2RIZA

Unliganded b-specific-1,3-galactosyltransferase g176r mutant (abbb)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
284
structure length
284
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title ABO(H) blood group A and B glycosyltransferases recognize substrate via specific conformational changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 284
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2007-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2rizA00
4Y62A 5AJNA 3SXEA 1FGXA 4FROA 2A8UA 3T7NA 2X65A 5I1FA 4M2AA 4EEOA 1H4CA 3USRA 3CKJA 4KNXA 4FRBA 3R2WA 4EVWA 2ICXA 1G8OA 1FG5N 2WVMA 1H5RA 2OI5A 5CQLX 1H5SC 2FYDB 1QGQA 4Y64A 3Q7UA 1Z90A 4DE7A 1H7EA 2X5SA 2Z86A 3D98A 5C3BA 3R3IA 1GQ9A 4J18A 5J49A 2BO8A 3SX8A 1H3MA 2ICYA 3CKVA 3PNNA 5CMGX 3V8ZA 4EE3A 2I5KA 2OI6A 1GX0A 4R7PA 1LZ0A 2VSIA 3U2TA 2YCMA 1JVDA 4HO9A 1ZJOA 5C48A 2FYAA 2XWMA 2CU2A 2FY7A 2Y4JA 3CU0A 1QG8A 4FCUA 2QKXA 5C4EA 4FRMA 2Y4LA 5CMHA 4C2SA 2XWLA 1INJA 1YROB 3SPTA 5C49A 3LW6A 2XMHA 4G3SA 3OGZA 4FCEA 5C4CA 5C8RA 3TZTA 3ZGFA 2VS3A 1FGGA 5C3AA 5DDTA 4B42A 1HM8A 3I0DA 3POLA 2WVKA 1ZJ1A 1ZCYA 1O0RA 3HL3A 1O7OA 1H5SA 2YQSA 1ON8A 4EE5A 5CQMX 3SX5A 3CKOA 1TZFA 1FO9A 5C47A 1HJJA 2RJ0A 5CQPA 4MNDA 2PGVA 3TQDA 4P02A 3JUKA 3V0QA 5CMJA 4DDZA 1ZIZA 2QGIA 1GWWA 5AJPA 2X5ZA 1TVYA 1H4DA 2RIYA 4JD0A 1G0RA 5C38A 3DUVA 4L41C 3OKRA 1ZI4A 1YP3A 4KPXA 1V82A 3V91A 3OH1A 3T7MA 5DDVA 1S4NA 3Q4SA 2X60A 3D5NA 4KPZA 4AYJA 3DJ4A 4CJCA 1FXOA 1WVCA 2D7RA 1S4PA 3SXBA 1ZI3A 3SX3A 1WT2A 5C4BA 4ARWA 4EEGA 1GQCA 5HS2A 4B2WA 4P00A 1H7HA 5EIYA 4ECMA 2AGDA 4IRQA 3JUJA 4IRPA 4DECA 1JV1A 2YQJA 4E1KA 2FYCB 2V0IA 5FTVA 4KNRA 2XWNA 1JV3A 3I0JA 1H7QA 4HO0A 4KXOA 3RMVA 3ZGGA 1VZUA 3PKQA 2JCJA 2YQCA 1QWJA 5L6SA 1ZCTA 2RITA 5CMFX 3OH4A 1XHBA 2WGZA 1LL0A 3I0CA 4UEGA 4GBPA 4KT7A 4Y7GA 5FU8A 4EEMA 3I0FA 4KQLA 3U0YA 1MP3A 2YC3A 3V0OA 1FZWA 1H5TB 2D0JA 1VPAA 1HJLA 1IIMA 4HOCA 4BQHA 1VZTA 2RJ6A 1GX4A 3ST8A 3U2VA 5C1GA 3ZLKA 1FO8A 2WAWA 1ZJ0A 1MP5A 2GGQA 1O23B 1ON6A 4NAIA 1H4EA 2D7IA 1NKHB 3CGXA 4G3PA 3E26A 2VXMA 5C4FA 1R82A 4CJ8A 4HO8A 4AAWA 2WVLA 1VZXA 1R7XA 1V83A 4B5BA 1LZ7A 4Y7FA 3BRKX 3SXCA 3SXGA 4FREA 1VGUA 1ZHJA 2V0JA 5FUHA 1I52A 1VGZA 1G3LA 2RJ5A 2P73A 3FOQA 2AE7A 5C3DA 1H5SD 1ZJ2A 2RIZA 1H7LA 3O3PA 1FR8A 4Y6NA 1WT3A 2Q4JA 2AM3A 1MP4A 1ZI5A 3SXAA 3U2WA 2ZU7A 4FRAA 1R81A 1G2VA 4LW3A 2GGOA 4D0TA 2RJ7A 2Y4KA 2YQHA 4B4GA 1R7YA 4HO2A 1VGWA 4AC3A 1H7FA 1NMMB 2AECA 2V0KA 4Y7TA 1G97A 3IOIA 5EJ1A 5FV9A 3PKPA 1HM9A 1FR9A 4B3UA 1OQMB 2VFZA 3USQA 3V0NA 2VS5A 1GA8A 2AH9A 2FFUA 4EE4A 3OH0A 5CQNX 1TW1A 1G95A 4NAKA 4FRHA 2WEEA 4M4KA 1MC3A 2YESA 3RMWA 3IOJA 2RJ1A 1ZDFA 3F1CA 1JYLA 3V90A 1TW5A 1W77A 3U2XA 3JTJA 3RSBA 3V0PA 3I0LA 4M28A 2OEGA 5C4DA 2AM4A 2FYBA 3I0GA 2V0HA 2YC5A 2AM5A 4JISA 4ASYA 3I0IX 1NHEB 2E3DA 2NXVA 2VD4A 3BCVA 4Y9XA 1FOAA 3D8VA 4FRLA 4HO4A 4KC2A 4AYLA 4KC4A 1WT1A 3I0EA 1ZCUA 1LVWA 3F1YA 2VS4A 1EZIA 4HO3A 4D0ZA 1H5TA 3NGWA 3Q80A 1JYKA 3E25A 3U0XA 3OAMA 2ZU8A 4D48A 1HM0A 2Y7AA 1W55A 1G93A 2O1HA 2PX7A 4NANA 1YP4A 3OC9A 2I5EA 1FWYA 2FFVA 1R7TA 3OH2A 1VGTA 2JCLA 2VXLA 4FRQA 1O7QA 1QGSA 1ZI1A 3FWWA 2O1GA 1S4OA 1WSZA 1ZCVA 4NALA 3ZLLA 1SS9A 2P6WA 1G23A 1R80A 1H5RB 4FRDA 1INIA 4ASJA 1R7UA 2A8WA 3IOHA 1OMXA 5FTSA 4ZDQA 1G1LA 4B2XA 1YP2A 2E8BA 1HV9A 1XZ6A 3T7OA 5C1LA 2Z87A 5JQQA 1VM8A 1K4VA 4CJBA 1VICA 5IDSA 4YS8A 1W57A 3N9WA 1R7VA 1LZIA 2RJ8A 3I0HA 3ZF8A 4Y7VA 2VSHA 2RJ4A 3I0KA 2BO7A 4FQWA 4Y7UA 2UX8A 3EE5A 1NQIB 3DK5A 1LL2A 1E5KA 2AESA 3QVBA 4CVHA 1V84A 2I7BA 4KRVA 2JCKA 