 1XHBA 4FCEA 1ZI3A 4NAIA 5AJPA 5C4DA 2Y7AA 2PGVA 5C48A 4EEAA 1G3LA 5CMGX 4GBPA 3OKRA 1QGSA 3V90A 5C4BA 3SX8A 1FRWA 4Y64A 4CJ8A 2VS5A 4KC4A 5C38A 1ZJ0A 4AC3A 1R7TA 4Y63A 4P02A 1NWGB 1FR8A 3I0HA 3USQA 3NGWA 2BO8A 1O23B 2I5KA 2ZU7A 5C4CA 3POLA 1WT1A 2PA4A 5CQPA 4KC1A 3ZLLA 1H7EA 4G3PA 4KC2A 2V0HA 4EEGA 2E3DA 4D0ZA 1FXOA 2VSIA 1ZJ3A 5L6VA 1FZWA 4Y6NA 4IRQA 1H5SB 2BO4A 1NF5B 2YQJA 1ZCUA 5FYEA 1R7VA 1H7LA 3I0JA 1LL2A 4D11C 1PZTA 3CKOA 2O1FA 4KNXA 4LW6A 2AECA 1WT2A 2W0WA 1WSZA 1S4NA 3SPTA 1VICA 1QG8A 4HO9A 3V0QA 3I0KA 4HO8A 2ICYA 1FO9A 1O0RA 2NXVA 4M4KA 1NQIB 2YC3A 3F1CA 3SX7A 1ZJ1A 4CJCA 2FFUA 3U2TA 2BO7A 1JVDA 3I0FA 1VM8A 4UEGA 1ZDFA 5JQQA 5HS2A 1OMZA 1WT0A 3IOHA 2X5ZA 1LZIA 3KIAA 5AJOA 3OH1A 1GA8A 1E5KA 4MNDA 3RMVA 2RJ4A 3CKJA 2QKXA 2V0KA 4FRMA 2WEEA 2JCOA 1IINA 2AM4A 5DDVA 1H5TB 3D98A 4JD0A 1O7OA 4DDZA 2PGYA 5AJNA 5FU0A 1NHEB 3SX5A 3ST8A 3I0LA 1W57A 4Y7VA 5EJZA 1FO8A 4HO2A 5C1LA 2RJ8A 3N9WA 3OH2A 4KQLA 4JISA 4MIXA 1YP3A 3I0DA 5IDSA 2RJ6A 2AH9A 2OI7A 4HG6A 4Y9XA 5EJ1A 1VZUA 2YCMA 3CKQA 3CKVA 3GUEA 2O1GA 1VGTA 2XWNA 5FV9A 2PX7A 4B4MA 3SX3A 3V91A 4YS8A 1GQCA 1FXJA 2AM5A 1QWJA 1ZJ2A 3EE5A 4Y7UA 5FUHA 1G97A 1MP3A 4Y6UA 1H7FA 4G3QA 4EVWA 3OH4A 1VZTA 2FYCB 4EEOA 2JCLA 2VS4A 1G9RA
chains in the Genus database with same CATH topology
1OQMB 1ZI5A 2C0NA 3JUKA 3PKQA 2MZBA 4B4GA 2RJ9A 3V0MA 1IIMA 1H5RB 2XMEA 1SS9A 2VSHA 4AAWA 2Y4KA 1LL0A 3OAMA 2VS3A 1G2VA 2P6WA 1R81A 4D48A 1EYRA 5IDTA 1MP4A 1G95A 1XZ6A 4KT7A 2FYBA 2FYDB 1R82A 1H5TA 1JYKA 1S4PA 1H4CA 2ZU9A 4FIXA 1NKHB 1R7UA 4Y7GA 1TVYA 2D7RA 2J0AA 4C2SA 1VZXA 2WVLA 4D0TA 2DPWA 4KNRA 1H3MA 1VH3A 1Z90A 4O6MA 2RIYA 2WE9A 1INJA 4DECA 1W77A 4KXOA 2JCJA 3I0CA 1YP4A 1PZYB 5C3AA 1HV9A 2X60A 2Y4JA 5D92A 3SXAA 2QGIA 3SXDA 1HJJA 5CQOA 5I1FA 3I0IX 2AM3A 3IOIA 2X5SA 3U2XA 2FY7A 1TZFA 2APCA 2RJ7A 2I5EA 4B5BA 3U0XA 2OEFA 3BCVA 3R3IA 1VGWA 2VFZA 1K4VA 3TZTA 1KWSA 4B3UA 1H5RA 1ZCVA 3QVBA 3ZF8A 3E26A 5C8RA 1ZDGA 3ZGGA 3FOQA 1G1LA 1HM8A 2UX8A 1HM0A 2FYAA 4FRHA 1VPAA 4B2XA 2RIXA 3V0LA 5L6SA 2D7IA 2X65A 2YQSA 4P00A 4NANA 4XWIA 1H7TA 2XWLA 4HCQA 3ZLKA 1H5SA 5FTSA 5C3BA 4EEMA 1LVWA 2VXMA 1TW1A 2YQHA 1LZ7A 1ZI4A 2RJ1A 4ARWA 5FTVA 4EE4A 3V0NA 1EZIA 3T7NA 5C1GA 2I7BA 5CQNX 2AE7A 4Q7CA 4FRDA 5EIYA 1ZJPA 1ZIZA 3LW6A 4M2BA 2OEGA 3T7MA 1S4OA 2Z86A 2V0LA 2Q4JA 1WVCA 3SXGA 4NALA 3CGXA 5C4FA 2YQCA 1H5SC 4M28A 2OI6A 3PKPA 3RSBA 3SXEA 2WVKA 3JUJA 5CMIA 1MC3A 1O7QA 2P73A 2RIZA 1TW5A 1MP5A 1VGZA 1I52A 1FGGA 3SXBA 4O6NA 1R80A 5FU8A 3R2WA 4ZDQA 1ON8A 1FG5N 1JV3A 3D8VA 2YC5A 1LZ0A 1GQ9A 2V0IA 4CVHA 3U2WA 4FCUA 2FFVA 1JYLA 1NMMB 4M2AA 4ASYA 4EE3A 3PNNA 4ECMA 3F1YA 2Y6PA 1GX4A 2QH5A 2Z87A 5C47A 5IFYA 1FGXA 1H4DA 4HO0A 4LW3A 3OH3A 4FQWA 1W55A 