2RJ2A

Crystal structure of the sugar recognizing scf ubiquitin ligase at 1.7 resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
185
structure length
185
Chain Sequence
b'GSHMFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDGNVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution
rcsb
source organism Mus musculus
molecule tags Ligase
total genus 39
structure length 185
sequence length 185
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2rj2A00
3OEAA 1GUIA 3WNOA 1JZ2A 3IDAA 4MADA 1UY1A 3WNKA 4CU9A 2EIDA 3HPNA 2W87A 1SDDB 3OB8A 4CUAA 4ZXEA 3CKHA 4QDSA 5IYYA 3VD7A 1UY0A 2BGOA 3VD4A 3LEGA 3DYPA 3K75B 3GXUA 1OH4A 1UWWA 1TG7A 3K77A 3ACGA 2W1SA 4OMCA 2WAAA 3P1IA 4CU7A 5I0DA 2E26A 2WAOA 4W50A 1LNSA 2J1VA 2YFZA 3OEBA 2J22A 2C4XA 4ET7A 3SEEA 5DMYA 3GDBA 3F2ZA 3T2PA 3LEKA 1PMHX 2BBAA 2VMDA 2ZXQA 4DEVA 2Y8KA 3T2QA 2W91A 4UOJA 3IIIA 2QBXA 5LA2A 4MOAA 3VDCA 4QB1A 3HJRA 4XURA 1OD3A 2B4KA 1PMJX 4JKKA 2QQNA 3MO4A 2JD9A 1W8NA 4ZY9A 2E33A 4KI5M 1OT5A 1UXZA 1O8PA 2VM9A 4XUNA 4OYUA 1O8SA 4MO3M 3K4ZA 4LPLA 2JDAA 5JUVA 2YC4A 3ETPA 4DUVA 1JI6A 2RVAA 3WF1A 1UMIA 4A41A 1GOHA 2WN2A 2EIBA 1J84A 5JMOA 3CQOA 4BDVB 2W47A 2XONA 2WO3A 4KMQA 3HN3A 2VQUA 2QQKA 5FUIA 3CDZB 3I3BA 2VCAA 3WNNA 4QB2A 4OMDA 3GGLA 4ARXA 4ZZ8A 1XPWA 5IFPA 4P08A 3K4DA 2Z4FA 2E31A 5C70A 2V5DA 2VJXA 5B4NA 3WNPA 3FL7A 1UZ0A 4XUQA 4XZUG 2W46A 1OF4A 2W5FA 3ACHA 3HOBA 3ABZA 1H6XA 1EUTA 3OG2A 4LQRA 5LA0A 3C7GA 1UYXA 3C8XA 3FHAA 2V72A 4DUWA 4QDRA 2VZUA 3SEPA 4CU8A 3CZUA 5CZKA 1TVGA 2W1QA 3JXSA 2QQLA 3IAPA 5JR2A 2HYXA 3A22A 4LKSA 4GZ9A 1ULPA 3MUZ1 2VMEA 2VZSA 2W3JA 1US3A 1D7PM 2QQOA 2VZVA 3VD3A 1CZSA 2HLEA 1EUUA 3THDA 2EIEA 1BHGA 2VC9A 3UETA 5IJRA 4YPJA 2ZEWA 4M4RA 2YC2A 2ORZA 1UYYA 5IFTA 3I3DA 5DPNA 1UY4A 5IHRA 4OUEA 1KEXA 2WO1A 1JZ8A 2WZEA 4E8DA 5J1XA 2WZ8A 2CDPA 2WBKA 3J7HA 1JZ4A 2WYSA 2VMFA 4FI9A 2JE8A 3THCA 3MV01 4HG6B 3W5MA 5JXIA 4W8JA 2W92A 4D0QA 3FHQA 2J1SA 1YQ2A 4ZZ5A 1F4AA 1K45A 3NRUA 5JXHA 2YG0A 3OGSA 1PX4A 1K42A 3I2KA 1RYYA 3I2IA 2QQJA 4QX0A 3WQBA 3MBWA 2W9XA 3NJVA 5B4XA 2BGPA 5G04L 5JXGA 3T0BA 3C7EA 2VZ1A 4JKLA 1K12A 4E8CA 3NQHA 4JHZA 2WO2A 2J1UA 4CUCA 3WF0A 1NKGA 4KWUA 3VDAA 2VO5A 1T2XA 3DYMA 2QQMA 2EICA 2OKXA 4AAXA 2Y6KA 5HXMA 1CX1A 2Y6JA 3ZM8A 1HN1A 1F4HA 2Y6LA 2ORXA 4TTGA 3WF3A 2R7EB 1US2A 3CZJA 3T0AA 3I97A 1OF3A 2X10A 2XHNA 2E32A 1W0NA 3C7OA 1R64A 1J83A 1KGYA 2LS6A 2VL4A 4XUPA 5JXJA 2DCKA 4A6OA 3PUIA 4A4AA 2BZDA 4GWJA 1GNYA 3A23A 3T2OA 1DP0A 4XUOA 3ECQA 3E1F1 3K4AA 4PQQA 4DXSA 2W94A 4A45A 2VZPA 2RJ2A 1NX9A 4GWIA 1SHWB 4A44A 1JZ3A 1H6YA 1IQDC 1JU4A 3A7QA 4QPWA 3AC0A 4Z2AA 3SKJE 3C7FA 2VOTA 3WF2A 4P00B 2XOMA 2ID4A 4DXTA 2YFUA 2RV9A 5LCWL 5EJ1B 3WEZA 2VZRA 1O59A 3WNLA 3HNYM 4XVHA 1UMHA 1W99A 3U37A 3OGRA 4PT6A 2LW8A 2ZEYA 5A1AA 3DECA 1JZ7A 4A42A 4QX2A 5C71A 2WDBA 4LHSA 4L0PA 4MGQA 2VCBA 1L7QA 3P6BA 3CMGA 5DN2A 1JHJA 3WF4A 3CIHA 1UY3A 2PQSA 4M4PA 1L7RA 3EB7A 4D8MA 1P8JA 2Y64A 2VZ3A 2DCJA 3NJXA 3I2GA 2WN3A 2W95A 2VQTA 3HNMA 1K3IA 2J7MA 4RYDA 1MPXA 1NUKA 1CIYA 3EYPA 2VZQA 4DUXA 1I5PA 4ARYA 5F7UA 1UYZA 4CVUA 2W1WA 4QB6A 2DDUA 4MGSA 3MUY1 3NNGA 4UAPA 3WSOA 4XUTA 2ZEXA 1W8OA 4BXSV 2Y6GA 2VZOA 5EIYB 2BERA 1UX7A 3MV11 3VD9A 3LQCA 1GMMA 3I2JA 3WNMA 1GOGA 4BJ0A 1XNAA 1DLCA 2J1AA 1WKYA 2Y6HA 1W9SA 1PX3A 3T09A 5CYYA 3I2HA 3I3EA 1XC6A 5DQ0A 4BK5A 1CZTA 3A21A 5EJZB 1JZ5A 2W1UA 3IAQA 4PF1A 3OBAA 2ZEZA 2VCCA 2C9KA 2VR4A 2J1TA 4JX0A 3VDBA 4DXRA 3I2FA 3LE0A 2WUHA 3LEIA 3K46A 4CU6A 3DYOA 3T0DA 3IB3A 4P5YA 4DEQA 3ACFA 3BGAA 4QX3A 2VZTA 1GQPA 3LPFA 5G05L 1JU3A 2C26A 3VD5A 4TXWA 3LPGA 2YB7A 2J1EA 5HPOA 1CZVA 4QDQA 2QQIA 2VTFA 4JKMA 3W5NA 3OGVA 2J1RA 1JYVA 4P02B 2CDOA 4A3ZA 1UY2A 3PUHA 4W4ZA 1XNTA 3D3AA 4IUGA 4QX1A 1W9TA 5LA1A 2B9VA 4CUBA 5C7GA 1JYNA 1WCQA 3T08A 2JKXA 3GM8A 1NAEA 3HEIA 2V4VA 2L9LA 3UNPA 2X09A 4OZOA 2WABA 2KD7A 2VMCA 2WQ8A 1GOFA 1ULOA 1W9WA 2XQXA 3SKVA 3BN6A 1UXXX 4BK4A 4UI9L 1JYWA 3FN9A 4QAWA 1DYOA 4RN5A 1SG3A 3HNBM 1JZ6A 4AG4A 3C7HA 3UESA 3ACIA 2X05A 1JYXA 1GU3A
chains in the Genus database with same CATH superfamily
3ZFGC 4Q4X3 3AMMA 1GUIA 3OEAA 2HWD2 5FYZA 1QXJA 2AR6A 1MZEA 4LR4A 4TLFA 2P34A 1MS9A 3WCRA 2VVFA 5FYMA 2PA7A 1W0PA 5LY1A 3PIGA 4FPKA 2VNRA 3MIHA 1CAXA 4META 1ZRCA 3T4VA 2EIDA 3HPNA 2AENA 4ZHNA 3OB8A 4HVQA 1BBT2 3VKFC 1UY0A 1W9FA 2A3YA 2JIGA 1VBE1 1T6BX 2DU0A 3AMPA 5SV8A 3DL3A 1D2QA 3ZIWA 2VVDA 1CPMA 4Y4YA 5C9AB 2C0ZA 2GMMA 3OOXA 3RYRA 4YM3A 4K3UA 1RINA 3P1IA 2ZJCA 1W8WA 1H8TC 4XJ9A 4QQPA 2UY8A 4IE0A 2VOXA 4FPEA 2WAOA 3RYKA 4LBQB 3VBOA 5CISA 1LAJA 1VBD3 2RDSA 4DOUA 3OUHA 1PO12 2J1VA 4HKWA 2R16A 3N7MA 3ZFEC 3DEMA 1SFPA 2B8MA 4LKDA 3PUAA 5FPAA 3LSDA 4IE6A 4BYYA 1LOCA 5DDJ1 5FO8B 2PXJA 3F2ZA 5FJKA 1AL22 2PHRA 2OXBA 3J7MA 4KG8A 4LULA 5FXXA 3Q8BA 1LOFA 1PMHX 4AAPA 4A7ZA 2F17A 1WLDA 4FT8A 4X6QB 1CN1A 1E57A 2X5IC 2ZAAA 2W91A 4UOJA 1HRI3 1BJQA 3IIIA 1U5IA 3V0AB 4I0BA 3ALQA 5LA2A 4MOAA 1VIWB 1YJKA 4RR3A 2D6MA 4GKYA 3ST7A 1OD3A 1RUE3 3VBUA 1YRZA 2GMEA 4IEVA 5GLTA 3R4UA 2B4KA 3ATGA 3LA7A 1G6NA 2QQNA 3MO4A 1S0JA 4Z2WA 1HXS1 2VPVA 2YU2A 4KI5M 3VUOA 1OT5A 2DFCA 2OT7A 2VM9A 4ZONA 2CAVA 4GJZA 3M8LA 1VB4A 2A75A 3QH7A 2MEV3 4OHXA 5SV5A 1QDOA 1XU2A 2D93A 1HRV3 4XDPA 3H8XA 2JDAA 5JUVA 3BTYA 1NY72 2BVVA 2ZHMA 5I91A 4RSUA 3QCWA 3KQRA 2H6CA 1JW6A 3GALA 3O7OA 2OPKA 5F5QA 2OUJA 3BTXA 3MYXA 4WZFA 3CF6E 1RUJ1 1U5ZA 2JDHA 2W08A 3N7KA 4INDA 3RG0A 3CQOA 4CXWA 3AYCA 1ALYA 4DINB 1DGWA 4FTEA 2XONA 2XB6C 3IDEA 4DY5A 4EJRA 2RHPA 4QWNA 5FZ9A 5ACA2 1C1FA 1AR73 1F35A 2MPFA 1GFF2 3WQ0A 2WNEA 4B4QA 5JSOA 1ASJ3 1MACA 4HOOA 5FKCA 3WG4A 4XIKA 2NMOA 4XJAA 5FRAA 5IUQA 2HWE3 3CU7A 2YROA 4OQ9A 3N7LA 1PO23 2Z4FA 3NW4A 3O5SA 1BVVA 