2W0WA 4D11C 3U2UA 5AJOA 5FYEA 2MZBA 1G9RA 1LZJA 4B4BA 1ZDGA 2RIXA 1ZJPA 1FRWA 2BO4A 3SXDA 1H7TA 1H7GA 2PGYA 4K6RA 2OEFA 2QH5A 1OMZA 2W0VA 4KC1A 2ZU9A 2PA4A 1WT0A 2WE9A 3KIAA 2XMEA 2V0LA 4G3QA 5CQOA 2P72A 4HCQA 1H5SB 5C36A 1NF5B 4HO5A 5EJZA 2DPWA 4Y63A 4MYBA 5IFYA 4HG6A 1ZJ3A 4FRPA 3GUEA 1LL3A 4M2BA 3K8DA 5IDTA 1IINA 3OH3A 3CKNA 2BO6A 4G87A 3V0MA 4B4MA 1PZYB 3V8YA 3CKQA 2Y6PA 1FXJA 1JVGA 1KWSA 1VH3A 4Y6UA 3SX7A 2OI7A 5FU0A 4HO6A 4XWIA 1PZTA 4D11A 2O1FA 1GWVA 4BMAA 3K8EA 2JCOA 3V0LA 2Y4MA 4EEAA 5BXCA 5L6VA 1NWGB 2RJ9A 1EYRA 4LW6A 1VH1A 5C1HA 5CMIA 2APCA
chains in the Genus database with same CATH superfamily
4Y62A 5AJNA 3SXEA 1FGXA 4FROA 2A8UA 3T7NA 2X65A 5I1FA 4M2AA 4EEOA 1H4CA 3USRA 3CKJA 4KNXA 4FRBA 3R2WA 4EVWA 4O6NA 2ICXA 1G8OA 1FG5N 2WVMA 1H5RA 2OI5A 5CQLX 1H5SC 2FYDB 1QGQA 4Y64A 3Q7UA 1Z90A 4DE7A 1H7EA 2X5SA 2Z86A 3D98A 5D92A 5C3BA 3R3IA 1GQ9A 4J18A 5J49A 2BO8A 3SX8A 1H3MA 2ICYA 3CKVA 3PNNA 5CMGX 3V8ZA 4EE3A 2I5KA 2OI6A 1GX0A 4R7PA 1LZ0A 2VSIA 3U2TA 2YCMA 1JVDA 4HO9A 1ZJOA 5C48A 2FYAA 2XWMA 2CU2A 2FY7A 2Y4JA 2C0NA 3CU0A 1QG8A 4FCUA 2QKXA 5C4EA 4FRMA 2Y4LA 5CMHA 4C2SA 2XWLA 1INJA 1YROB 3SPTA 5C49A 3LW6A 2XMHA 4G3SA 3OGZA 4FCEA 5C4CA 5C8RA 3TZTA 3ZGFA 2VS3A 1FGGA 5C3AA 5DDTA 4B42A 1HM8A 3I0DA 3POLA 2WVKA 1ZJ1A 1ZCYA 1O0RA 3HL3A 1O7OA 1H5SA 2YQSA 1ON8A 4EE5A 5CQMX 3SX5A 3CKOA 1TZFA 1FO9A 5C47A 1HJJA 2RJ0A 5CQPA 4MNDA 2PGVA 3TQDA 4P02A 3JUKA 3V0QA 5CMJA 4DDZA 1ZIZA 2QGIA 1GWWA 5AJPA 2X5ZA 1TVYA 1H4DA 2RIYA 4JD0A 1G0RA 5C38A 3DUVA 4L41C 3OKRA 1ZI4A 1YP3A 4KPXA 1V82A 3V91A 3OH1A 3T7MA 5DDVA 1S4NA 3Q4SA 2X60A 3D5NA 4KPZA 4AYJA 3DJ4A 4CJCA 1FXOA 1WVCA 2D7RA 1S4PA 3SXBA 1ZI3A 3SX3A 1WT2A 5C4BA 4ARWA 4EEGA 1GQCA 5HS2A 4B2WA 4P00A 1H7HA 5EIYA 4ECMA 2AGDA 4IRQA 3JUJA 4IRPA 4DECA 1JV1A 2YQJA 4E1KA 2FYCB 2V0IA 5FTVA 4KNRA 2XWNA 1JV3A 3I0JA 1H7QA 4HO0A 4KXOA 3RMVA 3ZGGA 1VZUA 3PKQA 2JCJA 2YQCA 1QWJA 5L6SA 1ZCTA 2RITA 5CMFX 3OH4A 1XHBA 2WGZA 1LL0A 3I0CA 4UEGA 4GBPA 4KT7A 4Y7GA 5FU8A 4EEMA 3I0FA 4KQLA 3U0YA 1MP3A 2YC3A 3V0OA 1FZWA 1H5TB 2D0JA 1VPAA 1HJLA 1IIMA 4HOCA 4BQHA 1VZTA 2RJ6A 1GX4A 3ST8A 3U2VA 5C1GA 3ZLKA 1FO8A 2WAWA 1ZJ0A 1MP5A 2GGQA 1O23B 1ON6A 4NAIA 1H4EA 2D7IA 1NKHB 3CGXA 4G3PA 2J0BA 2VXMA 3E26A 5C4FA 1R82A 4CJ8A 4HO8A 4AAWA 2WVLA 1VZXA 4Q7CA 1R7XA 1V83A 4B5BA 1LZ7A 4Y7FA 3BRKX 3SXCA 3SXGA 4FREA 1VGUA 1ZHJA 2V0JA 5FUHA 1I52A 1VGZA 4FIYA 1G3LA 2RJ5A 2P73A 3FOQA 2AE7A 5C3DA 1H5SD 1ZJ2A 2RIZA 1H7LA 3O3PA 1FR8A 4Y6NA 1WT3A 2Q4JA 2AM3A 1MP4A 1ZI5A 3SXAA 3U2WA 2ZU7A 4FRAA 1R81A 1G2VA 4LW3A 2GGOA 4D0TA 2RJ7A 2Y4KA 2YQHA 4B4GA 1R7YA 4HO2A 1VGWA 4AC3A 1H7FA 1NMMB 2AECA 2V0KA 4MIXA 4Y7TA 1G97A 3IOIA 5EJ1A 5FV9A 3PKPA 1HM9A 1FR9A 4B3UA 1OQMB 2VFZA 3USQA 3V0NA 2VS5A 1GA8A 2AH9A 2FFUA 4EE4A 3OH0A 5CQNX 1TW1A 1G95A 4NAKA 4FRHA 2WEEA 4M4KA 1MC3A 2YESA 3RMWA 3IOJA 2RJ1A 1ZDFA 3F1CA 1JYLA 3V90A 1TW5A 1W77A 3U2XA 3JTJA 3RSBA 3V0PA 3I0LA 4M28A 2OEGA 5C4DA 2AM4A 2FYBA 3I0GA 2V0HA 2YC5A 2AM5A 4JISA 4ASYA 3I0IX 1NHEB 2E3DA 2NXVA 2VD4A 3BCVA 4Y9XA 1FOAA 3D8VA 4FRLA 4HO4A 4KC2A 4AYLA 4KC4A 1WT1A 3I0EA 1ZCUA 1LVWA 3F1YA 2VS4A 1EZIA 4HO3A 4D0ZA 1H5TA 3NGWA 3Q80A 1JYKA 3E25A 3U0XA 3OAMA 2ZU8A 4D48A 1HM0A 2Y7AA 1W55A 1G93A 5D91A 2O1HA 2PX7A 4NANA 1YP4A 3OC9A 2I5EA 1FWYA 2FFVA 1R7TA 3OH2A 1VGTA 2JCLA 2VXLA 4FRQA 1O7QA 1QGSA 1ZI1A 3FWWA 2O1GA 2J0AA 1S4OA 1WSZA 1ZCVA 4NALA 3ZLLA 1SS9A 2P6WA 1G23A 1R80A 1H5RB 4FRDA 1INIA 4ASJA 1R7UA 2A8WA 3IOHA 1OMXA 5FTSA 4ZDQA 1G1LA 4B2XA 1YP2A 2E8BA 1HV9A 1XZ6A 3T7OA 5C1LA 2Z87A 5JQQA 1VM8A 1K4VA 4CJBA 