2CU2A 3HL3A 5CMHA 1G23A 4B4BA 2WAWA 2RJ5A 3DK5A 3DUVA 5C3DA 4HO4A 1G93A 2O1HA 4FRAA 3OGZA 3SXCA 1FWYA 1ZHJA 2AESA 4BQHA 1R7XA 4D11A 1YP2A 4CJBA 1GWVA 4KRVA 1GX0A 4FRBA 1G8OA 3IOJA 4MYBA 1YROB 5D91A 4HO3A 1FOAA 5BXCA 1LL3A 2V0JA 2XMHA 1H7QA 2VD4A 3K8DA 3I0EA 1HM9A 3I0GA 4G87A 2ICXA 4B42A 1QGQA 3D5NA 1H7HA 1VH1A 3O3PA 1JV1A 5CQMX 2VK9A 4IRPA 4E1KA 4AYJA 1FR9A 4J18A 2WVMA 2VXLA 3OC9A 4KPXA 1ZCTA 4FRQA 2ZU8A 4HO5A 2XWMA 1VGUA 1H4EA 2BO6A 2WGZA 2YESA 2RITA 3BRKX 1JVGA 3V8ZA 4FRLA 4Y7TA 3TQDA 3Q4SA 3CKNA 4AYLA 5CMJA 4Y7FA 1OMXA 1LZJA 5C49A 4G3SA 5DDTA 2A8UA 2OI5A 2J0BA 5C4EA 4EE5A 3Q80A 4FIYA 1G0RA 1INIA 4KPZA 5J49A 3CU0A 4L41C 2P72A 1H7GA 3Q7UA 2A8WA 4BMAA 2RJ0A 3JTJA 1H5SD 3K8EA 3V8YA 1HJLA 3DJ4A 4FRPA 1V82A 3E25A 4FROA 1ZJOA 4Y62A 3U2UA 4K6RA 2W0VA 1V84A 3USRA 3V0OA 1ZCYA 1R7YA 2AGDA 2Y4LA 2GGQA 1ZI1A 4R7PA 2Y4MA 1WT3A 4ASJA 4FREA 3OH0A 3FWWA 2D0JA 2E8BA 4B2WA 3RMWA 3ZGFA 4HO6A 5CMFX 1ON6A 5C1HA 3T7OA 4HOCA 5CQLX 1GWWA 4NAKA 4DE7A 2JCKA 2GGOA 1V83A 3U0YA 3V0PA 3U2VA 5C36A 1XHBA 4FCEA 1ZI3A 4NAIA 5AJPA 5C4DA 2Y7AA 2PGVA 5C48A 4EEAA 1G3LA 5CMGX 4GBPA 3OKRA 1QGSA 3V90A 5C4BA 3SX8A 1FRWA 4Y64A 4CJ8A 2VS5A 4KC4A 5C38A 1ZJ0A 4AC3A 1R7TA 4Y63A 4P02A 1NWGB 1FR8A 3I0HA 3USQA 3NGWA 2BO8A 1O23B 2I5KA 2ZU7A 5C4CA 3POLA 1WT1A 2PA4A 5CQPA 4KC1A 3ZLLA 1H7EA 4G3PA 4KC2A 2V0HA 4EEGA 2E3DA 4D0ZA 1FXOA 2VSIA 1ZJ3A 5L6VA 1FZWA 4Y6NA 4IRQA 1H5SB 2BO4A 1NF5B 2YQJA 1ZCUA 5FYEA 1R7VA 1H7LA 3I0JA 1LL2A 4D11C 1PZTA 3CKOA 2O1FA 4KNXA 4LW6A 2AECA 1WT2A 2W0WA 1WSZA 1S4NA 3SPTA 1VICA 1QG8A 4HO9A 3V0QA 3I0KA 4HO8A 2ICYA 1FO9A 1O0RA 2NXVA 4M4KA 1NQIB 2YC3A 3F1CA 3SX7A 1ZJ1A 4CJCA 2FFUA 3U2TA 2BO7A 1JVDA 3I0FA 1VM8A 4UEGA 1ZDFA 5JQQA 5HS2A 1OMZA 1WT0A 3IOHA 2X5ZA 1LZIA 3KIAA 5AJOA 3OH1A 1GA8A 1E5KA 4MNDA 3RMVA 2RJ4A 3CKJA 2QKXA 2V0KA 4FRMA 2WEEA 2JCOA 1IINA 2AM4A 5DDVA 1H5TB 3D98A 4JD0A 1O7OA 4DDZA 2PGYA 5AJNA 5FU0A 1NHEB 3SX5A 3ST8A 3I0LA 1W57A 4Y7VA 5EJZA 1FO8A 4HO2A 5C1LA 2RJ8A 3N9WA 3OH2A 4KQLA 4JISA 4MIXA 1YP3A 3I0DA 5IDSA 2RJ6A 2AH9A 2OI7A 4HG6A 4Y9XA 5EJ1A 1VZUA 2YCMA 3CKQA 3CKVA 3GUEA 2O1GA 1VGTA 2XWNA 5FV9A 2PX7A 4B4MA 3SX3A 3V91A 4YS8A 1GQCA 1FXJA 2AM5A 1QWJA 1ZJ2A 3EE5A 4Y7UA 5FUHA 1G97A 1MP3A 4Y6UA 1H7FA 4G3QA 4EVWA 3OH4A 1VZTA 2FYCB 4EEOA 2JCLA 2VS4A 1G9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQM B;  1ZI5 A;  3JUK A;  3PKQ A;  2MZB A;  4B4G A;  2RJ9 A;  3V0M A;  1IIM A;  1H5R B;  2XME A;  1SS9 A;  2VSH A;  4AAW A;  2Y4K A;  1LL0 A;  3OAM A;  2VS3 A;  1G2V A;  2P6W A;  1R81 A;  4D48 A;  1EYR A;  5IDT A;  1MP4 A;  1G95 A;  1XZ6 A;  4KT7 A;  2FYB A;  2FYD B;  1R82 A;  1H5T A;  1JYK A;  1S4P A;  1H4C A;  2ZU9 A;  1NKH B;  1R7U A;  4Y7G A;  1TVY A;  