1LULA 3FL7A 3HAGA 3OD0A 5FYBA 3WW2A 4K7JA 1W6QA 2IC1A 3Q9OA 2A1XA 4XF1A 3ZDVA 1EAH2 5FZ4A 1C1LA 3WXPA 3ABZA 1O91A 2FDFA 2F4PA 5L9RA 3R0RA 2XBO3 4PDWC 3C7GA 1IZ3A 2WKKA 4W6YA 4L11A 3C8XA 2D5HA 3VV1A 5CBLA 4YLZA 2ZX1A 1ENRA 1ZBE1 1FPN2 1XNKA 3VZLA 3LOBA 4QDRA 5FWEA 3VZJA 4QPGA 3IPVA 4CU8A 1MEC3 4EN0A 4KBZA 1WGPA 4AQ6A 4I0WB 3M1HA 1S2EA 3IAPA 5JR2A 4ATEA 3PTYA 2R063 3A22A 4AFDA 3N36A 4GZ9A 1OFNA 2VMEA 1GZ9A 2W3JA 2VZSA 4Q4W1 5AC91 2Q8OA 5JVVA 5C4WA 1IHMA 3ON7A 1SCRA 2HLEA 2OQ6A 3OUIA 2PELA 1BHGA 2VC9A 1UX6A 3UETA 4YW4A 1VRH3 2IZWA 1XBFA 3AZZA 5FZOB 4K9SA 2VNGA 5KHIA 1ULGA 2ZEWA 4XBQA 4FXGB 1VLNA 2YC2A 4XJUA 2ZGNA 1RB8G 5GLZA 1GZTA 1KEXA 1TEIA 2GZWA 2OVUA 2WSUA 3LFMA 5J1XA 1WBLA 4JDOA 5CADA 1W8TA 1AHSA 2RS52 3BIWE 2CNAA 5FLHA 5A1FA 2R0HA 2WYSA 3X29B 1V6JA 4E2SA 3O1SA 4HG6B 3D82A 3W5MA 4BH9A 1B35A 4XHXA 2A73B 1SEFA 2IXJA 4W8JA 4CCMA 1TMF2 3I7DA 3QLQA 3WUCA 2A5ZA 1YQ2A 1SFYA 2YBPA 1SPPB 1Y3TA 5CG8A 2P4EA 5HCBA 5LBBA 3I2KA 4AVCA 3PUQA 5CFCB 3FFZA 2DU1A 4QX0A 3WQBA 1XYNA 5H9RA 5F37A 2RMU3 4PCRA 5JXGA 1NA1C 1ZBA1 4Q2FA 4AI1A 1GNZA 3CO2A 1QJX3 2ZMNA 2UWBA 2AREA 1OLRA 3ZX7A 1C4RA 4YGBA 1FI2A 3DXTA 4ES9A 1R1A2 4BQXA 2CY6A 5A3WA 4CUCA 3AVRA 1G8WA 2ZGOA 2GC0A 3LGRA 2BYVE 1PIV1 2RS31 5FY7A 4CP1A 4BWOA 5LEJA 2HH9A 2IFRA 5F9TA 1LU2A 3RZLA 3RZZA 1YFYA 3GHNA 1OC1A 2WL1A 1PK6A 1LECA 3INAA 2OKXA 4AHXA 2Y6KA 4LXLA 4ASKA 1R082 1CX1A 3ZM8A 4GULA 2CL2A 2TEPA 2WR9A 3ASIA 3WF3A 4C1XA 3SCFA 3CZJA 4Q1PA 4YFWA 2ARAA 2KA3A 3C3VA 1ODNA 1OF3A 1XNDA 4GD4A 3T1LA 3O1UA 3RQ0A 3USSA 2XHNA 3O1TA 2V73A 3POGA 4WVMA 4UFJA 5FMBA 2WYFA 2E32A 3C7OA 1R64A 3D5OA 2LS6A 1IKPA 5JXJA 1YCIA 1ZZBA 5DG2A 4EV0A 3ZSJA 1QJFA 3PUIA 3UK9A 3ZYIB 1WMFA 2HWB3 4Q0SA 3J8F2 4GWJA 3H0OA 3A23A 5J48A 5E1RA 3VBRC 4XUOA 4GWMA 4RS5B 1JOJA 1SZBA 2CHHA 3Q8EA 4O61A 4EZHA 4CZSA 1COV2 5D8AA 5CFCC 1NX9A 3POYA 4FTBA 2GP3A 3I2OA 1FPN1 1JZ3A 1BYHA 4WVWA 1IQDC 3VBHB 1HRV2 3AC0A 2OX0A 2P3IA 2PTMA 4BHPA 5A33B 2GNTA 3MHZA 3WW4A 1GKBA 3AKSA 2RV9A 2AGSA 2QJVA 5EJ1B 4BQ1A 1OA4A 2VZRA 1O59A 2RJLA 3WNLA 1V6IA 1W06A 4B3NA 4CEYB 2F6BA 3HNYM 4XVHA 2BNMA 2XKPA 3M7AA 2ES3A 4S2HA 5FWJA 1BXHA 2B46X 2XLAA 3M3CA 4IL7A 1BQPA 1QDCA 4PT6A 1UNBA 3AZXA 3ZXGA 3EJKA 1W6OA 3KWVA 3MI8A 4QX2A 3JB4C 1OH3A 2WDBA 4L0PA 4UT5A 4LBOA 5BYNA 4YG6A 4NJ4A 5HV4A 4AVVA 3P6BA 1QH7A 3ZSKA 1CESA 4Y1XA 4D6QA 3WF4A 3CIHA 1PGSA 2E7AA 4LLFA 3FX3A 4NRPA 1WLTA 5FYTA 2KR2A 4BZ4A 1GP6A 4M4PA 3TEZA 5HBAA 2JG8B 1RUC1 1HW5A 2QNKA 3RI9A 1UPIA 4BMEA 3VL9A 1JTZX 1NA1A 4RS5C 1Z7S2 3M2MA 2XUMA 1JUHA 3I2GA 1Q3EA 3VLBB 2D5FA 5JPMB 2NN8A 3HQRA 5HXVA 5A3PA 4KBBA 5D2AA 3UKNA 2FCUA 4I3GA 1POV0 2DUQA 2VNVA 4EWEA 2XBO2 1KS4A 4UW6A 5HCHA 5FFOC 1MPXA 3ZMNA 1NUKA 1CIYA 2VUAA 3MDPA 1I5PA 1W2AX 4K40A 1GSLA 1UYZA 4HK8A 4XETA 3LAGA 3IDBB 1S0IA 4NPLA 2E53A 1CAUB 4LO6B 3APBA 3ZDSA 2XWJB 3AKPA 1U12A 2OZJA 3T3YA 1S4CA 1S0EA 4CEYC 2WWUA 2FCVA 4CP9B 3J9SA 1DZTA 4KWKA 1PGW2 1W6NB 1QU0A 1VBD1 3KV4A 1HDKA 5C5TA 4NIIA 4MXWB 5J09A 5EZWA 4TLGA 4YZ1A 5F3IA 4NIAA 4IV1B 3WDWA 4H14A 3DPRC 5EIYB 4PJYA 3MV11 1UZYA 1GMMA 4NE9A 1RUH2 4XF3A 5FMDA 2Q4SA 1W6MA 1UAIA 4GH4A 1DLCA 1AZDA 1H1AA 4QGLA 4PIXA 1SLIA 4RFT0 4XDOA 3FLTA 3VBRA 3LKJA 5FIXA 1FX5A 3PLQA 1C28A 3SHRA 3WR0A 5GZEA 1XQNA 2JG8C 2QQVA 1HRI1 1B09A 1QJY3 4WV8A 1CZTA 4OHWA 2W1UA 3OSDA 3K3OA 1TZOA 2ZEZA 1PZ9A 1RUE1 1D0HA 2QDRA 1ND3A 2PLV3 4AFCA 5I8SA 4CTEA 5BUVA 3IMNA 3JQWA 2VULA 5A7WA 5A7SA 4DXRA 3ZYRA 3I2FA 4M3CB 3RMYA 4CDWA 1Y9QA 2WJSA 2WUHA 4YVSC 1G9AA 1BK0A 3I8TA 5T5JA 2GU9A 2XR4A 4FVVA 2MEV1 1PVXA 4P5HA 3BODA 1HRV1 1KQRA 2ADDA 1DFQA 1DQ2A 3OUJA 4FO9A 1S0BA 1CONA 1IOAA 2ZOEB 3K2OA 1DCSA 4P5YA 5A80A 1TQ5A 3ZN6A 3P3NA 2VZTA 4LBLA 4XTPA 4QGNA 4HSJA 2P2KA 3L2YA 4R52A 4XABA 3ZSEA 5F39A 2Z5WA 1NCRB 5DUUA 2XHKA 4HBNA 2WNVC 4NOTA 4IV1C 1IQAA 2C26A 1RUJ3 3VD5A 1RXGA 4TN7A 4MUVA 1L3JA 3ZR5A 1Y9MA 1FOD3 4K1ZA 5H9QA 1I3HA 4GALA 1T6GC 1AR71 3KGLA 5HPOA 1VMHA 1GWMA 1VP6A 3M70A 4Y20B 5A3LA 2E7QA 3WDXA 1ASJ1 5J7MA 3OGVA 2J1RA 3TNQA 4P9IA 2ARBA 4LIUA 4PBOA 5A3OA 1ZA4A 2XJTA 1ZX5A 4QKDA 5FY5A 2H6BA 2HWE1 2DVAA 2ZKNA 5FUPA 4R9DA 2TUNA 4JRLA 1PO21 2IFWA 3PU3A 4Q8LA 3IBMA 4QHBA 4DY3A 1XSRA 3WZ1A 5LA1A 2O1QA 2B9VA 2Z42A 2HWD3 1RUOA 5CKNA 2HWB2 3KV9A 2CWMA 3ZFFA 1MVEA 5APAA 3O1RA 5FQ0A 2A6WA 2JKXA 3ITQA 4NIHA 1YC61 2XBO1 2V4VA 1J1TA 3HBZA 1OD5A 5GZDA 4OZOA 5FZ3A 1BBT3 2A7AA 2WQ8A 2G4IA 3MW4A 4IEXA 3WDYA 4ATFA 3N9PA 1C57A 3ZN5A 5A6QA 5FY0A 5C3QA 4NROA 1W8UA 4H3WA 2VGDA 2SLIA 2ZACA 1MEC1 5HI0A 3RRDA 4BU2A 1UOBA 3TNPB 4MG2A 1UXXX 1NCRC 1RUD3 2HWC3 1HJFA 3DXUA 1OQDA 2FZ2A 2YZ4A 4QAWA 1SG3A 5BNOC 5FPUA 2JIJA 1JYTA 3GNEA 4S2FA 5F6LB 1GR3A 3Q8CA 4LKEA 2B9UA 2Y0IA 2YY1A 2FDKA 4EN8B 1O4YA 5CIRA 2VCMA 2X05A 3H8UA 1PO13 3WP6A 3NV3A 4GQ7A 2XUEA 1GP4A 3JZVA 4ZU7A 2UURA 2E63A 1VRH1 2I07B 3POWA 5LRSA 5FZ0A 5ABJB 3IM0A 4MADA 4HT1T 5FY1A 1UY1A 4MXVA 5JZGB 1AL23 3KCYA 5CNAA 1TNRA 3MLJA 1OKOA 5JOWA 1H2MA 1SDDB 4YVSA 3POFA 5EPAA 5IYYA 1KXGA 3VD7A 1RVF2 2GH2A 2JXAA 4OI0A 4GB32 3DYPA 1EP0A 1D4M2 1DZQA 1OQ1A 1UOJA 1V00A 2G9GA 1TG7A 4XE9A 5DAXA 3K77A 5F2SA 5BNNA 2NZ9A 3VN4A 3KVBA 4JGZB 2JD4A 1NG0A 4AWDA 1MQTA 1IS5A 2E26A 2YPJA 2H0VA 2ILMA 2VUCA 2WA4A 4FOQA 2XL7A 3U10A 4XXAA 3WQ7A 4W50A 4LLOA 3U07A 5DAWA 2X53S 4Y5SA 2J22A 5FYHA 5F6KA 3SEEA 2QZ2A 4E4DX 5EP9A 1QJX1 2VD7A 4LUKA 2LROA 2V09A 2BFUS 1LRHA 3IWZA 4HSLA 3T2PA 2BBAA 2Y60A 3URFA 2Q30A 2GSYA 2Y8KA 3PIJA 1HQLA 2LUWA 1YI7A 4R4XA 4AEDA 3H8RA 2ZX3A 2QBXA 1OFSA 4LJHA 2ZPXA 1DGWX 2KXLA 3ES4A 4GA9A 2GC1A 3HJRA 4PF5A 4AEDB 4JTOA 2Y33A 2J42A 2DTWA 4HN1A 4UFHA 4DMIA 5ABJC 3NAPB 5JZGC 5ACA3 4XCBA 1QIQA 2ZCWA 2JKBA 4LORA 3HMYA 4JZRA 2XQRA 1W8NA 2FMYA 2RS12 5L7OB 1NCQB 