1VICA 5IDSA 4YS8A 1W57A 3N9WA 1R7VA 1LZIA 2RJ8A 3I0HA 3ZF8A 4Y7VA 2VSHA 2RJ4A 3I0KA 2BO7A 4FQWA 4Y7UA 2UX8A 3EE5A 1NQIB 3DK5A 1LL2A 1E5KA 2AESA 3QVBA 4CVHA 1V84A 2I7BA 4KRVA 2JCKA 2W0WA 4D11C 3U2UA 5AJOA 5FYEA 2MZBA 1G9RA 1LZJA 4B4BA 1ZDGA 2RIXA 1ZJPA 1FRWA 2BO4A 3SXDA 1H7TA 1H7GA 2PGYA 4K6RA 2OEFA 2QH5A 1OMZA 2W0VA 4KC1A 2ZU9A 2PA4A 1WT0A 2WE9A 3KIAA 4FIXA 2VK9A 2XMEA 2V0LA 4G3QA 5CQOA 2P72A 4HCQA 1H5SB 5C36A 1NF5B 4HO5A 5EJZA 2DPWA 4Y63A 4MYBA 5IFYA 4HG6A 1ZJ3A 4FRPA 3GUEA 1LL3A 4M2BA 3K8DA 5IDTA 1IINA 3OH3A 3CKNA 2BO6A 4G87A 3V0MA 4B4MA 1PZYB 4O6MA 3V8YA 3CKQA 2Y6PA 1FXJA 1JVGA 1KWSA 1VH3A 4Y6UA 3SX7A 2OI7A 5FU0A 4HO6A 4XWIA 1PZTA 4D11A 2O1FA 1GWVA 4BMAA 3K8EA 2JCOA 3V0LA 2Y4MA 4EEAA 5BXCA 5L6VA 1NWGB 2RJ9A 1EYRA 4LW6A 1VH1A 5C1HA 5CMIA 2APCA
chains in the Genus database with same CATH topology
4Y62A 5AJNA 3SXEA 1FGXA 4FROA 2A8UA 3T7NA 2X65A 5I1FA 4M2AA 4EEOA 1H4CA 3USRA 3CKJA 4KNXA 4FRBA 3R2WA 4EVWA 4O6NA 2ICXA 1G8OA 1FG5N 2WVMA 1H5RA 2OI5A 5CQLX 1H5SC 2FYDB 1QGQA 4Y64A 3Q7UA 1Z90A 4DE7A 1H7EA 2X5SA 2Z86A 3D98A 5D92A 5C3BA 3R3IA 1GQ9A 4J18A 5J49A 2BO8A 3SX8A 1H3MA 2ICYA 3CKVA 3PNNA 5CMGX 3V8ZA 4EE3A 2I5KA 2OI6A 1GX0A 4R7PA 1LZ0A 2VSIA 3U2TA 2YCMA 1JVDA 4HO9A 1ZJOA 5C48A 2FYAA 2XWMA 2CU2A 2FY7A 2Y4JA 2C0NA 3CU0A 1QG8A 4FCUA 2QKXA 5C4EA 4FRMA 2Y4LA 5CMHA 4C2SA 2XWLA 1INJA 1YROB 3SPTA 5C49A 3LW6A 2XMHA 4G3SA 3OGZA 4FCEA 5C4CA 5C8RA 3TZTA 3ZGFA 2VS3A 1FGGA 5C3AA 5DDTA 4B42A 1HM8A 3I0DA 3POLA 2WVKA 1ZJ1A 1ZCYA 1O0RA 3HL3A 1O7OA 1H5SA 2YQSA 1ON8A 4EE5A 5CQMX 3SX5A 3CKOA 1TZFA 1FO9A 5C47A 1HJJA 2RJ0A 5CQPA 4MNDA 2PGVA 3TQDA 4P02A 3JUKA 3V0QA 5CMJA 4DDZA 1ZIZA 2QGIA 1GWWA 5AJPA 2X5ZA 1TVYA 1H4DA 2RIYA 4JD0A 1G0RA 5C38A 3DUVA 4L41C 3OKRA 1ZI4A 1YP3A 4KPXA 1V82A 3V91A 3OH1A 3T7MA 5DDVA 1S4NA 3Q4SA 2X60A 3D5NA 4KPZA 4AYJA 3DJ4A 4CJCA 1FXOA 1WVCA 2D7RA 1S4PA 3SXBA 1ZI3A 3SX3A 1WT2A 5C4BA 4ARWA 4EEGA 1GQCA 5HS2A 4B2WA 4P00A 1H7HA 5EIYA 4ECMA 2AGDA 4IRQA 3JUJA 4IRPA 4DECA 1JV1A 2YQJA 4E1KA 2FYCB 2V0IA 5FTVA 4KNRA 2XWNA 1JV3A 3I0JA 1H7QA 4HO0A 4KXOA 3RMVA 3ZGGA 1VZUA 3PKQA 2JCJA 2YQCA 1QWJA 5L6SA 1ZCTA 2RITA 5CMFX 3OH4A 1XHBA 2WGZA 1LL0A 3I0CA 4UEGA 4GBPA 4KT7A 4Y7GA 5FU8A 4EEMA 3I0FA 4KQLA 3U0YA 1MP3A 2YC3A 3V0OA 1FZWA 1H5TB 2D0JA 1VPAA 1HJLA 1IIMA 4HOCA 4BQHA 1VZTA 2RJ6A 1GX4A 3ST8A 3U2VA 5C1GA 3ZLKA 1FO8A 2WAWA 1ZJ0A 1MP5A 2GGQA 1O23B 1ON6A 4NAIA 1H4EA 2D7IA 1NKHB 3CGXA 4G3PA 2J0BA 2VXMA 3E26A 5C4FA 1R82A 4CJ8A 4HO8A 4AAWA 2WVLA 1VZXA 4Q7CA 1R7XA 1V83A 4B5BA 1LZ7A 4Y7FA 3BRKX 3SXCA 3SXGA 4FREA 1VGUA 1ZHJA 2V0JA 5FUHA 1I52A 1VGZA 4FIYA 1G3LA 2RJ5A 2P73A 3FOQA 2AE7A 5C3DA 1H5SD 1ZJ2A 2RIZA 1H7LA 3O3PA 1FR8A 4Y6NA 1WT3A 2Q4JA 2AM3A 1MP4A 1ZI5A 3SXAA 3U2WA 2ZU7A 4FRAA 1R81A 1G2VA 4LW3A 2GGOA 4D0TA 2RJ7A 2Y4KA 2YQHA 4B4GA 1R7YA 4HO2A 1VGWA 4AC3A 1H7FA 1NMMB 2AECA 2V0KA 4MIXA 4Y7TA 1G97A 3IOIA 5EJ1A 5FV9A 3PKPA 1HM9A 1FR9A 4B3UA 1OQMB 2VFZA 3USQA 3V0NA 2VS5A 1GA8A 2AH9A 2FFUA 4EE4A 3OH0A 5CQNX 1TW1A 1G95A 4NAKA 4FRHA 2WEEA 4M4KA 1MC3A 2YESA 3RMWA 3IOJA 2RJ1A 1ZDFA 3F1CA 1JYLA 3V90A 1TW5A 1W77A 3U2XA 3JTJA 3RSBA 3V0PA 3I0LA 4M28A 2OEGA 5C4DA 2AM4A 2FYBA 3I0GA 2V0HA 2YC5A 2AM5A 4JISA 4ASYA 3I0IX 1NHEB 2E3DA 2NXVA 2VD4A 3BCVA 4Y9XA 1FOAA 3D8VA 4FRLA 4HO4A 4KC2A 4AYLA 4KC4A 1WT1A 3I0EA 1ZCUA 1LVWA 3F1YA 2VS4A 1EZIA 4HO3A 4D0ZA 1H5TA 3NGWA 3Q80A 1JYKA 3E25A 3U0XA 3OAMA 2ZU8A 4D48A 1HM0A 2Y7AA 1W55A 1G93A 5D91A 2O1HA 2PX7A 4NANA 1YP4A 3OC9A 2I5EA 1FWYA 2FFVA 1R7TA 3OH2A 1VGTA 2JCLA 2VXLA 4FRQA 1O7QA 1QGSA 1ZI1A 3FWWA 2O1GA 2J0AA 