2D7R A;  4C2S A;  1VZX A;  2WVL A;  4D0T A;  2DPW A;  4KNR A;  1H3M A;  1VH3 A;  1Z90 A;  2RIY A;  2WE9 A;  1INJ A;  4DEC A;  1W77 A;  4KXO A;  2JCJ A;  3I0C A;  1YP4 A;  1PZY B;  5C3A A;  1HV9 A;  2X60 A;  2Y4J A;  3SXA A;  2QGI A;  3SXD A;  1HJJ A;  5CQO A;  5I1F A;  3I0I X;  2AM3 A;  3IOI A;  2X5S A;  3U2X A;  2FY7 A;  1TZF A;  2APC A;  2RJ7 A;  2I5E A;  4B5B A;  3U0X A;  2OEF A;  3BCV A;  3R3I A;  1VGW A;  2VFZ A;  1K4V A;  3TZT A;  1KWS A;  4B3U A;  1H5R A;  1ZCV A;  3QVB A;  3ZF8 A;  3E26 A;  5C8R A;  1ZDG A;  3ZGG A;  3FOQ A;  1G1L A;  1HM8 A;  2UX8 A;  1HM0 A;  2FYA A;  4FRH A;  1VPA A;  4B2X A;  2RIX A;  3V0L A;  5L6S A;  2D7I A;  2X65 A;  2YQS A;  4P00 A;  4NAN A;  4XWI A;  1H7T A;  2XWL A;  4HCQ A;  3ZLK A;  1H5S A;  5FTS A;  5C3B A;  4EEM A;  1LVW A;  2VXM A;  1TW1 A;  2YQH A;  1LZ7 A;  1ZI4 A;  2RJ1 A;  4ARW A;  5FTV A;  4EE4 A;  3V0N A;  1EZI A;  3T7N A;  5C1G A;  2I7B A;  5CQN X;  2AE7 A;  4FRD A;  5EIY A;  1ZJP A;  1ZIZ A;  3LW6 A;  4M2B A;  2OEG A;  3T7M A;  1S4O A;  2Z86 A;  2V0L A;  2Q4J A;  1WVC A;  3SXG A;  4NAL A;  3CGX A;  5C4F A;  2YQC A;  1H5S C;  4M28 A;  2OI6 A;  3PKP A;  3RSB A;  3SXE A;  2WVK A;  3JUJ A;  5CMI A;  1MC3 A;  1O7Q A;  2P73 A;  2RIZ A;  1TW5 A;  1MP5 A;  1VGZ A;  1I52 A;  1FGG A;  3SXB A;  1R80 A;  5FU8 A;  3R2W A;  4ZDQ A;  1ON8 A;  1FG5 N;  1JV3 A;  3D8V A;  2YC5 A;  1LZ0 A;  1GQ9 A;  2V0I A;  4CVH A;  3U2W A;  4FCU A;  2FFV A;  1JYL A;  1NMM B;  4M2A A;  4ASY A;  4EE3 A;  3PNN A;  4ECM A;  3F1Y A;  2Y6P A;  1GX4 A;  2QH5 A;  2Z87 A;  5C47 A;  5IFY A;  1FGX A;  1H4D A;  4HO0 A;  4LW3 A;  3OH3 A;  4FQW A;  1W55 A;  2CU2 A;  3HL3 A;  5CMH A;  1G23 A;  4B4B A;  2WAW A;  2RJ5 A;  3DK5 A;  3DUV A;  5C3D A;  4HO4 A;  1G93 A;  2O1H A;  4FRA A;  3OGZ A;  3SXC A;  1FWY A;  1ZHJ A;  2AES A;  4BQH A;  1R7X A;  4D11 A;  1YP2 A;  4CJB A;  1GWV A;  4KRV A;  1GX0 A;  4FRB A;  1G8O A;  3IOJ A;  4MYB A;  1YRO B;  4HO3 A;  1FOA A;  5BXC A;  1LL3 A;  2V0J A;  2XMH A;  1H7Q A;  2VD4 A;  3K8D A;  3I0E A;  1HM9 A;  3I0G A;  4G87 A;  2ICX A;  4B42 A;  1QGQ A;  3D5N A;  1H7H A;  1VH1 A;  3O3P A;  1JV1 A;  5CQM X;  4IRP A;  4E1K A;  4AYJ A;  1FR9 A;  4J18 A;  2WVM A;  2VXL A;  3OC9 A;  4KPX A;  1ZCT A;  4FRQ A;  2ZU8 A;  4HO5 A;  2XWM A;  1VGU A;  1H4E A;  2BO6 A;  2WGZ A;  2YES A;  2RIT A;  3BRK X;  1JVG A;  3V8Z A;  4FRL A;  4Y7T A;  3TQD A;  3Q4S A;  3CKN A;  4AYL A;  5CMJ A;  4Y7F A;  1OMX A;  1LZJ A;  5C49 A;  4G3S A;  5DDT A;  2A8U A;  2OI5 A;  5C4E A;  4EE5 A;  3Q80 A;  1G0R A;  1INI A;  4KPZ A;  5J49 A;  3CU0 A;  4L41 C;  2P72 A;  1H7G A;  3Q7U A;  2A8W A;  4BMA A;  2RJ0 A;  3JTJ A;  1H5S D;  3K8E A;  3V8Y A;  