3NJZA 4RGAA 1UXZA 1O8PA 4YFZA 3O1OA 3ZN4A 4BLJA 4MGYE 1O8SA 1UKGA 1QF3A 3OF1A 2R49A 4MO3M 1MS3A 1QJY2 1GBGA 2ZKLA 4XJWA 2IVJA 4OI2A 3OY8A 1FMD3 3WVJA 4QPIC 5EYYA 4DUVA 1G9DA 4JGZC 5FYSA 4IV3A 2HWB1 4COUA 1GOHA 2PLV2 1XYOA 4PLOA 5CU1A 1EAH3 2EIBA 1SBFA 2BWAA 3A0KA 3GCWA 4JHTA 5JMOA 1GICA 5FP9A 4Z8BA 1AR92 3DCQA 1IKQA 3ZVXA 4LMFA 3WT3A 4KMQA 4B7KA 3M4FA 2FDJA 1ST8A 5A6ZA 1NXMA 1Y9GA 4COWA 1N3OA 1V0AA 2X8KA 3AKQA 2D6PA 1W2OA 1AX2A 4OFGA 4Q0QA 1LR5A 1W39A 2PQQA 3CDZB 4PQ9A 5ISLA 2MHFA 1JXNA 3BCWA 4UBHA 4Q5OA 4YW2A 5JAXA 3MIDA 4WM8A 4QHOA 3WNNA 1L7LA 5JOYA 1Y43B 3GGLA 4OMDA 1XOYA 3ETQA 4L2NA 1RJ7A 1XPWA 4LBMA 3PMSA 2Z2SB 3JU9A 3NAPC 1CD3G 2I74A 3WNPA 2PAMA 5B4NA 1G9BA 1FOD2 1VBC2 1W3XA 1QKQA 1WWYA 2XMLA 5L7OC 4HN0A 4OHVA 2IWGB 1AYN2 1NCQC 1VPHA 3B01A 4PBPA 4XF4A 4G9SB 1H6XA 1LOBA 1VRBA 1QJU3 2JENA 4YW3A 2AACA 2XPJA 1XNCA 4OHZA 4XTMA 5LY2A 3OG2A 3AK0A 4BISA 4BIOA 5LA0A 1GYKA 3VZMA 2WNOA 1SACA 2OIIA 1F9KA 4AFBA 2OS2A 2Z79A 5CKQA 2RS53 3PVBB 2QVSB 2BDRA 3CJIC 3CZUA 2VTXA 1F31A 3U14A 3DV8A 4QQ2A 2W1QA 4DFSA 1X9TA 5BV6A 2PN5A 2CGOA 1RJ8A 3JXSA 3PU8A 4YVWC 1TMF3 2QQLA 3BPSA 5K8SA 1LTEA 1XE0A 1IGOA 3HN1A 3N35A 4BQ3A 2Q5TA 4LOSA 3UYJA 1ULPA 1RXFA 1GQGA 3MUZ1 4W65A 5IVFA 2CSGA 1PVC3 1V9U2 4UFLA 2WLPA 3SXWA 2QQOA 1RC6A 2VZVA 5FO9B 1CZSA 1UF2C 4FPFA 5C8CC 1EUUA 5F3GA 2R0FA 2EIEA 3TWIA 5IT6A 4I2OA 1WA6X 3ELNA 4XZPA 2R072 3TAYA 5IJRA 4YPJA 5FZHA 3USUA 4E27A 5I0SA 1RUD2 1UY4A 2HWC2 2XG3A 1JZ8A 1O6UA 2WZEA 2FZ1A 3RMXA 1R1A3 2EA7A 2YU1A 3HD8B 4XFAA 3TYJA 4EWDA 1ODMA 2ZGSA 2D40A 2ZX0A 4NRMA 1QEXA 3NMBA 4PI0A 3PNAA 4XF9A 5FZ8A 1RGSA 3WG3A 4UYBA 1LESA 4FI9A 4LK7A 4C0BA 4QPIA 5C3OA 4LBJA 1CIWA 2RS11 1R083 1STMA 1SBDA 2W92A 3B9IA 3ZXAC 2J1SA 3BOWA 2BJSA 3ES1A 3EO6A 2G9ZA 3EQEA 3RZJA 3B93A 4AGRA 3IT8A 1LJ7A 5EHDA 3POEA 1EY2A 4TZDA 2WIIB 5LZ6A 1QJY1 1RYYA 3DKQA 1QNYA 1SLTA 1WCDJ 2QQJA 2Y26A 2YPDA 3C2UA 3KZ4C 5IVJA 4CRQA 1U0AA 5B4XA 4NHXA 5G04L 3T0BA 2PLV1 3MFAA 1AYM3 2JB4A 4LO8A 4JKLA 1U5XA 3WP3A 2W39A 1PHMA 2X29A 1YXWA 5LK7B 3J8F3 5F3CA 1QJEA 3BKZA 3FC0A 3WF0A 2B45X 1NKGA 3JBG3 5FBZA 4UWDA 4KWUA 3VDAA 3IIAA 3ZXDA 1COV3 3S57A 1C5HA 4XW3A 4MSVA 1EYBA 1T2XA 1OKQA 2PYTA 1MZ5A 2QQMA 4CUGA 2XXZA 1W28A 3MW2A 3OPTA 5GZCA 5HXMA 4HPKA 5FZGA 2FMDA 1RUG3 3WG2A 4RQPB 2ZZJA 3NVCA 1DYKA 5C9AC 4TTGA 2R7EB 1US2A 4MHRA 1V6LA 1BCXA 3NO8A 4U2AA 2NP0A 3OBRA 3V0BA 2X10A 3H1YA 3L2HA 3VB9A 3ZKYA 4B4PA 2K9ZA 1KFUL 4S2DA 5EWSA 2ZGRA 1UO9A 4URAA 3H8OA 4C90A 1UMZA 4XPVA 2NM1A 1FOD1 4IE5A 5FOJB 4A6OA 1JS9A 2BW8A 4KU8A 1UL9A 2DBNA 5KWRA 4LE4A 3POIA 3CJIA 4X6RB 1GNYA 1RMU2 1OUSA 4N9IA 4BQ5A 2WT0A 3ZFGA 3E1F1 5LB6A 4AYUA 1CAVB 2Y0OA 4JGYB 1X9PA 2RJ2A 4IEUA 2D3RA 2NYYA 2DVGA 3H50A 4HVRA 4A44A 4K6BA 4EWAA 2I45A 1H6YA 2D44A 1YQ5A 5EV7A 1JU4A 3GZTB 4NVPA 1DDLA 4X8PA 2RJKA 4NIGA 3O12A 1BEV2 4Y1VA 1FMD2 2W52A 3N9LA 3AM2A 2VOTA 4FCAA 5FZLA 4Z2AA 1Y7BA 1I1EA 1Q8SA 2HWD1 4P00B 1W6PA 3W21A 3I59A 5LCWL 1RUF2 1Z7S3 5J37A 3WEZA 5AVAA 2Q1ZB 5LA9A 4LA2A 5J3UA 1LHOA 4XC9A 2BTVC 1H8TA 1JBCA 1BBT1 3OGRA 3UJOA 1GZCA 5FTTC 3ZIXA 5A1AA 4XMIA 1ZZ7A 1S55A 4IEYA 4RQPC 3BOPA 4AHYA 1LHVA 1JZ7A 4Y22A 1VJ2A 4LHSA 2ZZQA 4MGQA 2FQPA 1N3PA 3V65A 4M3CE 5IW0A 3ZFEA 3OYWA 1RUD1 2HWC1 4D7YA 1ZZ6A 2V5YA 5FK7A 1JHJA 1OHFA 1UY3A 1N3QA 1MR5A 3KMHA 1VBA2 1WMDA 3LD8A 2QQPA 2IVIB 4NHMA 2X5IA 5K9YA 2P6HA 1PO11 1KJLA 5KXEA 3NWKA 1H1MA 1LOGA 1D2SA 5JI7A 3ILNA 3I3MA 1TME2 2ZABA 4ZU4A 1RUH3 1SBEA 3RI8A 1AR62 3WHUA 1AL21 3AYDA 3PVOA 2A71A 3FFQA 3NNLA 1WW7A 3WD5A 5B2GB 2IXHA 2P37A 1OQEA 1QJU2 4KG0A 2YBSA 3MIBA 4QKFA 3N9MA 1UZWA 3JB8A 1OOPB 3EYPA 1POV3 1O5LA 2VZQA 2WWJA 3JD72 4DUXA 4MV2A 4CVUA 1HX6A 2WQZC 4AI3A 3IKWA 4X8NA 4CCLA 5AVPA 3LFIA 1NE4A 2YC0A 4QB6A 4CCJA 2E6VA 5C9AA 3O1VA 2ZA9A 4XUTA 4P9YA 4FPJA 4ES8A 4IGPA 4ONUA 1E5SA 3ZSMA 4LBQA 3H1WA 4AW7A 2XJQA 2NMNA 1PVC2 4M01A 5EXOA 1X8MA 4XJZA 1YYNA 2BERA 3LQCA 3I2JA 3SCHA 1YEWA 4I0AA 3RPQA 4BJ0A 1NY71 1XSQA 4MVTA 4R8HA 2YGMA 2HBUA 4JV4A 4E4HA 1W9SA 4OI1A 3TEWA 1SMVA 1XU1A 4D6SA 3T09A 1UW8A 5CYYA 2WT1A 1GV9A 3I2HA 4AXOA 1W6MB 4YZ3A 2YYOA 5EJZB 3PUSA 1QOOA 5FYCA 1QGLA 2VU9A 3HBKA 5FP4A 4FPYA 1ZM1A 3AP6A 3OBAA 3V0AA 2WRAA 1SLLA 5ACA1 5JI9A 2DFBA 1Z78A 2J1TA 2RE9A 3PJQA 5FP3A 3EHKA 3VDBA 2H0BA 2XLFA 5T5LA 4EN7B 5FK8A 1H30A 1OOPC 4N8MA 1BZWA 2BUKA 3GBWA 5EYXA 3OCPA 1UZVA 3VBFB 4M3CF 1BEV1 1FMD1 4PDWA 2WO7A 4A6SA 1UIKA 4Q4Y2 1PMIA 4Q0VA 3ACFA 4CDXB 3BGAA 3EBRA 4DEQA 5C3PA 4QX3A 4CA9A 1AVBA 4Z07A 1JHNA 3N9NA 4D3WA 1AYM2 5IK8A 1GQPA 3AZYA 4ZU5A 1VR3A 1EAH1 2W2IA 3E5XA 1N1VA 2HWF3 4YSFA 5E88A 2WNUB 3TB0A 3AB0A 4XDQA 1ND2B 1UCXA 4DZGA 4MYEA 4QM8A 3JBG2 1JMUB 4TXWA 4AVBA 4NR1A 3PVEA 4YGDA 2XVKA 1URXA 1VBB2 3KLSA 5CFDB 3RNSA 4OI4A 2J1EA 1J3RA 5T5OA 1WLWA 5GM0A 1RUG2 4JKMA 2AZ5A 5FMOL 3HVDA 2ERFA 2QKDA 1SLBA 2LTNA 1JYVA 1HN0A 3BVCA 4OZXA 4WM7B 3P5BA 1VBA1 1UY2A 4R9AA 4BMBA 4M0HA 1XNTA 5BNQA 3ILRA 5L9VA 3IN9A 3WX5A 2JG9B 3LA2A 3GZEA 1VB2A 4H7MA 3RYPA 1GP5A 2BNNA 3HWJA 4QX1A 3RZGA 3SC7X 1W2TA 2F4LA 1RL3A 5IVBA 4N43B 2PHXA 3KT1A 1AR61 3ZXFA 5C7GA 4OUMA 3T08A 2AUYA 1O7FA 4A7KA 3GYDA 1QJU1 1YQCA 4JTNA 1OUXA 3GM8A 2KM2A 1DHKB 3HEIA 5FZIA 3LDBA 1H2NA 3VBFC 2NQYA 1BKZA 1KDMA 2VMCA 4Q8KA 4XJ8A 3GZAA 1RVF3 2A3XA 5FPVA 4CDXC 4GB33 1ULOA 2RS51 5FQ0B 3ZYBA 4CDUB 2OA2A 2XQXA 2WS93 3CBNA 1D4M3 3QBQA 4IXLA 2VH9A 4QGMA 3SKVA 3ENRA 5JSRA 1W05A 3N3HA 4JAAA 4LO4B 1WCSA 1K5MB 2P6CA 3POJA 1TMF1 2WNUC 3UL2A 1ENQA 1KFXL 3FBMA 4UI9L 3ZXEA 1JYWA 4D7TA 4AI0A 3PJYA 5BPXA 1ND2C 4CCCA 1ZRFA 1DYOA 5A1LA 1XB9A 1HQWA 5F2WA 1PVC1 3TN92 4AG4A 1IG0A 3C7HA 3RWKX 1U5YA 5CFDC 2YHJA 3VDDB 3BI3A 5FP7A 1HLCA 1JYXA 1GU3A 4JVAA 3VBHC 3OPWA 3AJYA 1YJLA 1Q8QA 4LK6A 4CE8A 