1S4OA 1WSZA 1ZCVA 4NALA 3ZLLA 1SS9A 2P6WA 1G23A 1R80A 1H5RB 4FRDA 1INIA 4ASJA 1R7UA 2A8WA 3IOHA 1OMXA 5FTSA 4ZDQA 1G1LA 4B2XA 1YP2A 2E8BA 1HV9A 1XZ6A 3T7OA 5C1LA 2Z87A 5JQQA 1VM8A 1K4VA 4CJBA 1VICA 5IDSA 4YS8A 1W57A 3N9WA 1R7VA 1LZIA 2RJ8A 3I0HA 3ZF8A 4Y7VA 2VSHA 2RJ4A 3I0KA 2BO7A 4FQWA 4Y7UA 2UX8A 3EE5A 1NQIB 3DK5A 1LL2A 1E5KA 2AESA 3QVBA 4CVHA 1V84A 2I7BA 4KRVA 2JCKA 2W0WA 4D11C 3U2UA 5AJOA 5FYEA 2MZBA 1G9RA 1LZJA 4B4BA 1ZDGA 2RIXA 1ZJPA 1FRWA 2BO4A 3SXDA 1H7TA 1H7GA 2PGYA 4K6RA 2OEFA 2QH5A 1OMZA 2W0VA 4KC1A 2ZU9A 2PA4A 1WT0A 2WE9A 3KIAA 4FIXA 2VK9A 2XMEA 2V0LA 4G3QA 5CQOA 2P72A 4HCQA 1H5SB 5C36A 1NF5B 4HO5A 5EJZA 2DPWA 4Y63A 4MYBA 5IFYA 4HG6A 1ZJ3A 4FRPA 3GUEA 1LL3A 4M2BA 3K8DA 5IDTA 1IINA 3OH3A 3CKNA 2BO6A 4G87A 3V0MA 4B4MA 1PZYB 4O6MA 3V8YA 3CKQA 2Y6PA 1FXJA 1JVGA 1KWSA 1VH3A 4Y6UA 3SX7A 2OI7A 5FU0A 4HO6A 4XWIA 1PZTA 4D11A 2O1FA 1GWVA 4BMAA 3K8EA 2JCOA 3V0LA 2Y4MA 4EEAA 5BXCA 5L6VA 1NWGB 2RJ9A 1EYRA 4LW6A 1VH1A 5C1HA 5CMIA 2APCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y62 A;  5AJN A;  3SXE A;  1FGX A;  4FRO A;  2A8U A;  3T7N A;  2X65 A;  5I1F A;  4M2A A;  4EEO A;  1H4C A;  3USR A;  3CKJ A;  4KNX A;  4FRB A;  3R2W A;  4EVW A;  2ICX A;  1G8O A;  1FG5 N;  2WVM A;  1H5R A;  2OI5 A;  5CQL X;  1H5S C;  2FYD B;  1QGQ A;  4Y64 A;  3Q7U A;  1Z90 A;  4DE7 A;  1H7E A;  2X5S A;  2Z86 A;  3D98 A;  5C3B A;  3R3I A;  1GQ9 A;  4J18 A;  5J49 A;  2BO8 A;  3SX8 A;  1H3M A;  2ICY A;  3CKV A;  3PNN A;  5CMG X;  3V8Z A;  4EE3 A;  2I5K A;  2OI6 A;  1GX0 A;  4R7P A;  1LZ0 A;  2VSI A;  3U2T A;  2YCM A;  1JVD A;  4HO9 A;  1ZJO A;  5C48 A;  2FYA A;  2XWM A;  2CU2 A;  2FY7 A;  2Y4J A;  3CU0 A;  1QG8 A;  4FCU A;  2QKX A;  5C4E A;  4FRM A;  2Y4L A;  5CMH A;  4C2S A;  2XWL A;  1INJ A;  1YRO B;  3SPT A;  5C49 A;  3LW6 A;  2XMH A;  4G3S A;  3OGZ A;  4FCE A;  5C4C A;  5C8R A;  3TZT A;  3ZGF A;  2VS3 A;  1FGG A;  5C3A A;  5DDT A;  4B42 A;  1HM8 A;  3I0D A;  3POL A;  2WVK A;  1ZJ1 A;  1ZCY A;  1O0R A;  3HL3 A;  1O7O A;  1H5S A;  2YQS A;  1ON8 A;  4EE5 A;  5CQM X;  3SX5 A;  3CKO A;  1TZF A;  1FO9 A;  5C47 A;  1HJJ A;  2RJ0 A;  5CQP A;  4MND A;  2PGV A;  3TQD A;  4P02 A;  3JUK A;  3V0Q A;  5CMJ A;  4DDZ A;  1ZIZ A;  2QGI A;  1GWW A;  5AJP A;  2X5Z A;  1TVY A;  1H4D A;  2RIY A;  4JD0 A;  1G0R A;  5C38 A;  3DUV A;  4L41 C;  3OKR A;  1ZI4 A;  1YP3 A;  4KPX A;  1V82 A;  3V91 A;  3OH1 A;  3T7M A;  5DDV A;  1S4N A;  3Q4S A;  2X60 A;  3D5N A;  4KPZ A;  4AYJ A;  3DJ4 A;  4CJC A;  1FXO A;  1WVC A;  2D7R A;  1S4P A;  3SXB A;  1ZI3 A;  3SX3 A;  1WT2 A;  5C4B A;  4ARW A;  4EEG A;  1GQC A;  5HS2 A;  4B2W A;  4P00 A;  1H7H A;  5EIY A;  4ECM A;  2AGD A;  4IRQ A;  3JUJ A;  4IRP A;  4DEC A;  1JV1 A;  2YQJ A;  4E1K A;  2FYC B;  2V0I A;  5FTV A;  4KNR A;  2XWN A;  1JV3 A;  3I0J A;  1H7Q A;  4HO0 A;  4KXO A;  3RMV A;  3ZGG A;  1VZU A;  3PKQ A;  2JCJ A;  2YQC A;  1QWJ A;  5L6S A;  1ZCT A;  2RIT A;  5CMF X;  3OH4 A;  1XHB A;  2WGZ A;  1LL0 A;  3I0C A;  4UEG A;  4GBP A;  4KT7 A;  4Y7G A;  5FU8 A;  4EEM A;  3I0F A;  4KQL A;  3U0Y A;  1MP3 A;  2YC3 A;  3V0O A;  1FZW A;  1H5T B;  2D0J A;  1VPA A;  1HJL A;  1IIM A;  4HOC A;  4BQH A;  1VZT A;  2RJ6 A;  1GX4 A;  3ST8 A;  3U2V A;  5C1G A;  3ZLK A;  1FO8 A;  2WAW A;  1ZJ0 A;  1MP5 A;  2GGQ A;  1O23 B;  1ON6 A;  4NAI A;  1H4E A;  2D7I A;  1NKH B;  3CGX A;  4G3P A;  3E26 A;  2VXM A;  5C4F A;  1R82 A;  4CJ8 A;  4HO8 A;  4AAW A;  2WVL A;  1VZX A;  1R7X A;  1V83 A;  4B5B A;  1LZ7 A;  4Y7F A;  3BRK X;  3SXC A;  3SXG