1HJL A;  3DJ4 A;  4FRP A;  1V82 A;  3E25 A;  4FRO A;  1ZJO A;  4Y62 A;  3U2U A;  4K6R A;  2W0V A;  1V84 A;  3USR A;  3V0O A;  1ZCY A;  1R7Y A;  2AGD A;  2Y4L A;  2GGQ A;  1ZI1 A;  4R7P A;  2Y4M A;  1WT3 A;  4ASJ A;  4FRE A;  3OH0 A;  3FWW A;  2D0J A;  2E8B A;  4B2W A;  3RMW A;  3ZGF A;  4HO6 A;  5CMF X;  1ON6 A;  5C1H A;  3T7O A;  4HOC A;  5CQL X;  1GWW A;  4NAK A;  4DE7 A;  2JCK A;  2GGO A;  1V83 A;  3U0Y A;  3V0P A;  3U2V A;  5C36 A;  1XHB A;  4FCE A;  1ZI3 A;  4NAI A;  5AJP A;  5C4D A;  2Y7A A;  2PGV A;  5C48 A;  4EEA A;  1G3L A;  5CMG X;  4GBP A;  3OKR A;  1QGS A;  3V90 A;  5C4B A;  3SX8 A;  1FRW A;  4Y64 A;  4CJ8 A;  2VS5 A;  4KC4 A;  5C38 A;  1ZJ0 A;  4AC3 A;  1R7T A;  4Y63 A;  4P02 A;  1NWG B;  1FR8 A;  3I0H A;  3USQ A;  3NGW A;  2BO8 A;  1O23 B;  2I5K A;  2ZU7 A;  5C4C A;  3POL A;  1WT1 A;  2PA4 A;  5CQP A;  4KC1 A;  3ZLL A;  1H7E A;  4G3P A;  4KC2 A;  2V0H A;  4EEG A;  2E3D A;  4D0Z A;  1FXO A;  2VSI A;  1ZJ3 A;  5L6V A;  1FZW A;  4Y6N A;  4IRQ A;  1H5S B;  2BO4 A;  1NF5 B;  2YQJ A;  1ZCU A;  5FYE A;  1R7V A;  1H7L A;  3I0J A;  1LL2 A;  4D11 C;  1PZT A;  3CKO A;  2O1F A;  4KNX A;  4LW6 A;  2AEC A;  1WT2 A;  2W0W A;  1WSZ A;  1S4N A;  3SPT A;  1VIC A;  1QG8 A;  4HO9 A;  3V0Q A;  3I0K A;  4HO8 A;  2ICY A;  1FO9 A;  1O0R A;  2NXV A;  4M4K A;  1NQI B;  2YC3 A;  3F1C A;  3SX7 A;  1ZJ1 A;  4CJC A;  2FFU A;  3U2T A;  2BO7 A;  1JVD A;  3I0F A;  1VM8 A;  4UEG A;  1ZDF A;  5JQQ A;  5HS2 A;  1OMZ A;  1WT0 A;  3IOH A;  2X5Z A;  1LZI A;  3KIA A;  5AJO A;  3OH1 A;  1GA8 A;  1E5K A;  4MND A;  3RMV A;  2RJ4 A;  3CKJ A;  2QKX A;  2V0K A;  4FRM A;  2WEE A;  2JCO A;  1IIN A;  2AM4 A;  5DDV A;  1H5T B;  3D98 A;  4JD0 A;  1O7O A;  4DDZ A;  2PGY A;  5AJN A;  5FU0 A;  1NHE B;  3SX5 A;  3ST8 A;  3I0L A;  1W57 A;  4Y7V A;  5EJZ A;  1FO8 A;  4HO2 A;  5C1L A;  2RJ8 A;  3N9W A;  3OH2 A;  4KQL A;  4JIS A;  1YP3 A;  3I0D A;  5IDS A;  2RJ6 A;  2AH9 A;  2OI7 A;  4HG6 A;  4Y9X A;  5EJ1 A;  1VZU A;  2YCM A;  3CKQ A;  3CKV A;  3GUE A;  2O1G A;  1VGT A;  2XWN A;  5FV9 A;  2PX7 A;  4B4M A;  3SX3 A;  3V91 A;  4YS8 A;  1GQC A;  1FXJ A;  2AM5 A;  1QWJ A;  1ZJ2 A;  3EE5 A;  4Y7U A;  5FUH A;  1G97 A;  1MP3 A;  4Y6U A;  1H7F A;  4G3Q A;  4EVW A;  3OH4 A;  1VZT A;  2FYC B;  4EEO A;  2JCL A;  2VS4 A;  1G9R A; 
#chains in the Genus database with same CATH topology