1SLCA 2DUOA 3VHRA 5FZ6A 1H1IA 3LA3A 2ZGQA 5DAQA 4WM7C 5A6XA 2GC2A 3TEXA 2WFF2 3QACA 1G7YA 2D7FA 4CU9A 3VHNA 5C6CA 4CCKA 5FZOA 4AOCA 4AZZA 3M3IA 3MLLA 1BVP1 1H4HA 1R1A1 3MFCA 2EAKA 3CKHA 5DG1A 4N9HA 4MGIE 2BGOA 3VD4A 4AFAA 1MZFA 4BQYA 4AVAA 1DYPA 3K75B 3KGZA 3GXUA 4N43C 4C8DA 1OH4A 4Y24A 2JDNA 1QQP2 3AKRA 2VG9A 3ACGA 3BU0A 4N90A 1R081 2W1SA 3GJAA 2WAAA 4QMAA 4CU7A 5F5IA 1EPWA 2RS13 2BU9A 3AVSA 5JIAA 4GAZA 3WCSA 3I4IA 4MX3A 3GJBA 2WSVA 1SPPA 4N7UA 4Y3OA 1LNSA 2Z69A 4XBNA 1YIPA 2IXLA 1NQDA 4CDUC 3OEBA 2C4XA 4E2GA 4ET7A 5DMYA 2BOJA 5CFCA 5LBEA 1DQ4A 5FY9A 1K5MC 1O5UA 2DWRA 5LEKA 1AYM1 3KCXA 3KD4A 2JEMA 3EXUA 4V2VA 3SH5A 2ZHKA 3LEKA 3J8F1 4NAOA 2VMDA 2BEOA 3WW1A 4DEVA 5D21A 2RDNA 4OVEA 4HONA 3T2QA 2B7YA 3VDDC 3ZXJA 3JBG1 3RGBA 3TOJA 1COV1 3KCCA 1AR93 3BTAA 4QXHA 1QOSA 3WDVA 4QB1A 3LWCA 2A70A 1XXNA 1NLSA 2JB8A 1I5ZA 2RG4A 3H1MA 4FP3A 2ZMKA 4XURA 1OSGA 4O9GA 4QX5A 3ZR6A 2VOVA 5DUVA 1NZIA 1RUG1 2OPWA 3UKTA 1PMJX 2WQ4A 3AP4A 3PHMA 5T54A 2AH2A 5FP8A 2HEWF 3MF6A 4CDQB 2JD9A 4EQVA 4ZY9A 1REDA 2VW0A 3N9OA 3MPPG 4AE2A 2GH8A 5I8TA 4OCTA 4BQ4A 1UU5A 1AJOA 1QOTA 4URTA 2GNBA 1CJPA 4B1MA 5LBCA 1FT9A 4QXKA 1YFXA 2VECA 4OYUA 4AGGA 1X33A 1LENA 3FHIB 3JQXA 4P9GA 3K4ZA 4AL9A 2RM23 4LPLA 4PLNA 5FZKA 2BOIA 5IK4A 3BUCA 4JDNA 3ETPA 1JODA 4LHKA 1JI6A 4AFMA 4Q4V2 4LBNA 2RVAA 5F8PA 3WF1A 1UMIA 2HYKA 1VBC3 4A41A 3J26N 3UJQA 1AYN3 4WZCA 3LIGA 1JYIA 1E5RA 2A6XA 3MIFA 4COYA 1CAWB 4XILA 4FPHA 1O3RA 4RS5A 4BDVB 4XIOA 3ZYHA 4CEWB 4XCAA 1REFA 3AL6A 3NV4A 4YWAA 4AI8A 5JDBA 1SQ4A 3D6EA 2VUDA 3J7NA 1LCLA 2BGCA 4LKFA 3E6CC 3GZUC 3FUQA 1NLQA 4XHBA 3VBHA 3L9JT 4DNYA 3D0SA 1O4ZA 2QQKA 3I3BA 2ADEA 2AEZA 3VBSB 5A33A 1Z7S1 5KXDA 2WWSA 1Q8OA 3DUIA 2HWF2 1GZWB 2VMIA 2DVBA 4ISQA 4DO0A 5DZFA 4ZZ8A 1ZRRA 2O0OA 3K4DA 3SMHA 1W03A 2D98A 4CEYA 4R4ZA 1I6XA 1ULEA 2E31A 2VBBA 1V9U3 3LB9A 4PLMA 1UPSA 2VJXA 4CP0A 5BNPB 2PAKA 5FZAA 5LASA 2ZHNA 4XUQA 2W46A 1H2KA 2XJUA 1OF4A 2QQUA 3HOBA 3SNMA 4N53B 2VBDA 1RUNA 3DPRA 5FZBA 5LRRA 5E8AA 4HVOA 2R073 4XFHA 3Q8FA 3W9AA 4AI9A 5CG9A 2WFPA 3ZYGA 4MLOA 2VOKA 4JQRA 3FHAA 1PGW1 1LGBA 4UF0B 2V72A 4GIQA 3AXEA 4DUWA 2DTYA 2XJVA 2VMGA 2LM3A 2JG8A 3SEPA 5CZKA 3RJ2X 2N7GA 5F3EA 4UW3A 3SH4A 3N9QA 1J3PA 1RUH1 1ZZ9A 1DGRA 2I2SA 5K0UB 2VOWA 2HYXA 2BNOA 3OBTA 3CLPA 5L36A 4LKSA 4YYOA 4EYUA 5FY4A 4CSWA 1GNHA 3S5AA 4FPCA 3AMHA 1QJZA 5FZCA 1US3A 1POV1 2K2SA 5ANNA 4R9CA 5J36A 3VD3A 2GC3A 3OTFA 2G9FA 3LSEA 5A3UA 2OZ6A 2JDPA 5C5UA 3GCXA 4YZ5A 4IGQA 3VBSC 2WS92 1CAXB 1CAUA 2VQAA 4M4RA 4P9WA 1UYYA 2D6OX 1C8NA 3I3DA 5DPNA 5IHRA 4XBLA 4XFFA 1CX4A 2JDKA 4WBBA 3K48A 3NKGA 4CP9A 2MNGA 4RHV2 2WZ8A 2JDZA 5BNPC 2WBKA 1W6NA 2R043 3A4UA 1DZRA 4BM8A 4QU1A 5F1RA 1RHI2 2VMFA 2XVGA 4MXWA 2JE8A 2WNVA 3MV01 4MZUA 2ET1A 4N53C 1APNA 4IV1A 5F5CA 3RVHA 3THCA 5JXIA 1AR83 2CAUA 4ZS2A 3KHCA 5KXCA 4RL7A 3VBOB 4HFSA 3MICA 3CL1A 4KL1A 4ZZ5A 4MGZE 3OBZA 3SITA 5JPNB 3NRUA 3RS6A 3I54A 5JXHA 4LUMA 2AC1A 2ZGPA 4YG3A 2VTXJ 4YARA 1F5JA 3WP5A 1VE0A 3I2IA 4EROA 1K42A 2HEVF 1QNWA 5JCTA 3MBWA 3NJVA 1N1TA 1Q8VA 3O0WA 4FPGA 1Z0HA 5BY5A 2VXJA 1FATA 1G9CA 2QDNA 4L9BA 1C8M3 5K0UC 4BE3A 1PGL2 2OUHA 4E8CA 4JHZA 3HR9A 1RMU3 2JDUA 2PHUA 3SH3A 2Q1FA 2UWAA 4NHKA 2W68A 2CU5A 4M3CA 1AX1A 2WINB 1VBE2 4RR3B 5T52A 3THPA 3ACLA 2JWPA 3LF7A 3VBUB 4BXFA 2G1MA 4FOVA 2EICA 4LA3A 2PHFA 3AMNA 2Y6JA 3N4MA 1HN1A 4NN0A 2FCTA 2Y6LA 4U36A 4H7LA 3M3EA 1BEV3 4EN6B 2ORXA 5A3NA 5FPZA 2WC2A 4UBGA 3I97A 2HWF1 2VUJA 3MF9A 5K4LA 3VHPA 1RUF3 1CJDA 4HPKB 4YG0A 2YUEA 3H3UA 5JWPA 2SBAA 2YMZA 4YGCA 3T4HB 2GN3A 1NCRA 2ENRA 3SCGA 1CQ9A 4AVTA 4J1XA 4GWNA 3BIEA 2DCKA 4D6RA 2PHDA 4B4RA 5BNOA 2GP5A 1RITA 3RWNA 3VBOC 4A4AA 3UGFA 1O4TA 2QQWA 4KWJA 3T2OA 1DG6A 1LHUA 1DP0A 2WZR3 3ECQA 5FZDA 1WA4A 5CEHA 4P9LA 3JUUA 3K4AA 4Y20A 5A7PA 2GALA 4PQQA 3T1MA 1FYUA 2W94A 4A45A 4AQTA 2VZPA 4B1LA 1Y4WA 2VVEA 3R05A 1LKNA 1VBA3 2PFWA 1UD1A 2R1DA 3H7YA 1LOFC 3M3QA 1YHFA 2RM22 3PURA 3S6PA 1S0DA 3SKJE 5IAXA 1OXCA 3WF2A 2XOMA 2DCYA 2ID4A 3KT4A 5FY8A 1TME3 2C1FA 5FO7B 5IK7A 4LOTA 2Q8CA 1ACCA 1AR63 4RR3C 2W0XA 1VMJA 1V6OA 3VGIA 3VBUC 1W8ZA 3U37A 2GNMA 5GLWA 3H3LA 4CCNA 1RVF1 3FWEA 5FKBA 1NLRA 2ZEYA 4XFBA 1KD7A 3IMMA 1W6QB 3DECA 4GB31 5KXBA 3JD73 3HT2A 5C71A 1VAKA 1WBFA 1D4M1 2JE9A 2WS91 5BXXA 4IESA 1OA3A 3UV9A 2XJPA 2VCBA 5JOXA 4QQHA 3CMGA 1BLZA 5JLVA 4IW3A 5CB7A 3MGUA 2BP6A 3R6SA 4IQPA 3PMEA 4QU2A 4S2GA 3B94A 2BBVA 5FZFA 2A6YA 1ZA7A 4OULA 3ZLIA 3EB7A 4HK9A 4ASLA 1CR7A 4QPGB 1G9FA 1DBNA 1RHI1 3IPVB 1WMXA 3ORJA 3OYWB 3J4UH 4FOYA 2B39A 2Y64A 1WW5A 2VZ3A 4LNVA 1ZREA 1X36A 4R9BA 4NIDA 4I30A 1ULDA 5IWFA 1PZ7A 2DCJA 4FSJA 3NJXA 1NYWA 1ZRDA 3TEYA 2XDVA 5T55A 1DQ1A 2GAUA 5ABJA 5JZGA 1HV1A 2WN3A 2CV6A 2VQTA 4AVSA 3HNMA 3LDKA 3LDRA 2J7MA 5C4WB 4RYDA 2DYCA 1MS8A 1LB2A 4KU7A 2QUOA 4UW5A 3BPZA 4ARYA 5DZEA 3S30A 4FFHA 2P1BA 2UYAA 1PGL1 1UOFA 4Q29A 1J3QA 4JC1A 2JICA 1C3HA 3NV2A 4ISRA 4CCOA 4IERA 1VAVA 1Q5OA 2DDUA 4Y26A 2FDGA 1F15A 2RDRA 3NNGA 4JGZA 3WSOA 2EXKA 3W59A 4V1PA 1YUDA 1ZBE2 5IVYA 3NKTA 1ENXA 1W8OA 4OUSA 3CEWA 4BXSV 2Y6GA 1B35B 2VZOA 2EAAA 4B8EA 4YW6A 1ZRIA 4J25A 4RGGA 5C3RA 2D6KA 3I2DA 2VY0A 4I09A 5EJ3A 2TNFA 1OLME 4Q4Y3 4Z82A 1Q56A 3FZ3A 5FLIA 2P5BA 2P3JA 2Y6HA 4OLLA 3WLUA 3WP4A 1FV2A 3KS7A 3W58A 4BPZA 1PX3A 1MS4A 5CVRA 3MIEA 5KC6A 3GF6A 4Q4W2 5AC92 3D8CA 2D43A 4QM9A 4QPGC 4BK5A 5KHJA 4QKBA 3U78A 3A21A 3WDTA 5IK5A 1JZ5A 1AR91 4PF1A 5IVEA 4D94A 2R042 3MW3A 3LIHA 3U75A 1VBB3 2C9KA 2VR4A 3KB5A 4K1YA 4XAEA 4JX0A 1AR82 3NAPA 3N7JA 3LE0A 5C4WC 2ARXA 5L7OA 3GBGA 3WY6A 4W6XA 1VAMA 1NCQA 5DAVA 3T30A 3LEIA 1PM7A 1PK6B 4YM1A 4CU6A 2LRPA 1FNZA 2DVDA 2RM21 2ZS6B 3T0DA 2FD8A 4AEKA 3IB3A 2FDHA 4NWVA 1DLLA 4XEZA 3ME2A 4UXAA 