A;  4FRE A;  1VGU A;  1ZHJ A;  2V0J A;  5FUH A;  1I52 A;  1VGZ A;  1G3L A;  2RJ5 A;  2P73 A;  3FOQ A;  2AE7 A;  5C3D A;  1H5S D;  1ZJ2 A;  2RIZ A;  1H7L A;  3O3P A;  1FR8 A;  4Y6N A;  1WT3 A;  2Q4J A;  2AM3 A;  1MP4 A;  1ZI5 A;  3SXA A;  3U2W A;  2ZU7 A;  4FRA A;  1R81 A;  1G2V A;  4LW3 A;  2GGO A;  4D0T A;  2RJ7 A;  2Y4K A;  2YQH A;  4B4G A;  1R7Y A;  4HO2 A;  1VGW A;  4AC3 A;  1H7F A;  1NMM B;  2AEC A;  2V0K A;  4Y7T A;  1G97 A;  3IOI A;  5EJ1 A;  5FV9 A;  3PKP A;  1HM9 A;  1FR9 A;  4B3U A;  1OQM B;  2VFZ A;  3USQ A;  3V0N A;  2VS5 A;  1GA8 A;  2AH9 A;  2FFU A;  4EE4 A;  3OH0 A;  5CQN X;  1TW1 A;  1G95 A;  4NAK A;  4FRH A;  2WEE A;  4M4K A;  1MC3 A;  2YES A;  3RMW A;  3IOJ A;  2RJ1 A;  1ZDF A;  3F1C A;  1JYL A;  3V90 A;  1TW5 A;  1W77 A;  3U2X A;  3JTJ A;  3RSB A;  3V0P A;  3I0L A;  4M28 A;  2OEG A;  5C4D A;  2AM4 A;  2FYB A;  3I0G A;  2V0H A;  2YC5 A;  2AM5 A;  4JIS A;  4ASY A;  3I0I X;  1NHE B;  2E3D A;  2NXV A;  2VD4 A;  3BCV A;  4Y9X A;  1FOA A;  3D8V A;  4FRL A;  4HO4 A;  4KC2 A;  4AYL A;  4KC4 A;  1WT1 A;  3I0E A;  1ZCU A;  1LVW A;  3F1Y A;  2VS4 A;  1EZI A;  4HO3 A;  4D0Z A;  1H5T A;  3NGW A;  3Q80 A;  1JYK A;  3E25 A;  3U0X A;  3OAM A;  2ZU8 A;  4D48 A;  1HM0 A;  2Y7A A;  1W55 A;  1G93 A;  2O1H A;  2PX7 A;  4NAN A;  1YP4 A;  3OC9 A;  2I5E A;  1FWY A;  2FFV A;  1R7T A;  3OH2 A;  1VGT A;  2JCL A;  2VXL A;  4FRQ A;  1O7Q A;  1QGS A;  1ZI1 A;  3FWW A;  2O1G A;  1S4O A;  1WSZ A;  1ZCV A;  4NAL A;  3ZLL A;  1SS9 A;  2P6W A;  1G23 A;  1R80 A;  1H5R B;  4FRD A;  1INI A;  4ASJ A;  1R7U A;  2A8W A;  3IOH A;  1OMX A;  5FTS A;  4ZDQ A;  1G1L A;  4B2X A;  1YP2 A;  2E8B A;  1HV9 A;  1XZ6 A;  3T7O A;  5C1L A;  2Z87 A;  5JQQ A;  1VM8 A;  1K4V A;  4CJB A;  1VIC A;  5IDS A;  4YS8 A;  1W57 A;  3N9W A;  1R7V A;  1LZI A;  2RJ8 A;  3I0H A;  3ZF8 A;  4Y7V A;  2VSH A;  2RJ4 A;  3I0K A;  2BO7 A;  4FQW A;  4Y7U A;  2UX8 A;  3EE5 A;  1NQI B;  3DK5 A;  1LL2 A;  1E5K A;  2AES A;  3QVB A;  4CVH A;  1V84 A;  2I7B A;  4KRV A;  2JCK A;  2W0W A;  4D11 C;  3U2U A;  5AJO A;  5FYE A;  2MZB A;  1G9R A;  1LZJ A;  4B4B A;  1ZDG A;  2RIX A;  1ZJP A;  1FRW A;  2BO4 A;  3SXD A;  1H7T A;  1H7G A;  2PGY A;  4K6R A;  2OEF A;  2QH5 A;  1OMZ A;  2W0V A;  4KC1 A;  2ZU9 A;  2PA4 A;  1WT0 A;  2WE9 A;  3KIA A;  2XME A;  2V0L A;  4G3Q A;  5CQO A;  2P72 A;  4HCQ A;  1H5S B;  5C36 A;  1NF5 B;  4HO5 A;  5EJZ A;  2DPW A;  4Y63 A;  4MYB A;  5IFY A;  4HG6 A;  1ZJ3 A;  4FRP A;  3GUE A;  1LL3 A;  4M2B A;  3K8D A;  5IDT A;  1IIN A;  3OH3 A;  3CKN A;  2BO6 A;  4G87 A;  3V0M A;  4B4M A;  1PZY B;  3V8Y A;  3CKQ A;  2Y6P A;  1FXJ A;  1JVG A;  1KWS A;  1VH3 A;  4Y6U A;  3SX7 A;  2OI7 A;  5FU0 A;  4HO6 A;  4XWI A;  1PZT A;  4D11 A;  2O1F A;  1GWV A;  4BMA A;  3K8E A;  2JCO A;  3V0L A;  2Y4M A;  4EEA A;  5BXC A;  5L6V A;  1NWG B;  2RJ9 A;  1EYR A;  4LW6 A;  1VH1 A;  5C1H A;  5CMI A;  2APC A; 
#chains in the Genus database with same CATH topology
 4Y62 A;  5AJN A;  3SXE A;  1FGX A;  4FRO A;  2A8U A;  3T7N A;  2X65 A;  5I1F A;  4M2A A;  4EEO A;  1H4C A;  3USR A;  3CKJ A;  4KNX A;  4FRB A;  3R2W A;  4EVW A;  4O6N A;  2ICX A;  1G8O A;  1FG5 N;  2WVM A;  1H5R A;  2OI5 A;  5CQL X;  1H5S C;  2FYD B;  1QGQ A;  4Y64 A;  3Q7U A;  1Z90 A;  4DE7 A;  1H7E A;  2X5S A;  2Z86 A;  3D98 A;  5D92 A;  5C3B A;  3R3I A;  1GQ9 A;  4J18 A;  5J49 A;  2BO8 A;  3SX8 A;  1H3M A;  2ICY A;  3CKV A;  3PNN A;  5CMG X;  3V8Z A;  4EE3 A;  2I5K A;  2OI6 A;  1GX0 A;  4R7P A;  1LZ0 A;  2VSI A;  3U2T