 1OQM B;  1ZI5 A;  2C0N A;  3JUK A;  3PKQ A;  2MZB A;  4B4G A;  2RJ9 A;  3V0M A;  1IIM A;  1H5R B;  2XME A;  1SS9 A;  2VSH A;  4AAW A;  2Y4K A;  1LL0 A;  3OAM A;  2VS3 A;  1G2V A;  2P6W A;  1R81 A;  4D48 A;  1EYR A;  5IDT A;  1MP4 A;  1G95 A;  1XZ6 A;  4KT7 A;  2FYB A;  2FYD B;  1R82 A;  1H5T A;  1JYK A;  1S4P A;  1H4C A;  2ZU9 A;  4FIX A;  1NKH B;  1R7U A;  4Y7G A;  1TVY A;  2D7R A;  2J0A A;  4C2S A;  1VZX A;  2WVL A;  4D0T A;  2DPW A;  4KNR A;  1H3M A;  1VH3 A;  1Z90 A;  4O6M A;  2RIY A;  2WE9 A;  1INJ A;  4DEC A;  1W77 A;  4KXO A;  2JCJ A;  3I0C A;  1YP4 A;  1PZY B;  5C3A A;  1HV9 A;  2X60 A;  2Y4J A;  5D92 A;  3SXA A;  2QGI A;  3SXD A;  1HJJ A;  5CQO A;  5I1F A;  3I0I X;  2AM3 A;  3IOI A;  2X5S A;  3U2X A;  2FY7 A;  1TZF A;  2APC A;  2RJ7 A;  2I5E A;  4B5B A;  3U0X A;  2OEF A;  3BCV A;  3R3I A;  1VGW A;  2VFZ A;  1K4V A;  3TZT A;  1KWS A;  4B3U A;  1H5R A;  1ZCV A;  3QVB A;  3ZF8 A;  3E26 A;  5C8R A;  1ZDG A;  3ZGG A;  3FOQ A;  1G1L A;  1HM8 A;  2UX8 A;  1HM0 A;  2FYA A;  4FRH A;  1VPA A;  4B2X A;  2RIX A;  3V0L A;  5L6S A;  2D7I A;  2X65 A;  2YQS A;  4P00 A;  4NAN A;  4XWI A;  1H7T A;  2XWL A;  4HCQ A;  3ZLK A;  1H5S A;  5FTS A;  5C3B A;  4EEM A;  1LVW A;  2VXM A;  1TW1 A;  2YQH A;  1LZ7 A;  1ZI4 A;  2RJ1 A;  4ARW A;  5FTV A;  4EE4 A;  3V0N A;  1EZI A;  3T7N A;  5C1G A;  2I7B A;  5CQN X;  2AE7 A;  4Q7C A;  4FRD A;  5EIY A;  1ZJP A;  1ZIZ A;  3LW6 A;  4M2B A;  2OEG A;  3T7M A;  1S4O A;  2Z86 A;  2V0L A;  2Q4J A;  1WVC A;  3SXG A;  4NAL A;  3CGX A;  5C4F A;  2YQC A;  1H5S C;  4M28 A;  2OI6 A;  3PKP A;  3RSB A;  3SXE A;  2WVK A;  3JUJ A;  5CMI A;  1MC3 A;  1O7Q A;  2P73 A;  2RIZ A;  1TW5 A;  1MP5 A;  1VGZ A;  1I52 A;  1FGG A;  3SXB A;  4O6N A;  1R80 A;  5FU8 A;  3R2W A;  4ZDQ A;  1ON8 A;  1FG5 N;  1JV3 A;  3D8V A;  2YC5 A;  1LZ0 A;  1GQ9 A;  2V0I A;  4CVH A;  3U2W A;  4FCU A;  2FFV A;  1JYL A;  1NMM B;  4M2A A;  4ASY A;  4EE3 A;  3PNN A;  4ECM A;  3F1Y A;  2Y6P A;  1GX4 A;  2QH5 A;  2Z87 A;  5C47 A;  5IFY A;  1FGX A;  1H4D A;  4HO0 A;  4LW3 A;  3OH3 A;  4FQW A;  1W55 A;  2CU2 A;  3HL3 A;  5CMH A;  1G23 A;  4B4B A;  2WAW A;  2RJ5 A;  3DK5 A;  3DUV A;  5C3D A;  4HO4 A;  1G93 A;  2O1H A;  4FRA A;  3OGZ A;  3SXC A;  1FWY A;  1ZHJ A;  2AES A;  4BQH A;  1R7X A;  4D11 A;  1YP2 A;  4CJB A;  1GWV A;  4KRV A;  1GX0 A;  4FRB A;  1G8O A;  3IOJ A;  4MYB A;  1YRO B;  5D91 A;  4HO3 A;  1FOA A;  5BXC A;  1LL3 A;  2V0J A;  2XMH A;  1H7Q A;  2VD4 A;  3K8D A;  3I0E A;  1HM9 A;  3I0G A;  4G87 A;  2ICX A;  4B42 A;  1QGQ A;  3D5N A;  1H7H A;  1VH1 A;  3O3P A;  1JV1 A;  5CQM X;  2VK9 A;  4IRP A;  4E1K A;  4AYJ A;  1FR9 A;  4J18 A;  2WVM A;  2VXL A;  3OC9 A;  4KPX A;  1ZCT A;  4FRQ A;  2ZU8 A;  4HO5 A;  2XWM A;  1VGU A;  1H4E A;  2BO6 A;  2WGZ A;  2YES A;  2RIT A;  3BRK X;  1JVG A;  3V8Z A;  4FRL A;  4Y7T A;  3TQD A;  3Q4S A;  3CKN A;  4AYL A;  5CMJ A;  4Y7F A;  1OMX A;  1LZJ A;  5C49 A;  4G3S A;  5DDT A;  2A8U A;  2OI5 A;  2J0B A;  5C4E A;  4EE5 A;  3Q80 A;  4FIY