1YIFA 4N7IA 1VBC1 1RTVA 3J7LA 4DXZA 3RDIA 1C8M2 1AYN1 3T2TA 2DF7A 3WNXA 3IZOA 4C1WA 4WVMB 1M06G 4PDWB 4O9EA 4A7YA 4YVWA 3D0JA 1B35C 4K8FA 2OYZA 1CPNA 3TBDA 1ZBA2 1GQHA 1ZYBA 1W04A 2YB7A 1W3VA 3QD6A 4FXKB 4QD2A 4FBFA 1OI6A 3W5NA 1AX0A 2P3KA 2VW1A 5C8CA 5D8AB 4QT6A 3WUDA 4P02B 2CDOA 1PIV2 2RS32 4I3PA 3FLPA 4A3ZA 2Q8DA 3CHXA 3PUHA 4W4ZA 4FFFA 1WD3A 4FP2A 1FXZA 3TN93 3VKMA 1V9U1 2YBKA 3D3AA 2GDFA 2FHRA 4NMIA 1W9TA 3B02A 4G3YC 4AHWA 3B00A 1PNGA 4TYSA 1WW4A 4L99A 5E6HA 5JSPA 5T5PA 1JYNA 2XLGA 4BCUA 3S0MA 3POSA 3FMGA 3NV1A 3QH6A 4IE4A 2R071 3FBYA 1F2NA 5FJHA 1WMEA 2WZR2 2XKOA 4L92A 1DIWA 2WFF3 1PK6C 4LO5B 2L9LA 3UNPA 2X09A 1YFUA 2WABA 2KD7A 3CNAA 1W6OB 4J6GA 1R1ZA 1S0FA 5FBJA 3O1MA 1HB3A 4LT5A 1GOFA 4MGKE 1O3TA 4IEZA 4Y1ZA 5J98B 4E4SA 1S1AA 1YI9A 4SBVA 3VZOA 1EV12 3ZYFA 5JOZA 2XJSA 3BN6A 4A3XA 5H9SA 1QQP3 1TE1B 2GMPA 1N1YA 1KJRA 1UIJA 4BK4A 1OVPA 1QY4A 4BQWA 1CGPA 1A34A 1YLLA 3AZWA 3FN9A 3GHMA 3ZYPA 4RN5A 5FPBA 2E7TA 3BB6A 4JGYC 1LGNA 4GMP3 1HIXA 3ACIA 2ZTNA 4JDMA 4P14A 4AI2A 2ZBJA 2C24A 5FZMA 4CPBA 4PIZA 2RR13 1NA1B 1ZNPA 3WNOA 4AEJA 1JZ2A 2ETEA 1VMFA 3OPZA 4KWLA 5D8AC 4HANA 2JDYA 2PMWB 3IDAA 2IUWA 2ZX4A 3WNKA 5FMOS 4I02A 4AQSA 2W87A 3HQUA 4QXBA 3IDCB 1YNAA 4CUAA 4ZXEA 4QDSA 1H9PA 5KHHA 4CXYA 1HB1A 2UWCA 1KDKA 3LEGA 5L9BA 2R041 4L8QA 3HQXA 3NL1A 2QTWB 1UWWA 2LALA 4IEOA 3POBA 3BALA 4XMAA 5I93A 2FDIA 1AR81 4LBKA 2Y6FA 4OMCA 1OPMA 4XFIA 4EZ4A 1UN1A 1QXRA 2DUPA 1LEMA 5FAXA 4BOWA 5A6YA 5I0DA 1FNYA 2QFEA 4DRRA 3VZNA 1KS5A 4I01A 1PZ8A 1RUC2 1X82A 2IXIA 1IPJA 3MPBA 2YFZA 4Q4X2 2ZGTA 2ZX2A 3RSJA 2CWSA 4GH4B 2O8OA 1DGRN 3GDBA 2DCTA 1C8M1 2OW4A 3VBRB 4Q4V3 1IPSA 5IATA 3M3OA 1WCKA 4O65A 4ZKTB 1RMU1 4HL0A 2ZXQA 3G6JB 4RGKA 2A6VA 5I0UA 3WW3A 3K51A 5FV3A 1H8VA 5DUXA 5E89A 2E9QA 5TSWA 3H42B 3VDCA 1ND3B 5T50A 4B7EA 2BVBA 5A7WB 2A6ZA 1OURA 1W8HA 1JUIA 1OPOA 4JKKA 4AEMA 4CDWB 2E33A 1YQ8A 4IEWA 1HKDA 4RQPA 1OLQA 2JE7A 4KH9A 2DURA 5FYVA 5FXZA 3KQ4B 1VBD2 1S0GA 4XUNA 1RUF1 4F7ZA 4PHZA 2D3SA 3OGGA 4QXCA 2R30A 5JR7B 2YGLA 3R4SA 4DRVA 1O3QA 3ZKUA 3LEMA 4Y1UA 1R093 2YDEA 3WDUA 4QPYA 4F83A 5CA6A 4Z1VA 1AF9A 2YC4A 4YNIA 3ZN6B 4FFIA 5LW9A 4FAGA 1FAYA 4YM0A 3LOIA 4XFCA 1WD4A 2G19A 3B69A 3ILFA 2WZR1 4BQ2A 3ZYJB 1Q8PA 2XVLA 3B7MA 2WN2A 5GLVA 4F8AA 3K3NA 4M00A 2C5DA 1J84A 1HRI2 1WZXA 4K21A 3B9CA 2JJ6A 1DU3D 2W47A 1CAVA 4B29A 2WO3A 2D6NA 2P3YA 2ZGUA 4GH4C 4JGYA 1RUE2 1WCUA 5FPLA 1LHNA 1OVSA 4AQ2A 3OD4A 4C0HA 1EV11 3HN3A 2O14A 1I9RA 1AXKA 5DZGA 2VQUA 5EQUA 5KHKA 5C33A 5FUIA 3ZSLA 1A8DA 3OGJA 4FPOB 4BA6A 2VBPA 1TME1 5A7OA 5KR7A 3OJBA 5HCFA 5L19A 2VCAA 4K20A 2RDQA 1X50A 4QB2A 1PNFA 4ARXA 3KM5A 4Q26A 2MEV2 5IFPA 2QZ3A 2BV4A 4P08A 5L73A 2DV9A 1F5FA 1ND3C 5GZFA 1QMJA 4LTAA 4AR2A 5IVVA 5C70A 5JMCA 2V5DA 4PI2A 4ZPIA 3JD71 4CDWC 1AXYA 1UZ0A 1M4WA 1XNBA 3AL5A 4XQ4A 4XZUG 1V6KA 1IS4A 2W5FA 4H2AA 3ACHA 3AX4A 1JOPA 4XXPA 3ZFFB 3BTZA 1S2KA 1WLCA 3KHBA 4LE3A 1E5IA 3AP7A 4FFGA 1D4VB 1EUTA 4EE2A 5A3MA 5A70A 4H55A 4LQRA 5A32B 5M0TA 2ARCA 1UYXA 2R32A 5GZGA 4ITCA 4XQDA 2YV8A 4J1WA 1MS5A 4QKNA 4GMP0 2XL9A 1RUI3 1GANA 3DPRB 3NNMA 4RHV3 4A2UA 3BYWA 1AR72 3H9AA 3AKTA 2VZUA 2ZGKA 3ZOIA 1RHI3 3UGGA 3KVAA 1TVGA 3DF0A 1ASJ2 1TNFA 4HLTA 5IAVA 2PHWA 2V4AA 3CJXA 3NSTA 4IEPA 4ZXKA 4F3JA 2HWE2 2GNDA 1PO22 3THTA 5A3TA 4Q4X1 1XE7A 2P17A 3WQ1A 3PDQA 3P3PA 1LOEA 3AJZA 2TBVA 2ZHLA 1D7PM 2IXCA 4YW5A 3VZKA 1HB2A 1OOPA 2JG9C 3THDA 3UKVA 2UYBA 4OHYA 2ORZA 3Q8AA 3A0NA 4YRDA 4YVSB 1LODA 3ROUA 3W20A 5IFTA 4OUEA 3WOGA 2E51A 2WO1A 4E8DA 4LIVA 1CWPA 3GBFA 4KNCA 2CDPA 1GWLA 1VBE3 3J7HA 3E5QA 3O14A 1DQ6A 4LHNA 5BNNB 2VW2A 1JZ4A 1MEC2 2EALA 3ZFFC 4LHLA 4JRAA 2RR12 3V56A 4COVA 1SCSA 4UFKA 4YZ2A 5A32A 5I8YA 1MQTB 3BU7A 2WLQA 4Q4Y1 4D0QA 3FHQA 2R062 3RJRA 2JECA 3DKWA 1F4AA 1WUVA 1YWKA 3MZHA 1K45A 2Q1MA 3AP9A 2CTVA 2WNVB 1ULFA 2ET7A 2YG0A 3OGSA 1PX4A 3S7EA 4P9XA 3UGHA 1NOVA 2W9XA 3AYAA 2BGPA 1DGLA 3FLRA 1VRH2 3O0XA 2BPA2 1VBB1 4LITA 4KQ7A 3C7EA 5DDJ3 2EIGA 2OQ7A 2VZ1A 4CP2A 1BMV2 4YZ4A 1K12A 1XRUA 1XYPA 2O8QA 2Y34A 2XWBB 4CCEA 2EXIA 2HBTA 2VE1A 3NQHA 2PHTA 2WO2A 2J1UA 1MVQA 3AFKA 4E9KA 4NPMA 5FOBB 5HV0A 3H3ZA 3RZMA 1X7NA 1X8EA 2XH6A 2VO5A 1AL0G 3DYMA 4AAXA 1AJKA 1DF0A 4V2WA 5ANQA 1LHWA 3VBFA 1F4HA 4Y5Z0 3ZMOA 2AYHA 3ZXLA 5JIUA 5FR3A 1ENSA 4AHZA 1OMIA 4LO7A 1HXS3 4CDXA 5AFEA 3I49A 3T0AA 2FBEA 5FPXA 2EF6A 5GALA 4HZFA 3FJSA 1REEA 2ZAHA 3WHTA 2B5HA 1J1LA 5BNNC 1A8MA 5FLJA 2WNUA 3KV5A 1W0NA 1VALA 3OY8B 4WVVA 4AGVA 1J83A 1KGYA 2VL4A 1H4GA 3MEPA 4XUPA 2RMU2 4OQ8A 1ND2A 4IV3B 4GXLA 1MQTC 5IVCA 1QJX2 5FYUA 5C8WA 2D97A 4FOWA 1K5JA 4QX7A 2BZDA 5CFDA 3ZPYA 2EVXA 3ZPOA 3DGTA 3U1XA 4DXSA 4C91A 5BNOB 2D3PA 1UU4A 2HKXA 4Y5TA 1V6MA 4MGTA 4GWIA 4WM7A 1SHWB 3TN91 1W9YA 5FZEA 3A7QA 1R092 4QPWA 5DXDA 4Q1RA 1MZ6A 1MS0A 4SLIA 2JG9A 3C7FA 2AEYA 2EXHA 4Q0PA 2Q8EA 1A6CA 3QOPA 4WM8B 4AEDC 4DXTA 2YFUA 4CDQC 1N47A 4XQWA 4N43A 2XJRA 3WG1A 2UU8A 5F32A 4BIFA 1JN2P 1OLMA 2WFF1 1QXPA 2XGXA 1UMHA 1SLAA 1JH5A 4HXCA 1W99A 3U11A 5FDBA 4QQOA 4YGEA 1IS3A 1LOAA 2LW8A 4JCKA 2DVFA 4HKOA 5EFUA 3FE5A 4A42A 1H0BA 5KBFA 3RZHA 4DS0A 3HT1A 4DIQA 1OBNA 1QQP1 1W2NA 3S7IA 4CDUA 4D7SA 1L7QA 4XF0A 2BQPA 5DN2A 1UYPA 1YO8A 1J58A 4BLIA 4Y4RA 4CXXA 1HB4A 5FXVA 1WW6A 3SLIA 1K5MA 3AMQA 4Y33A 5I0RA 1UOGA 1PM4A 4DPNA 5CKMA 2PQSA 4GMP1 4CEWC 1L7RA 4IV3C 5FMCA 1IG3A 5FYIA 1QH6A 4D8MA 1ZBE3 1BK1A 1P8JA 2RR11 1NT0A 3R4DB 1POQA 2WZPP 3LCPA 3VDDA 3PL0A 4TSVA 4HMZA 2ZMLA 2R061 1C5IA 1EPZA 1GWKA 5J96B 3B3QE 5A7NA 1NXD1 1S0CA 5FCCA 5H9PA 4YW1A 2W95A 2WT2A 1K3IA 1ZZ8A 3AFGA 3ZXKA 2C9AA 4Q4W3 3PTRB 3V64A 5AC93 5T3NA 2ATFA 2CGPA 2K46A 3F95A 3B5LB 5A7QA 1RUI2 1N1SA 5F7UA 5K7PA 3WINE 4WM8C 3O1PA 3VKOA 1BMV1 2W1WA 3U4XA 4IETA 