A;  2YCM A;  1JVD A;  4HO9 A;  1ZJO A;  5C48 A;  2FYA A;  2XWM A;  2CU2 A;  2FY7 A;  2Y4J A;  2C0N A;  3CU0 A;  1QG8 A;  4FCU A;  2QKX A;  5C4E A;  4FRM A;  2Y4L A;  5CMH A;  4C2S A;  2XWL A;  1INJ A;  1YRO B;  3SPT A;  5C49 A;  3LW6 A;  2XMH A;  4G3S A;  3OGZ A;  4FCE A;  5C4C A;  5C8R A;  3TZT A;  3ZGF A;  2VS3 A;  1FGG A;  5C3A A;  5DDT A;  4B42 A;  1HM8 A;  3I0D A;  3POL A;  2WVK A;  1ZJ1 A;  1ZCY A;  1O0R A;  3HL3 A;  1O7O A;  1H5S A;  2YQS A;  1ON8 A;  4EE5 A;  5CQM X;  3SX5 A;  3CKO A;  1TZF A;  1FO9 A;  5C47 A;  1HJJ A;  2RJ0 A;  5CQP A;  4MND A;  2PGV A;  3TQD A;  4P02 A;  3JUK A;  3V0Q A;  5CMJ A;  4DDZ A;  1ZIZ A;  2QGI A;  1GWW A;  5AJP A;  2X5Z A;  1TVY A;  1H4D A;  2RIY A;  4JD0 A;  1G0R A;  5C38 A;  3DUV A;  4L41 C;  3OKR A;  1ZI4 A;  1YP3 A;  4KPX A;  1V82 A;  3V91 A;  3OH1 A;  3T7M A;  5DDV A;  1S4N A;  3Q4S A;  2X60 A;  3D5N A;  4KPZ A;  4AYJ A;  3DJ4 A;  4CJC A;  1FXO A;  1WVC A;  2D7R A;  1S4P A;  3SXB A;  1ZI3 A;  3SX3 A;  1WT2 A;  5C4B A;  4ARW A;  4EEG A;  1GQC A;  5HS2 A;  4B2W A;  4P00 A;  1H7H A;  5EIY A;  4ECM A;  2AGD A;  4IRQ A;  3JUJ A;  4IRP A;  4DEC A;  1JV1 A;  2YQJ A;  4E1K A;  2FYC B;  2V0I A;  5FTV A;  4KNR A;  2XWN A;  1JV3 A;  3I0J A;  1H7Q A;  4HO0 A;  4KXO A;  3RMV A;  3ZGG A;  1VZU A;  3PKQ A;  2JCJ A;  2YQC A;  1QWJ A;  5L6S A;  1ZCT A;  2RIT A;  5CMF X;  3OH4 A;  1XHB A;  2WGZ A;  1LL0 A;  3I0C A;  4UEG A;  4GBP A;  4KT7 A;  4Y7G A;  5FU8 A;  4EEM A;  3I0F A;  4KQL A;  3U0Y A;  1MP3 A;  2YC3 A;  3V0O A;  1FZW A;  1H5T B;  2D0J A;  1VPA A;  1HJL A;  1IIM A;  4HOC A;  4BQH A;  1VZT A;  2RJ6 A;  1GX4 A;  3ST8 A;  3U2V A;  5C1G A;  3ZLK A;  1FO8 A;  2WAW A;  1ZJ0 A;  1MP5 A;  2GGQ A;  1O23 B;  1ON6 A;  4NAI A;  1H4E A;  2D7I A;  1NKH B;  3CGX A;  4G3P A;  2J0B A;  2VXM A;  3E26 A;  5C4F A;  1R82 A;  4CJ8 A;  4HO8 A;  4AAW A;  2WVL A;  1VZX A;  4Q7C A;  1R7X A;  1V83 A;  4B5B A;  1LZ7 A;  4Y7F A;  3BRK X;  3SXC A;  3SXG A;  4FRE A;  1VGU A;  1ZHJ A;  2V0J A;  5FUH A;  1I52 A;  1VGZ A;  4FIY A;  1G3L A;  2RJ5 A;  2P73 A;  3FOQ A;  2AE7 A;  5C3D A;  1H5S D;  1ZJ2 A;  2RIZ A;  1H7L A;  3O3P A;  1FR8 A;  4Y6N A;  1WT3 A;  2Q4J A;  2AM3 A;  1MP4 A;  1ZI5 A;  3SXA A;  3U2W A;  2ZU7 A;  4FRA A;  1R81 A;  1G2V A;  4LW3 A;  2GGO A;  4D0T A;  2RJ7 A;  2Y4K A;  2YQH A;  4B4G A;  1R7Y A;  4HO2 A;  1VGW A;  4AC3 A;  1H7F A;  1NMM B;  2AEC A;  2V0K A;  4MIX A;  4Y7T A;  1G97 A;  3IOI A;  5EJ1 A;  5FV9 A;  3PKP A;  1HM9 A;  1FR9 A;  4B3U A;  1OQM B;  2VFZ A;  3USQ A;  3V0N A;  2VS5 A;  1GA8 A;  2AH9 A;  2FFU A;  4EE4 A;  3OH0 A;  5CQN X;  1TW1 A;  1G95 A;  4NAK A;  4FRH A;  2WEE A;  4M4K A;  1MC3 A;  2YES A;  3RMW A;  3IOJ A;  2RJ1 A;  1ZDF A;  3F1C A;  1JYL A;  3V90 A;  1TW5 A;  1W77 A;  3U2X A;  3JTJ A;  3RSB A;  3V0P A;  3I0L A;  4M28 A;  2OEG A;  5C4D A;  2AM4 A;  2FYB A;  3I0G A;  2V0H A;  2YC5 A;  2AM5 A;  4JIS A;  4ASY A;  3I0I X;  1NHE B;  2E3D A;  2NXV A;  2VD4 A;  3BCV A;  4Y9X A;  1FOA A;  3D8V A;  4FRL A;  4HO4 A;  4KC2 A;  4AYL A;  4KC4 A;  1WT1 A;  3I0E A;  1ZCU A;  1LVW A;  3F1Y A;  2VS4 A;  1EZI A;  4HO3 A;  4D0Z A;  1H5T A;  3NGW A;  3Q80 A;  1JYK A;  3E25 A;  3U0X A;  3OAM A;  2ZU8 A;  4D48 A;  1HM0 A;  2Y7A A;  1W55 A;  1G93 A;  5D91 A;  2O1H A;  2PX7 A;  4NAN A;  1YP4 A;  3OC9 A;  2I5E A;  1FWY A;  2FFV A;  1R7T A;  3OH2 A;  1VGT A;  2JCL A;  2VXL A;  4FRQ A;  1O7Q A;  1QGS A;  1ZI1 A;  3FWW A;  2O1G A;  2J0A A;  1S4O A;  1WSZ A;  1ZCV A;  4NAL A;  3ZLL A;  1SS9 A;  