A;  1G0R A;  1INI A;  4KPZ A;  5J49 A;  3CU0 A;  4L41 C;  2P72 A;  1H7G A;  3Q7U A;  2A8W A;  4BMA A;  2RJ0 A;  3JTJ A;  1H5S D;  3K8E A;  3V8Y A;  1HJL A;  3DJ4 A;  4FRP A;  1V82 A;  3E25 A;  4FRO A;  1ZJO A;  4Y62 A;  3U2U A;  4K6R A;  2W0V A;  1V84 A;  3USR A;  3V0O A;  1ZCY A;  1R7Y A;  2AGD A;  2Y4L A;  2GGQ A;  1ZI1 A;  4R7P A;  2Y4M A;  1WT3 A;  4ASJ A;  4FRE A;  3OH0 A;  3FWW A;  2D0J A;  2E8B A;  4B2W A;  3RMW A;  3ZGF A;  4HO6 A;  5CMF X;  1ON6 A;  5C1H A;  3T7O A;  4HOC A;  5CQL X;  1GWW A;  4NAK A;  4DE7 A;  2JCK A;  2GGO A;  1V83 A;  3U0Y A;  3V0P A;  3U2V A;  5C36 A;  1XHB A;  4FCE A;  1ZI3 A;  4NAI A;  5AJP A;  5C4D A;  2Y7A A;  2PGV A;  5C48 A;  4EEA A;  1G3L A;  5CMG X;  4GBP A;  3OKR A;  1QGS A;  3V90 A;  5C4B A;  3SX8 A;  1FRW A;  4Y64 A;  4CJ8 A;  2VS5 A;  4KC4 A;  5C38 A;  1ZJ0 A;  4AC3 A;  1R7T A;  4Y63 A;  4P02 A;  1NWG B;  1FR8 A;  3I0H A;  3USQ A;  3NGW A;  2BO8 A;  1O23 B;  2I5K A;  2ZU7 A;  5C4C A;  3POL A;  1WT1 A;  2PA4 A;  5CQP A;  4KC1 A;  3ZLL A;  1H7E A;  4G3P A;  4KC2 A;  2V0H A;  4EEG A;  2E3D A;  4D0Z A;  1FXO A;  2VSI A;  1ZJ3 A;  5L6V A;  1FZW A;  4Y6N A;  4IRQ A;  1H5S B;  2BO4 A;  1NF5 B;  2YQJ A;  1ZCU A;  5FYE A;  1R7V A;  1H7L A;  3I0J A;  1LL2 A;  4D11 C;  1PZT A;  3CKO A;  2O1F A;  4KNX A;  4LW6 A;  2AEC A;  1WT2 A;  2W0W A;  1WSZ A;  1S4N A;  3SPT A;  1VIC A;  1QG8 A;  4HO9 A;  3V0Q A;  3I0K A;  4HO8 A;  2ICY A;  1FO9 A;  1O0R A;  2NXV A;  4M4K A;  1NQI B;  2YC3 A;  3F1C A;  3SX7 A;  1ZJ1 A;  4CJC A;  2FFU A;  3U2T A;  2BO7 A;  1JVD A;  3I0F A;  1VM8 A;  4UEG A;  1ZDF A;  5JQQ A;  5HS2 A;  1OMZ A;  1WT0 A;  3IOH A;  2X5Z A;  1LZI A;  3KIA A;  5AJO A;  3OH1 A;  1GA8 A;  1E5K A;  4MND A;  3RMV A;  2RJ4 A;  3CKJ A;  2QKX A;  2V0K A;  4FRM A;  2WEE A;  2JCO A;  1IIN A;  2AM4 A;  5DDV A;  1H5T B;  3D98 A;  4JD0 A;  1O7O A;  4DDZ A;  2PGY A;  5AJN A;  5FU0 A;  1NHE B;  3SX5 A;  3ST8 A;  3I0L A;  1W57 A;  4Y7V A;  5EJZ A;  1FO8 A;  4HO2 A;  5C1L A;  2RJ8 A;  3N9W A;  3OH2 A;  4KQL A;  4JIS A;  4MIX A;  1YP3 A;  3I0D A;  5IDS A;  2RJ6 A;  2AH9 A;  2OI7 A;  4HG6 A;  4Y9X A;  5EJ1 A;  1VZU A;  2YCM A;  3CKQ A;  3CKV A;  3GUE A;  2O1G A;  1VGT A;  2XWN A;  5FV9 A;  2PX7 A;  4B4M A;  3SX3 A;  3V91 A;  4YS8 A;  1GQC A;  1FXJ A;  2AM5 A;  1QWJ A;  1ZJ2 A;  3EE5 A;  4Y7U A;  5FUH A;  1G97 A;  1MP3 A;  4Y6U A;  1H7F A;  4G3Q A;  4EVW A;  3OH4 A;  1VZT A;  2FYC B;  4EEO A;  2JCL A;  2VS4 A;  1G9R A; 
#chains in the Genus database with same CATH homology