1HQNA 3USUB 2HJIA 2NLRA 1Q43A 3AZVA 4MGSA 2DCZA 5GJ6A 1UKRA 3MUY1 3AXDA 4QQLA 4UAPA 3MIGA 5HCAA 4E4ZA 1HV0A 1IPKA 4RA0A 2ZEXA 4K8RB 3PVNA 1OA2A 5LWBA 3I3QA 3KF3A 3AYEA 5KC5A 4ASMB 3EMRA 4QPIB 1DQ5A 1DQ0A 1FV3A 1UX7A 4IDZA 5CAZA 3VD9A 4FTSA 3WNMA 2YXSA 1GOGA 3FUOA 1XNAA 1HJGA 1ULCA 5LBFA 2J1AA 1WKYA 4Q4V1 5FXWA 2Q0AA 3SISA 5C3SA 3S5QA 3TRSB 1KRIA 2PAEA 4KGQA 3H7JA 3I3EA 2VXRA 3VL8A 5FZ7A 1XC6A 2D6LX 5FUNA 3O0VA 4YW7A 2Y38A 4DQAA 4QX8A 5DQ0A 5AFBA 3VKLA 3KV6A 4NHYA 2RMU1 4Q27A 1W90A 3IAQA 4YM2A 3AP5A 4GKXA 4IGOA 4NO4A 4EN9B 2VMHA 2VCCA 1ZBA3 2JDMA 4XOGA 1GLHA 2EXJA 5FZ1A 4NWWA 1UZZA 2JX9A 1NQJA 4GJYA 5D1IA 5FREA 2IXKA 1LU1A 4XFGA 4CDQA 4AF9A 4W6WA 4IEQA 1LEDA 1NE6A 1V6NA 1W8FA 3K46A 1PIV3 2CGNA 1CVNA 2RS33 1AUYA 3E5UA 4HKLA 4WVZA 3DYOA 5E16A 5F5AA 3E97A 1F8VA 4FAHA 1R091 4CYDA 1O3SA 3NNJA 4FQZA 5DUWA 4E2QA 1IS6A 4PIYA 2HEYF 4NAMA 3WV6A 1UU6A 1XE8A 1ONAA 1RIRA 2NPIA 4Q0UA 5DABA 3V0BB 1A3KA 5DDJ2 4NPRA 3LPFA 1D0GA 1XJAA 5G05L 1JU3A 5GKAC 1YFWA 4KGGA 1CAWA 1ZZCA 2GN7A 4CCDA 2B42B 4CEWA 3KF5A 3LPGA 3CJIB 4Y1YA 1JOBA 4CPBD 4ORFA 3RFRA 3KSCA 1CZVA 4QDQA 1J59A 3ZFGB 1G86A 1W0OA 2QQIA 4QHZA 4YVWB 2VTFA 1EV13 5KHGA 2R6QA 4MH0E 4NHLA 4XACA 4Z92B 4G4FA 4LEJA 1H9WA 1HXS2 4HETA 4O7XA 1E5HA 2QCSB 4UFMA 5FYYA 3VBSA 1QWRA 3NJYA 2UY9A 2BWCA 1AXZA 1FPN3 1GZWA 1V70A 3U4SA 4ZS3A 3NNFA 4RD7A 3ZO0B 5C8CB 2WA3A 4IUGA 1W6PB 4LBQD 2CYFA 2C6SA 2PHLA 3E6BA 3I59B 5ERLA 4CUBA 2VNOA 4M0NA 5BNPA 3RZKA 1WCQA 3LZZA 4UFIA 3HIFA 2BRTA 1JYCA 3G7DA 1KITA 1W2UA 4RFRB 5LK5A 4AK3A 4N53A 4UW4A 1H2LA 4XYXA 1NAEA 1H8TB 4BB3A 3SQOA 3UT0A 3U0ZA 1RUJ2 5GLUA 2ZGLA 4P9JA 2VQ0A 3JCIA 5LATA 4MHUA 1RUI1 4RHV1 3VKNA 4DB5A 4FQ4A 1LGCA 3MLKA 4Y22B 1W9WA 5DAPA 4UF0A 3E6DA 4L97A 2A3WA 3ZFEB 2BFUL 1YQ6A 3D4KA 1A78A 4XAAA 2DBIA 4NUBA 4NRQA 4JQTA 4FPLA 1SFNA 2ZGMA 1QHDA 2R1BA 5I0TA 5K0UA 1S2BA 2K0GA 1MS1A 1SDWA 3VHOA 3HNBM 1NZCA 2X5IB 1JZ6A 3UESA 4D69A 2VAUA 1UQXA 1ZVFA 3DN7A 1RUC3 3KT7A 4COZA 4IE7A 2QE3A 4TWTA
chains in the Genus database with same CATH topology
3OEAA 1GUIA 3WNOA 1JZ2A 3IDAA 4MADA 1UY1A 3WNKA 4CU9A 2EIDA 3HPNA 2W87A 1SDDB 3OB8A 4CUAA 4ZXEA 3CKHA 4QDSA 5IYYA 3VD7A 1UY0A 2BGOA 3VD4A 3LEGA 3DYPA 3K75B 3GXUA 1OH4A 1UWWA 1TG7A 3K77A 3ACGA 2W1SA 4OMCA 2WAAA 3P1IA 4CU7A 5I0DA 2E26A 2WAOA 4W50A 1LNSA 2J1VA 2YFZA 3OEBA 2J22A 2C4XA 4ET7A 3SEEA 5DMYA 3GDBA 3F2ZA 3T2PA 3LEKA 1PMHX 2BBAA 2VMDA 2ZXQA 4DEVA 2Y8KA 3T2QA 2W91A 4UOJA 3IIIA 2QBXA 5LA2A 4MOAA 3VDCA 4QB1A 3HJRA 4XURA 1OD3A 2B4KA 1PMJX 4JKKA 2QQNA 3MO4A 2JD9A 1W8NA 4ZY9A 2E33A 4KI5M 1OT5A 1UXZA 1O8PA 2VM9A 4XUNA 4OYUA 1O8SA 4MO3M 3K4ZA 4LPLA 2JDAA 5JUVA 2YC4A 3ETPA 4DUVA 1JI6A 2RVAA 3WF1A 1UMIA 4A41A 1GOHA 2WN2A 2EIBA 1J84A 5JMOA 3CQOA 4BDVB 2W47A 2XONA 2WO3A 4KMQA 3HN3A 2VQUA 2QQKA 5FUIA 3CDZB 3I3BA 2VCAA 3WNNA 4QB2A 4OMDA 3GGLA 4ARXA 4ZZ8A 1XPWA 5IFPA 4P08A 3K4DA 2Z4FA 2E31A 5C70A 2V5DA 2VJXA 5B4NA 3WNPA 3FL7A 1UZ0A 4XUQA 4XZUG 2W46A 1OF4A 2W5FA 3ACHA 3HOBA 3ABZA 1H6XA 1EUTA 3OG2A 4LQRA 5LA0A 3C7GA 1UYXA 3C8XA 3FHAA 2V72A 4DUWA 4QDRA 2VZUA 3SEPA 4CU8A 3CZUA 5CZKA 1TVGA 2W1QA 3JXSA 2QQLA 3IAPA 5JR2A 2HYXA 3A22A 4LKSA 4GZ9A 1ULPA 3MUZ1 2VMEA 2VZSA 2W3JA 1US3A 1D7PM 2QQOA 2VZVA 3VD3A 1CZSA 2HLEA 1EUUA 3THDA 2EIEA 1BHGA 2VC9A 3UETA 5IJRA 4YPJA 2ZEWA 4M4RA 2YC2A 2ORZA 1UYYA 5IFTA 3I3DA 5DPNA 1UY4A 5IHRA 4OUEA 1KEXA 2WO1A 1JZ8A 2WZEA 4E8DA 5J1XA 2WZ8A 2CDPA 2WBKA 3J7HA 1JZ4A 2WYSA 2VMFA 4FI9A 2JE8A 3THCA 3MV01 4HG6B 3W5MA 5JXIA 4W8JA 2W92A 4D0QA 3FHQA 2J1SA 1YQ2A 4ZZ5A 1F4AA 1K45A 3NRUA 5JXHA 2YG0A 3OGSA 1PX4A 1K42A 3I2KA 1RYYA 3I2IA 2QQJA 4QX0A 3WQBA 3MBWA 2W9XA 3NJVA 5B4XA 2BGPA 5G04L 5JXGA 3T0BA 3C7EA 2VZ1A 4JKLA 1K12A 4E8CA 3NQHA 4JHZA 2WO2A 2J1UA 4CUCA 3WF0A 1NKGA 4KWUA 3VDAA 2VO5A 1T2XA 3DYMA 2QQMA 2EICA 2OKXA 4AAXA 2Y6KA 5HXMA 1CX1A 2Y6JA 3ZM8A 1HN1A 1F4HA 2Y6LA 2ORXA 4TTGA 3WF3A 2R7EB 1US2A 3CZJA 3T0AA 3I97A 1OF3A 2X10A 2XHNA 2E32A 1W0NA 3C7OA 1R64A 1J83A 1KGYA 2LS6A 2VL4A 4XUPA 5JXJA 2DCKA 4A6OA 3PUIA 4A4AA 2BZDA 4GWJA 1GNYA 3A23A 3T2OA 1DP0A 4XUOA 3ECQA 3E1F1 3K4AA 4PQQA 4DXSA 2W94A 4A45A 2VZPA 2RJ2A 1NX9A 4GWIA 1SHWB 4A44A 1JZ3A 1H6YA 1IQDC 1JU4A 3A7QA 4QPWA 3AC0A 4Z2AA 3SKJE 3C7FA 2VOTA 3WF2A 4P00B 2XOMA 2ID4A 4DXTA 2YFUA 2RV9A 5LCWL 5EJ1B 3WEZA 2VZRA 1O59A 3WNLA 3HNYM 4XVHA 1UMHA 1W99A 3U37A 3OGRA 4PT6A 2LW8A 2ZEYA 5A1AA 3DECA 1JZ7A 4A42A 4QX2A 5C71A 2WDBA 4LHSA 4L0PA 4MGQA 2VCBA 1L7QA 3P6BA 3CMGA 5DN2A 1JHJA 3WF4A 3CIHA 1UY3A 2PQSA 4M4PA 1L7RA 3EB7A 4D8MA 1P8JA 2Y64A 2VZ3A 2DCJA 3NJXA 3I2GA 2WN3A 2W95A 2VQTA 3HNMA 1K3IA 2J7MA 4RYDA 1MPXA 1NUKA 1CIYA 3EYPA 2VZQA 4DUXA 1I5PA 4ARYA 5F7UA 1UYZA 4CVUA 2W1WA 4QB6A 2DDUA 4MGSA 3MUY1 3NNGA 4UAPA 3WSOA 4XUTA 2ZEXA 1W8OA 4BXSV 2Y6GA 2VZOA 5EIYB 2BERA 1UX7A 3MV11 3VD9A 3LQCA 1GMMA 3I2JA 3WNMA 1GOGA 4BJ0A 1XNAA 1DLCA 2J1AA 1WKYA 2Y6HA 1W9SA 1PX3A 3T09A 5CYYA 3I2HA 3I3EA 1XC6A 5DQ0A 4BK5A 1CZTA 3A21A 5EJZB 1JZ5A 2W1UA 3IAQA 4PF1A 3OBAA 2ZEZA 2VCCA 2C9KA 2VR4A 2J1TA 4JX0A 3VDBA 4DXRA 3I2FA 3LE0A 2WUHA 3LEIA 3K46A 4CU6A 3DYOA 3T0DA 3IB3A 4P5YA 4DEQA 3ACFA 3BGAA 4QX3A 2VZTA 1GQPA 3LPFA 5G05L 1JU3A 2C26A 3VD5A 4TXWA 3LPGA 2YB7A 2J1EA 5HPOA 1CZVA 4QDQA 2QQIA 2VTFA 4JKMA 3W5NA 3OGVA 2J1RA 1JYVA 4P02B 2CDOA 4A3ZA 1UY2A 3PUHA 4W4ZA 1XNTA 3D3AA 4IUGA 4QX1A 1W9TA 5LA1A 2B9VA 4CUBA 5C7GA 1JYNA 1WCQA 3T08A 2JKXA 3GM8A 1NAEA 3HEIA 2V4VA 2L9LA 3UNPA 2X09A 4OZOA 2WABA 2KD7A 2VMCA 2WQ8A 1GOFA 1ULOA 1W9WA 2XQXA 3SKVA 3BN6A 1UXXX 4BK4A 4UI9L 1JYWA 3FN9A 4QAWA 1DYOA 4RN5A 1SG3A 3HNBM 1JZ6A 4AG4A 3C7HA 3UESA 3ACIA 2X05A 1JYXA 1GU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OEA A;  1GUI A;  3WNO A;  1JZ2 A;  3IDA