2P6W A;  1G23 A;  1R80 A;  1H5R B;  4FRD A;  1INI A;  4ASJ A;  1R7U A;  2A8W A;  3IOH A;  1OMX A;  5FTS A;  4ZDQ A;  1G1L A;  4B2X A;  1YP2 A;  2E8B A;  1HV9 A;  1XZ6 A;  3T7O A;  5C1L A;  2Z87 A;  5JQQ A;  1VM8 A;  1K4V A;  4CJB A;  1VIC A;  5IDS A;  4YS8 A;  1W57 A;  3N9W A;  1R7V A;  1LZI A;  2RJ8 A;  3I0H A;  3ZF8 A;  4Y7V A;  2VSH A;  2RJ4 A;  3I0K A;  2BO7 A;  4FQW A;  4Y7U A;  2UX8 A;  3EE5 A;  1NQI B;  3DK5 A;  1LL2 A;  1E5K A;  2AES A;  3QVB A;  4CVH A;  1V84 A;  2I7B A;  4KRV A;  2JCK A;  2W0W A;  4D11 C;  3U2U A;  5AJO A;  5FYE A;  2MZB A;  1G9R A;  1LZJ A;  4B4B A;  1ZDG A;  2RIX A;  1ZJP A;  1FRW A;  2BO4 A;  3SXD A;  1H7T A;  1H7G A;  2PGY A;  4K6R A;  2OEF A;  2QH5 A;  1OMZ A;  2W0V A;  4KC1 A;  2ZU9 A;  2PA4 A;  1WT0 A;  2WE9 A;  3KIA A;  4FIX A;  2VK9 A;  2XME A;  2V0L A;  4G3Q A;  5CQO A;  2P72 A;  4HCQ A;  1H5S B;  5C36 A;  1NF5 B;  4HO5 A;  5EJZ A;  2DPW A;  4Y63 A;  4MYB A;  5IFY A;  4HG6 A;  1ZJ3 A;  4FRP A;  3GUE A;  1LL3 A;  4M2B A;  3K8D A;  5IDT A;  1IIN A;  3OH3 A;  3CKN A;  2BO6 A;  4G87 A;  3V0M A;  4B4M A;  1PZY B;  4O6M A;  3V8Y A;  3CKQ A;  2Y6P A;  1FXJ A;  1JVG A;  1KWS A;  1VH3 A;  4Y6U A;  3SX7 A;  2OI7 A;  5FU0 A;  4HO6 A;  4XWI A;  1PZT A;  4D11 A;  2O1F A;  1GWV A;  4BMA A;  3K8E A;  2JCO A;  3V0L A;  2Y4M A;  4EEA A;  5BXC A;  5L6V A;  1NWG B;  2RJ9 A;  1EYR A;  4LW6 A;  1VH1 A;  5C1H A;  5CMI A;  2APC A; 
#chains in the Genus database with same CATH homology
 4Y62 A;  5AJN A;  3SXE A;  1FGX A;  4FRO A;  2A8U A;  3T7N A;  2X65 A;  5I1F A;  4M2A A;  4EEO A;  1H4C A;  3USR A;  3CKJ A;  4KNX A;  4FRB A;  3R2W A;  4EVW A;  4O6N A;  2ICX A;  1G8O A;  1FG5 N;  2WVM A;  1H5R A;  2OI5 A;  5CQL X;  1H5S C;  2FYD B;  1QGQ A;  4Y64 A;  3Q7U A;  1Z90 A;  4DE7 A;  1H7E A;  2X5S A;  2Z86 A;  3D98 A;  5D92 A;  5C3B A;  3R3I A;  1GQ9 A;  4J18 A;  5J49 A;  2BO8 A;  3SX8 A;  1H3M A;  2ICY A;  3CKV A;  3PNN A;  5CMG X;  3V8Z A;  4EE3 A;  2I5K A;  2OI6 A;  1GX0 A;  4R7P A;  1LZ0 A;  2VSI A;  3U2T A;  2YCM A;  1JVD A;  4HO9 A;  1ZJO A;  5C48 A;  2FYA A;  2XWM A;  2CU2 A;  2FY7 A;  2Y4J A;  2C0N A;  3CU0 A;  1QG8 A;  4FCU A;  2QKX A;  5C4E A;  4FRM A;  2Y4L A;  5CMH A;  4C2S A;  2XWL A;  1INJ A;  1YRO B;  3SPT A;  5C49 A;  3LW6 A;  2XMH A;  4G3S A;  3OGZ A;  4FCE A;  5C4C A;  5C8R A;  3TZT A;  3ZGF A;  2VS3 A;  1FGG A;  5C3A A;  5DDT A;  4B42 A;  1HM8 A;  3I0D A;  3POL A;  2WVK A;  1ZJ1 A;  1ZCY A;  1O0R A;  3HL3 A;  1O7O A;  1H5S A;  2YQS A;  1ON8 A;  4EE5 A;  5CQM X;  3SX5 A;  3CKO A;  1TZF A;  1FO9 A;  5C47 A;  1HJJ A;  2RJ0 A;  5CQP A;  4MND A;  2PGV A;  3TQD A;  4P02 A;  3JUK A;  3V0Q A;  5CMJ A;  4DDZ A;  1ZIZ A;  2QGI A;  1GWW A;  5AJP A;  2X5Z A;  1TVY A;  1H4D A;  2RIY A;  4JD0 A;  1G0R A;  5C38 A;  3DUV A;  4L41 C;  3OKR A;  1ZI4 A;  1YP3 A;  4KPX A;  1V82 A;  3V91 A;  3OH1 A;  3T7M A;  5DDV A;  1S4N A;  3Q4S A;  2X60 A;  3D5N A;  4KPZ A;  4AYJ A;  3DJ4 A;  4CJC A;  1FXO A;  1WVC A;  2D7R A;  1S4P A;  3SXB A;  1ZI3 A;  3SX3 A;  1WT2 A;  5C4B A;  4ARW A;  4EEG A;  1GQC A;  5HS2 A;  4B2W A;  4P00 A;  1H7H A;  5EIY A;  4ECM A;  2AGD A;  4IRQ A;  3JUJ A;  4IRP A;  4DEC A;  1JV1 A;  2YQJ A;  4E1K A;  2FYC B;  2V0I A;  5FTV A;  4KNR A;  2XWN A;  1JV3 A;  3I0J A;  1H7Q A;  4HO0 A;  4KXO A;  3RMV A;  3ZGG A;  1VZU A;  3PKQ A;  2JCJ A;  2YQC A;  1QWJ A;  5L6S A;  1ZCT A;  2RIT A;  5CMF X;  3OH4 A;  1XHB A;  2WGZ A;  1LL0 A;  3I0C A;  4UEG A;  4GBP A;  4KT7 A;  4Y7G A;  5FU8 A;  4EEM A;  3I0F