 1OQM B;  1ZI5 A;  2C0N A;  3JUK A;  3PKQ A;  2MZB A;  4B4G A;  2RJ9 A;  3V0M A;  1IIM A;  1H5R B;  2XME A;  1SS9 A;  2VSH A;  4AAW A;  2Y4K A;  1LL0 A;  3OAM A;  2VS3 A;  1G2V A;  2P6W A;  1R81 A;  4D48 A;  1EYR A;  5IDT A;  1MP4 A;  1G95 A;  1XZ6 A;  4KT7 A;  2FYB A;  2FYD B;  1R82 A;  1H5T A;  1JYK A;  1S4P A;  1H4C A;  2ZU9 A;  4FIX A;  1NKH B;  1R7U A;  4Y7G A;  1TVY A;  2D7R A;  2J0A A;  4C2S A;  1VZX A;  2WVL A;  4D0T A;  2DPW A;  4KNR A;  1H3M A;  1VH3 A;  1Z90 A;  4O6M A;  2RIY A;  2WE9 A;  1INJ A;  4DEC A;  1W77 A;  4KXO A;  2JCJ A;  3I0C A;  1YP4 A;  1PZY B;  5C3A A;  1HV9 A;  2X60 A;  2Y4J A;  5D92 A;  3SXA A;  2QGI A;  3SXD A;  1HJJ A;  5CQO A;  5I1F A;  3I0I X;  2AM3 A;  3IOI A;  2X5S A;  3U2X A;  2FY7 A;  1TZF A;  2APC A;  2RJ7 A;  2I5E A;  4B5B A;  3U0X A;  2OEF A;  3BCV A;  3R3I A;  1VGW A;  2VFZ A;  1K4V A;  3TZT A;  1KWS A;  4B3U A;  1H5R A;  1ZCV A;  3QVB A;  3ZF8 A;  3E26 A;  5C8R A;  1ZDG A;  3ZGG A;  3FOQ A;  1G1L A;  1HM8 A;  2UX8 A;  1HM0 A;  2FYA A;  4FRH A;  1VPA A;  4B2X A;  2RIX A;  3V0L A;  5L6S A;  2D7I A;  2X65 A;  2YQS A;  4P00 A;  4NAN A;  4XWI A;  1H7T A;  2XWL A;  4HCQ A;  3ZLK A;  1H5S A;  5FTS A;  5C3B A;  4EEM A;  1LVW A;  2VXM A;  1TW1 A;  2YQH A;  1LZ7 A;  1ZI4 A;  2RJ1 A;  4ARW A;  5FTV A;  4EE4 A;  3V0N A;  1EZI A;  3T7N A;  5C1G A;  2I7B A;  5CQN X;  2AE7 A;  4Q7C A;  4FRD A;  5EIY A;  1ZJP A;  1ZIZ A;  3LW6 A;  4M2B A;  2OEG A;  3T7M A;  1S4O A;  2Z86 A;  2V0L A;  2Q4J A;  1WVC A;  3SXG A;  4NAL A;  3CGX A;  5C4F A;  2YQC A;  1H5S C;  4M28 A;  2OI6 A;  3PKP A;  3RSB A;  3SXE A;  2WVK A;  3JUJ A;  5CMI A;  1MC3 A;  1O7Q A;  2P73 A;  2RIZ A;  1TW5 A;  1MP5 A;  1VGZ A;  1I52 A;  1FGG A;  3SXB A;  4O6N A;  1R80 A;  5FU8 A;  3R2W A;  4ZDQ A;  1ON8 A;  1FG5 N;  1JV3 A;  3D8V A;  2YC5 A;  1LZ0 A;  1GQ9 A;  2V0I A;  4CVH A;  3U2W A;  4FCU A;  2FFV A;  1JYL A;  1NMM B;  4M2A A;  4ASY A;  4EE3 A;  3PNN A;  4ECM A;  3F1Y A;  2Y6P A;  1GX4 A;  2QH5 A;  2Z87 A;  5C47 A;  5IFY A;  1FGX A;  1H4D A;  4HO0 A;  4LW3 A;  3OH3 A;  4FQW A;  1W55 A;  2CU2 A;  3HL3 A;  5CMH A;  1G23 A;  4B4B A;  2WAW A;  2RJ5 A;  3DK5 A;  3DUV A;  5C3D A;  4HO4 A;  1G93 A;  2O1H A;  4FRA A;  3OGZ A;  3SXC A;  1FWY A;  1ZHJ A;  2AES A;  4BQH A;  1R7X A;  4D11 A;  1YP2 A;  4CJB A;  1GWV A;  4KRV A;  1GX0 A;  4FRB A;  1G8O A;  3IOJ A;  4MYB A;  1YRO B;  5D91 A;  4HO3 A;  1FOA A;  5BXC A;  1LL3 A;  2V0J A;  2XMH A;  1H7Q A;  2VD4 A;  3K8D A;  3I0E A;  1HM9 A;  3I0G A;  4G87 A;  2ICX A;  4B42 A;  1QGQ A;  3D5N A;  1H7H A;  1VH1 A;  3O3P A;  1JV1 A;  5CQM X;  2VK9 A;  4IRP A;  4E1K A;  4AYJ A;  1FR9 A;  4J18 A;  2WVM A;  2VXL A;  3OC9 A;  4KPX A;  1ZCT A;  4FRQ A;  2ZU8 A;  4HO5 A;  2XWM A;  1VGU A;  1H4E A;  2BO6 A;  2WGZ A;  2YES A;  2RIT A;  3BRK X;  1JVG A;  3V8Z A;  4FRL A;  4Y7T A;  