A;  4MAD A;  1UY1 A;  3WNK A;  4CU9 A;  2EID A;  3HPN A;  2W87 A;  1SDD B;  3OB8 A;  4CUA A;  4ZXE A;  3CKH A;  4QDS A;  5IYY A;  3VD7 A;  1UY0 A;  2BGO A;  3VD4 A;  3LEG A;  3DYP A;  3K75 B;  3GXU A;  1OH4 A;  1UWW A;  1TG7 A;  3K77 A;  3ACG A;  2W1S A;  4OMC A;  2WAA A;  3P1I A;  4CU7 A;  5I0D A;  2E26 A;  2WAO A;  4W50 A;  1LNS A;  2J1V A;  2YFZ A;  3OEB A;  2J22 A;  2C4X A;  4ET7 A;  3SEE A;  5DMY A;  3GDB A;  3F2Z A;  3T2P A;  3LEK A;  1PMH X;  2BBA A;  2VMD A;  2ZXQ A;  4DEV A;  2Y8K A;  3T2Q A;  2W91 A;  4UOJ A;  3III A;  2QBX A;  5LA2 A;  4MOA A;  3VDC A;  4QB1 A;  3HJR A;  4XUR A;  1OD3 A;  2B4K A;  1PMJ X;  4JKK A;  2QQN A;  3MO4 A;  2JD9 A;  1W8N A;  4ZY9 A;  2E33 A;  4KI5 M;  1OT5 A;  1UXZ A;  1O8P A;  2VM9 A;  4XUN A;  4OYU A;  1O8S A;  4MO3 M;  3K4Z A;  4LPL A;  2JDA A;  5JUV A;  2YC4 A;  3ETP A;  4DUV A;  1JI6 A;  2RVA A;  3WF1 A;  1UMI A;  4A41 A;  1GOH A;  2WN2 A;  2EIB A;  1J84 A;  5JMO A;  3CQO A;  4BDV B;  2W47 A;  2XON A;  2WO3 A;  4KMQ A;  3HN3 A;  2VQU A;  2QQK A;  5FUI A;  3CDZ B;  3I3B A;  2VCA A;  3WNN A;  4QB2 A;  4OMD A;  3GGL A;  4ARX A;  4ZZ8 A;  1XPW A;  5IFP A;  4P08 A;  3K4D A;  2Z4F A;  2E31 A;  5C70 A;  2V5D A;  2VJX A;  5B4N A;  3WNP A;  3FL7 A;  1UZ0 A;  4XUQ A;  4XZU G;  2W46 A;  1OF4 A;  2W5F A;  3ACH A;  3HOB A;  3ABZ A;  1H6X A;  1EUT A;  3OG2 A;  4LQR A;  5LA0 A;  3C7G A;  1UYX A;  3C8X A;  3FHA A;  2V72 A;  4DUW A;  4QDR A;  2VZU A;  3SEP A;  4CU8 A;  3CZU A;  5CZK A;  1TVG A;  2W1Q A;  3JXS A;  2QQL A;  3IAP A;  5JR2 A;  2HYX A;  3A22 A;  4LKS A;  4GZ9 A;  1ULP A;  3MUZ 1;  2VME A;  2VZS A;  2W3J A;  1US3 A;  1D7P M;  2QQO A;  2VZV A;  3VD3 A;  1CZS A;  2HLE A;  1EUU A;  3THD A;  2EIE A;  1BHG A;  2VC9 A;  3UET A;  5IJR A;  4YPJ A;  2ZEW A;  4M4R A;  2YC2 A;  2ORZ A;  1UYY A;  5IFT A;  3I3D A;  5DPN A;  1UY4 A;  5IHR A;  4OUE A;  1KEX A;  2WO1 A;  1JZ8 A;  2WZE A;  4E8D A;  5J1X A;  2WZ8 A;  2CDP A;  2WBK A;  3J7H A;  1JZ4 A;  2WYS A;  2VMF A;  4FI9 A;  2JE8 A;  3THC A;  3MV0 1;  4HG6 B;  3W5M A;  5JXI A;  4W8J A;  2W92 A;  4D0Q A;  3FHQ A;  2J1S A;  1YQ2 A;  4ZZ5 A;  1F4A A;  1K45 A;  3NRU A;  5JXH A;  2YG0 A;  3OGS A;  1PX4 A;  1K42 A;  3I2K A;  1RYY A;  3I2I A;  2QQJ A;  4QX0 A;  3WQB A;  3MBW A;  2W9X A;  3NJV A;  5B4X A;  2BGP A;  5G04 L;  5JXG A;  3T0B A;  3C7E A;  2VZ1 A;  4JKL A;  1K12 A;  4E8C A;  3NQH A;  4JHZ A;  2WO2 A;  2J1U A;  4CUC A;  3WF0 A;  1NKG A;  4KWU A;  3VDA A;  2VO5 A;  1T2X A;  3DYM A;  2QQM A;  2EIC A;  2OKX A;  4AAX A;  2Y6K A;  5HXM A;  1CX1 A;  2Y6J A;  3ZM8 A;  1HN1 A;  1F4H A;  2Y6L A;  2ORX A;  4TTG A;  3WF3 A;  2R7E B;  1US2 A;  3CZJ A;  3T0A A;  3I97 A;  1OF3 A;  2X10 A;  2XHN A;  2E32 A;  1W0N A;  3C7O A;  1R64 A;  1J83 A;  1KGY A;  2LS6 A;  2VL4 A;  4XUP A;  5JXJ A;  2DCK A;  4A6O A;  3PUI A;  4A4A A;  2BZD A;  4GWJ A;  1GNY A;  3A23 A;  3T2O A;  1DP0 A;  4XUO A;  3ECQ A;  3E1F 1;  3K4A A;  4PQQ A;  4DXS A;  2W94 A;  4A45 A;  2VZP A;  2RJ2 A;  1NX9 A;  4GWI A;  1SHW B;  4A44 A;  1JZ3 A;  1H6Y A;  1IQD C;  1JU4 A;  3A7Q A;  4QPW A;  3AC0 A;  4Z2A A;  3SKJ E;  3C7F A;  2VOT A;  3WF2 A;  4P00 B;  2XOM A;  2ID4 A;  4DXT A;  2YFU A;  2RV9 A;  5LCW L;  5EJ1 B;  3WEZ A;  2VZR A;  1O59 A;  3WNL A;  3HNY M;  4XVH A;  1UMH A;  1W99 A;  3U37 A;  3OGR A;  4PT6 A;  2LW8 A;  2ZEY A;  5A1A A;  3DEC A;  1JZ7 A;  4A42 A;  4QX2 A;  5C71 A;  2WDB A;  4LHS A;  4L0P A;  4MGQ A;  2VCB A;  1L7Q A;  3P6B A;  3CMG A;  5DN2 A;  1JHJ A;  3WF4 A;  3CIH A;  1UY3 A;  2PQS A;  4M4P A;  1L7R A;  3EB7 A;  4D8M A;  1P8J A;  2Y64 A;  2VZ3 A;  2DCJ A;  3NJX A;  3I2G A;  2WN3 A;  2W95 A;  2VQT A;  3HNM A;  1K3I A;  2J7M A;  4RYD A;  1MPX A;  1NUK A;  1CIY A;  3EYP A;  2VZQ A;  4DUX A;  1I5P A;  4ARY A;  5F7U A;  1UYZ A;  4CVU A;  2W1W A;  4QB6 A;  2DDU A;  4MGS A;  3MUY 1;  3NNG A;  4UAP A;  3WSO A;  4XUT A;  2ZEX A;  1W8O A;  4BXS V;  2Y6G A;  2VZO A;  5EIY B;  2BER A;  1UX7 A;  3MV1 1;  3VD9 A;  3LQC A;  1GMM A;  3I2J A;  3WNM A;  1GOG A;  4BJ0 A;  1XNA A;  1DLC A;  2J1A A;  1WKY A;  2Y6H A;  1W9S A;  1PX3 A;  3T09 A;  5CYY A;  3I2H A;  3I3E A;  1XC6 A;  5DQ0 A;  4BK5 A;  1CZT A;  3A21 A;  5EJZ B;  1JZ5 A;  2W1U A;  3IAQ A;  4PF1 A;  3OBA A;  2ZEZ A;  2VCC A;  2C9K A;  2VR4 A;  2J1T A;  4JX0 A;  3VDB A;  4DXR A;  3I2F A;  3LE0 A;  2WUH A;  3LEI A;  3K46 A;  4CU6 A;  3DYO A;  3T0D A;  3IB3 A;  4P5Y A;  4DEQ A;  3ACF A;  3BGA A;  4QX3 A;  2VZT A;  1GQP A;  3LPF A;  5G05 L;  1JU3 A;  2C26 A;  3VD5 A;  4TXW A;  3LPG A;  2YB7 A;  2J1E A;  5HPO A;  1CZV A;  4QDQ A;  2QQI A;  2VTF A;  4JKM A;  3W5N A;  3OGV A;  2J1R A;  1JYV A;  4P02 B;  2CDO A;  4A3Z A;  1UY2 A;  3PUH A;  4W4Z A;  1XNT A;  3D3A A;  4IUG A;  4QX1 A;  1W9T A;  5LA1 A;  2B9V A;  4CUB A;  5C7G A;  1JYN A;  1WCQ A;  3T08 A;  2JKX A;  3GM8 A;  1NAE A;  3HEI A;  2V4V A;  2L9L A;  3UNP A;  2X09 A;  4OZO A;  2WAB A;  2KD7 A;  2VMC A;  2WQ8 A;  1GOF A;  1ULO A;  1W9W A;  2XQX A;  3SKV A;  3BN6 A;  1UXX X;  4BK4 A;  4UI9 L;  1JYW A;  3FN9 A;  4QAW A;  1DYO A;  4RN5 A;  1SG3 A;  3HNB M;  1JZ6 A;  4AG4 A;  3C7H A;  3UES A;  3ACI A;  2X05 A;  1JYX A;  1GU3 A; 
#chains in the Genus database with same CATH topology