A;  4KQL A;  3U0Y A;  1MP3 A;  2YC3 A;  3V0O A;  1FZW A;  1H5T B;  2D0J A;  1VPA A;  1HJL A;  1IIM A;  4HOC A;  4BQH A;  1VZT A;  2RJ6 A;  1GX4 A;  3ST8 A;  3U2V A;  5C1G A;  3ZLK A;  1FO8 A;  2WAW A;  1ZJ0 A;  1MP5 A;  2GGQ A;  1O23 B;  1ON6 A;  4NAI A;  1H4E A;  2D7I A;  1NKH B;  3CGX A;  4G3P A;  2J0B A;  2VXM A;  3E26 A;  5C4F A;  1R82 A;  4CJ8 A;  4HO8 A;  4AAW A;  2WVL A;  1VZX A;  4Q7C A;  1R7X A;  1V83 A;  4B5B A;  1LZ7 A;  4Y7F A;  3BRK X;  3SXC A;  3SXG A;  4FRE A;  1VGU A;  1ZHJ A;  2V0J A;  5FUH A;  1I52 A;  1VGZ A;  4FIY A;  1G3L A;  2RJ5 A;  2P73 A;  3FOQ A;  2AE7 A;  5C3D A;  1H5S D;  1ZJ2 A;  2RIZ A;  1H7L A;  3O3P A;  1FR8 A;  4Y6N A;  1WT3 A;  2Q4J A;  2AM3 A;  1MP4 A;  1ZI5 A;  3SXA A;  3U2W A;  2ZU7 A;  4FRA A;  1R81 A;  1G2V A;  4LW3 A;  2GGO A;  4D0T A;  2RJ7 A;  2Y4K A;  2YQH A;  4B4G A;  1R7Y A;  4HO2 A;  1VGW A;  4AC3 A;  1H7F A;  1NMM B;  2AEC A;  2V0K A;  4MIX A;  4Y7T A;  1G97 A;  3IOI A;  5EJ1 A;  5FV9 A;  3PKP A;  1HM9 A;  1FR9 A;  4B3U A;  1OQM B;  2VFZ A;  3USQ A;  3V0N A;  2VS5 A;  1GA8 A;  2AH9 A;  2FFU A;  4EE4 A;  3OH0 A;  5CQN X;  1TW1 A;  1G95 A;  4NAK A;  4FRH A;  2WEE A;  4M4K A;  1MC3 A;  2YES A;  3RMW A;  3IOJ A;  2RJ1 A;  1ZDF A;  3F1C A;  1JYL A;  3V90 A;  1TW5 A;  1W77 A;  3U2X A;  3JTJ A;  3RSB A;  3V0P A;  3I0L A;  4M28 A;  2OEG A;  5C4D A;  2AM4 A;  2FYB A;  3I0G A;  2V0H A;  2YC5 A;  2AM5 A;  4JIS A;  4ASY A;  3I0I X;  1NHE B;  2E3D A;  2NXV A;  2VD4 A;  3BCV A;  4Y9X A;  1FOA A;  3D8V A;  4FRL A;  4HO4 A;  4KC2 A;  4AYL A;  4KC4 A;  1WT1 A;  3I0E A;  1ZCU A;  1LVW A;  3F1Y A;  2VS4 A;  1EZI A;  4HO3 A;  4D0Z A;  1H5T A;  3NGW A;  3Q80 A;  1JYK A;  3E25 A;  3U0X A;  3OAM A;  2ZU8 A;  4D48 A;  1HM0 A;  2Y7A A;  1W55 A;  1G93 A;  5D91 A;  2O1H A;  2PX7 A;  4NAN A;  1YP4 A;  3OC9 A;  2I5E A;  1FWY A;  2FFV A;  1R7T A;  3OH2 A;  1VGT A;  2JCL A;  2VXL A;  4FRQ A;  1O7Q A;  1QGS A;  1ZI1 A;  3FWW A;  2O1G A;  2J0A A;  1S4O A;  1WSZ A;  1ZCV A;  4NAL A;  3ZLL A;  1SS9 A;  2P6W A;  1G23 A;  1R80 A;  1H5R B;  4FRD A;  1INI A;  4ASJ A;  1R7U A;  2A8W A;  3IOH A;  1OMX A;  5FTS A;  4ZDQ A;  1G1L A;  4B2X A;  1YP2 A;  2E8B A;  1HV9 A;  1XZ6 A;  3T7O A;  5C1L A;  2Z87 A;  5JQQ A;  1VM8 A;  1K4V A;  4CJB A;  1VIC A;  5IDS A;  4YS8 A;  1W57 A;  3N9W A;  1R7V A;  1LZI A;  2RJ8 A;  3I0H A;  3ZF8 A;  4Y7V A;  2VSH A;  2RJ4 A;  3I0K A;  2BO7 A;  4FQW A;  4Y7U A;  2UX8 A;  3EE5 A;  1NQI B;  3DK5 A;  1LL2 A;  1E5K A;  2AES A;  3QVB A;  4CVH A;  1V84 A;  2I7B A;  4KRV A;  2JCK A;  2W0W A;  4D11 C;  3U2U A;  5AJO A;  5FYE A;  2MZB A;  1G9R A;  1LZJ A;  4B4B A;  1ZDG A;  2RIX A;  1ZJP A;  1FRW A;  2BO4 A;  3SXD A;  1H7T A;  1H7G A;  2PGY A;  4K6R A;  2OEF A;  2QH5 A;  1OMZ A;  2W0V A;  4KC1 A;  2ZU9 A;  2PA4 A;  1WT0 A;  2WE9 A;  3KIA A;  4FIX A;  2VK9 A;  2XME A;  2V0L A;  4G3Q A;  5CQO A;  2P72 A;  4HCQ A;  1H5S B;  5C36 A;  1NF5 B;  4HO5 A;  5EJZ A;  2DPW A;  4Y63 A;  4MYB A;  5IFY A;  4HG6 A;  1ZJ3 A;  4FRP A;  3GUE A;  1LL3 A;  4M2B A;  3K8D A;  5IDT A;  1IIN A;  3OH3 A;  3CKN A;  2BO6 A;  4G87 A;  3V0M A;  4B4M A;  1PZY B;  4O6M A;  3V8Y A;  3CKQ A;  2Y6P A;  1FXJ A;  1JVG A;  1KWS A;  1VH3 A;  4Y6U A;  3SX7 A;  2OI7 A;  5FU0 A;  4HO6 A;  4XWI A;  1PZT A;  4D11 A;  2O1F A;  1GWV A;  4BMA A;  3K8E A;  2JCO A;  3V0L A;  2Y4M A;  4EEA A;  5BXC A;  5L6V A;  1NWG B;  2RJ9 A;  1EYR A;  4LW6 A;  1VH1 A;  5C1H A;  5CMI A;  2APC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...