3TQD A;  3Q4S A;  3CKN A;  4AYL A;  5CMJ A;  4Y7F A;  1OMX A;  1LZJ A;  5C49 A;  4G3S A;  5DDT A;  2A8U A;  2OI5 A;  2J0B A;  5C4E A;  4EE5 A;  3Q80 A;  4FIY A;  1G0R A;  1INI A;  4KPZ A;  5J49 A;  3CU0 A;  4L41 C;  2P72 A;  1H7G A;  3Q7U A;  2A8W A;  4BMA A;  2RJ0 A;  3JTJ A;  1H5S D;  3K8E A;  3V8Y A;  1HJL A;  3DJ4 A;  4FRP A;  1V82 A;  3E25 A;  4FRO A;  1ZJO A;  4Y62 A;  3U2U A;  4K6R A;  2W0V A;  1V84 A;  3USR A;  3V0O A;  1ZCY A;  1R7Y A;  2AGD A;  2Y4L A;  2GGQ A;  1ZI1 A;  4R7P A;  2Y4M A;  1WT3 A;  4ASJ A;  4FRE A;  3OH0 A;  3FWW A;  2D0J A;  2E8B A;  4B2W A;  3RMW A;  3ZGF A;  4HO6 A;  5CMF X;  1ON6 A;  5C1H A;  3T7O A;  4HOC A;  5CQL X;  1GWW A;  4NAK A;  4DE7 A;  2JCK A;  2GGO A;  1V83 A;  3U0Y A;  3V0P A;  3U2V A;  5C36 A;  1XHB A;  4FCE A;  1ZI3 A;  4NAI A;  5AJP A;  5C4D A;  2Y7A A;  2PGV A;  5C48 A;  4EEA A;  1G3L A;  5CMG X;  4GBP A;  3OKR A;  1QGS A;  3V90 A;  5C4B A;  3SX8 A;  1FRW A;  4Y64 A;  4CJ8 A;  2VS5 A;  4KC4 A;  5C38 A;  1ZJ0 A;  4AC3 A;  1R7T A;  4Y63 A;  4P02 A;  1NWG B;  1FR8 A;  3I0H A;  3USQ A;  3NGW A;  2BO8 A;  1O23 B;  2I5K A;  2ZU7 A;  5C4C A;  3POL A;  1WT1 A;  2PA4 A;  5CQP A;  4KC1 A;  3ZLL A;  1H7E A;  4G3P A;  4KC2 A;  2V0H A;  4EEG A;  2E3D A;  4D0Z A;  1FXO A;  2VSI A;  1ZJ3 A;  5L6V A;  1FZW A;  4Y6N A;  4IRQ A;  1H5S B;  2BO4 A;  1NF5 B;  2YQJ A;  1ZCU A;  5FYE A;  1R7V A;  1H7L A;  3I0J A;  1LL2 A;  4D11 C;  1PZT A;  3CKO A;  2O1F A;  4KNX A;  4LW6 A;  2AEC A;  1WT2 A;  2W0W A;  1WSZ A;  1S4N A;  3SPT A;  1VIC A;  1QG8 A;  4HO9 A;  3V0Q A;  3I0K A;  4HO8 A;  2ICY A;  1FO9 A;  1O0R A;  2NXV A;  4M4K A;  1NQI B;  2YC3 A;  3F1C A;  3SX7 A;  1ZJ1 A;  4CJC A;  2FFU A;  3U2T A;  2BO7 A;  1JVD A;  3I0F A;  1VM8 A;  4UEG A;  1ZDF A;  5JQQ A;  5HS2 A;  1OMZ A;  1WT0 A;  3IOH A;  2X5Z A;  1LZI A;  3KIA A;  5AJO A;  3OH1 A;  1GA8 A;  1E5K A;  4MND A;  3RMV A;  2RJ4 A;  3CKJ A;  2QKX A;  2V0K A;  4FRM A;  2WEE A;  2JCO A;  1IIN A;  2AM4 A;  5DDV A;  1H5T B;  3D98 A;  4JD0 A;  1O7O A;  4DDZ A;  2PGY A;  5AJN A;  5FU0 A;  1NHE B;  3SX5 A;  3ST8 A;  3I0L A;  1W57 A;  4Y7V A;  5EJZ A;  1FO8 A;  4HO2 A;  5C1L A;  2RJ8 A;  3N9W A;  3OH2 A;  4KQL A;  4JIS A;  4MIX A;  1YP3 A;  3I0D A;  5IDS A;  2RJ6 A;  2AH9 A;  2OI7 A;  4HG6 A;  4Y9X A;  5EJ1 A;  1VZU A;  2YCM A;  3CKQ A;  3CKV A;  3GUE A;  2O1G A;  1VGT A;  2XWN A;  5FV9 A;  2PX7 A;  4B4M A;  3SX3 A;  3V91 A;  4YS8 A;  1GQC A;  1FXJ A;  2AM5 A;  1QWJ A;  1ZJ2 A;  3EE5 A;  4Y7U A;  5FUH A;  1G97 A;  1MP3 A;  4Y6U A;  1H7F A;  4G3Q A;  4EVW A;  3OH4 A;  1VZT A;  2FYC B;  4EEO A;  2JCL A;  2VS4 A;  1G9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...