 3ZFG C;  4Q4X 3;  3AMM A;  1GUI A;  3OEA A;  2HWD 2;  5FYZ A;  1QXJ A;  2AR6 A;  1MZE A;  4LR4 A;  4TLF A;  2P34 A;  1MS9 A;  3WCR A;  2VVF A;  5FYM A;  2PA7 A;  1W0P A;  5LY1 A;  3PIG A;  4FPK A;  2VNR A;  3MIH A;  1CAX A;  4MET A;  1ZRC A;  3T4V A;  2EID A;  3HPN A;  2AEN A;  4ZHN A;  3OB8 A;  4HVQ A;  1BBT 2;  3VKF C;  1UY0 A;  1W9F A;  2A3Y A;  2JIG A;  1VBE 1;  1T6B X;  2DU0 A;  3AMP A;  5SV8 A;  3DL3 A;  1D2Q A;  3ZIW A;  2VVD A;  1CPM A;  4Y4Y A;  5C9A B;  2C0Z A;  2GMM A;  3OOX A;  3RYR A;  4YM3 A;  4K3U A;  1RIN A;  3P1I A;  2ZJC A;  1W8W A;  1H8T C;  4XJ9 A;  4QQP A;  2UY8 A;  4IE0 A;  2VOX A;  4FPE A;  2WAO A;  3RYK A;  4LBQ B;  3VBO A;  5CIS A;  1LAJ A;  1VBD 3;  2RDS A;  4DOU A;  3OUH A;  1PO1 2;  2J1V A;  4HKW A;  2R16 A;  3N7M A;  3ZFE C;  3DEM A;  1SFP A;  2B8M A;  4LKD A;  3PUA A;  5FPA A;  3LSD A;  4IE6 A;  4BYY A;  1LOC A;  5DDJ 1;  5FO8 B;  2PXJ A;  3F2Z A;  5FJK A;  1AL2 2;  2PHR A;  2OXB A;  3J7M A;  4KG8 A;  4LUL A;  5FXX A;  3Q8B A;  1LOF A;  1PMH X;  4AAP A;  4A7Z A;  2F17 A;  1WLD A;  4FT8 A;  4X6Q B;  1CN1 A;  1E57 A;  2X5I C;  2ZAA A;  2W91 A;  4UOJ A;  1HRI 3;  1BJQ A;  3III A;  1U5I A;  3V0A B;  4I0B A;  3ALQ A;  5LA2 A;  4MOA A;  1VIW B;  1YJK A;  4RR3 A;  2D6M A;  4GKY A;  3ST7 A;  1OD3 A;  1RUE 3;  3VBU A;  1YRZ A;  2GME A;  4IEV A;  5GLT A;  3R4U A;  2B4K A;  3ATG A;  3LA7 A;  1G6N A;  2QQN A;  3MO4 A;  1S0J A;  4Z2W A;  1HXS 1;  2VPV A;  2YU2 A;  4KI5 M;  3VUO A;  1OT5 A;  2DFC A;  2OT7 A;  2VM9 A;  4ZON A;  2CAV A;  4GJZ A;  3M8L A;  1VB4 A;  2A75 A;  3QH7 A;  2MEV 3;  4OHX A;  5SV5 A;  1QDO A;  1XU2 A;  2D93 A;  1HRV 3;  4XDP A;  3H8X A;  2JDA A;  5JUV A;  3BTY A;  1NY7 2;  2BVV A;  2ZHM A;  5I91 A;  4RSU A;  3QCW A;  3KQR A;  2H6C A;  1JW6 A;  3GAL A;  3O7O A;  2OPK A;  5F5Q A;  2OUJ A;  3BTX A;  3MYX A;  4WZF A;  3CF6 E;  1RUJ 1;  1U5Z A;  2JDH A;  2W08 A;  3N7K A;  4IND A;  3RG0 A;  3CQO A;  4CXW A;  3AYC A;  1ALY A;  4DIN B;  1DGW A;  4FTE A;  2XON A;  2XB6 C;  3IDE A;  4DY5 A;  4EJR A;  2RHP A;  4QWN A;  5FZ9 A;  5ACA 2;  1C1F A;  1AR7 3;  1F35 A;  2MPF A;  1GFF 2;  3WQ0 A;  2WNE A;  4B4Q A;  5JSO A;  1ASJ 3;  1MAC A;  4HOO A;  5FKC A;  3WG4 A;  4XIK A;  2NMO A;  4XJA A;  5FRA A;  5IUQ A;  2HWE 3;  3CU7 A;  2YRO A;  4OQ9 A;  3N7L A;  1PO2 3;  2Z4F A;  3NW4 A;  3O5S A;  1BVV A;  1LUL A;  3FL7 A;  3HAG A;  3OD0 A;  5FYB A;  3WW2 A;  4K7J A;  1W6Q A;  2IC1 A;  3Q9O A;  2A1X A;  4XF1 A;  3ZDV A;  1EAH 2;  5FZ4 A;  1C1L A;  3WXP A;  3ABZ A;  1O91 A;  2FDF A;  2F4P A;  5L9R A;  3R0R A;  2XBO 3;  4PDW C;  3C7G A;  1IZ3 A;  2WKK A;  4W6Y A;  4L11 A;  3C8X A;  2D5H A;  3VV1 A;  5CBL A;  4YLZ A;  2ZX1 A;  1ENR A;  1ZBE 1;  1FPN 2;  1XNK A;  3VZL A;  3LOB A;  4QDR A;  5FWE A;  3VZJ A;  4QPG A;  3IPV A;  4CU8 A;  1MEC 3;  4EN0 A;  4KBZ A;  1WGP A;  4AQ6 A;  4I0W B;  3M1H A;  1S2E A;  3IAP A;  5JR2 A;  4ATE A;  3PTY A;  2R06 3;  3A22 A;  4AFD A;  3N36 A;  4GZ9 A;  1OFN A;  2VME A;  1GZ9 A;  2W3J A;  2VZS A;  4Q4W 1;  5AC9 1;  2Q8O A;  5JVV A;  5C4W A;  1IHM A;  3ON7 A;  1SCR A;  2HLE A;  2OQ6 A;  3OUI A;  2PEL A;  1BHG A;  2VC9 A;  1UX6 A;  3UET A;  4YW4 A;  1VRH 3;  2IZW A;  1XBF A;  3AZZ A;  5FZO B;  4K9S A;  2VNG A;  5KHI A;  1ULG A;  2ZEW A;  4XBQ A;  4FXG B;  1VLN A;  2YC2 A;  4XJU A;  2ZGN A;  1RB8 G;  5GLZ A;  1GZT A;  1KEX A;  1TEI A;  2GZW A;  2OVU A;  2WSU A;  3LFM A;  5J1X A;  1WBL A;  4JDO A;  5CAD A;  1W8T A;  1AHS A;  2RS5 2;  3BIW E;  2CNA A;  5FLH A;  5A1F A;  2R0H A;  2WYS A;  3X29 B;  1V6J A;  4E2S A;  3O1S A;  4HG6 B;  3D82 A;  3W5M A;  4BH9 A;  1B35 A;  4XHX A;  2A73 B;  1SEF A;  2IXJ A;  4W8J A;  4CCM A;  1TMF 2;  3I7D A;  3QLQ A;  3WUC A;  2A5Z A;  1YQ2 A;  1SFY A;  2YBP A;  1SPP B;  1Y3T A;  5CG8 A;  2P4E A;  5HCB A;  5LBB A;  3I2K A;  4AVC A;  3PUQ A;  5CFC B;  3FFZ A;  2DU1 A;  4QX0 A;  3WQB A;  1XYN A;  5H9R A;  5F37 A;  2RMU 3;  4PCR A;  5JXG A;  1NA1 C;  1ZBA 1;  4Q2F A;  4AI1 A;  1GNZ A;  3CO2 A;  1QJX 3;  2ZMN A;  2UWB A;  2ARE A;  1OLR A;  3ZX7 A;  1C4R A;  4YGB A;  1FI2 A;  3DXT A;  4ES9 A;  1R1A 2;  4BQX A;  2CY6 A;  5A3W A;  4CUC A;  3AVR A;  1G8W A;  2ZGO A;  2GC0 A;  3LGR A;  2BYV E;  1PIV 1;  2RS3 1;  5FY7 A;  4CP1 A;  4BWO A;  5LEJ A;  2HH9 A;  2IFR A;  5F9T A;  1LU2 A;  3RZL A;  3RZZ A;  1YFY A;  3GHN A;  1OC1 A;  2WL1 A;  1PK6 A;  1LEC A;  3INA A;  2OKX A;  4AHX A;  2Y6K A;  4LXL A;  4ASK A;  1R08 2;  1CX1 A;  3ZM8 A;  4GUL A;  2CL2 A;  2TEP A;  2WR9 A;  3ASI A;  3WF3 A;  4C1X A;  3SCF A;  3CZJ A;  4Q1P A;  4YFW A;  2ARA A;  2KA3 A;  3C3V A;  1ODN A;  1OF3 A;  1XND A;  4GD4 A;  3T1L A;  3O1U A;  3RQ0 A;  3USS A;  2XHN A;  3O1T A;  2V73 A;  3POG A;  4WVM A;  4UFJ A;  5FMB A;  2WYF A;  2E32 A;  3C7O A;  1R64 A;  3D5O A;  2LS6 A;  1IKP A;  5JXJ A;  1YCI A;  1ZZB A;  5DG2 A;  4EV0 A;  3ZSJ A;  1QJF A;  3PUI A;  3UK9 A;  3ZYI B;  1WMF A;  2HWB 3;  4Q0S A;  3J8F 2;  4GWJ A;  3H0O A;  3A23 A;  5J48 A;  5E1R A;  3VBR C;  4XUO A;  4GWM A;  4RS5 B;  1JOJ A;  1SZB A;  2CHH A;  3Q8E A;  4O61 A;  4EZH A;  4CZS A;  1COV 2;  5D8A A;  5CFC C;  1NX9 A;  3POY A;  4FTB A;  2GP3 A;  3I2O A;  1FPN 1;  1JZ3 A;  1BYH A;  4WVW A;  1IQD C;  3VBH B;  1HRV 2;  3AC0 A;  2OX0 A;  2P3I A;  2PTM A;  4BHP A;  5A33 B;  2GNT A;  3MHZ A;  3WW4 A;  1GKB A;  3AKS A;  2RV9 A;  2AGS A;  2QJV A;  5EJ1 B;  4BQ1 A;  1OA4 A;  2VZR A;  1O59 A;  2RJL A;  3WNL A;  1V6I A;  1W06 A;  4B3N A;  4CEY B;  2F6B A;  3HNY M;  4XVH A;  2BNM A;  2XKP A;  3M7A A;  2ES3 A;  4S2H A;  5FWJ A;  1BXH A;  2B46 X;  2XLA A;  3M3C A;  4IL7 A;  1BQP A;  1QDC A;  4PT6 A;  1UNB A;  3AZX A;  3ZXG A;  3EJK A;  1W6O A;  3KWV A;  3MI8 A;  4QX2 A;  3JB4 C;  1OH3 A;  2WDB A;  4L0P A;  4UT5 A;  4LBO A;  5BYN A;  4YG6 A;  4NJ4 A;  5HV4 A;  4AVV A;  3P6B A;  1QH7 A;  3ZSK A;  1CES A;  4Y1X A;  4D6Q A;  3WF4 A;  3CIH A;  1PGS A;  2E7A A;  4LLF A;  3FX3 A;  4NRP A;  1WLT A;  5FYT A;  2KR2 A;  4BZ4 A;  1GP6 A;  4M4P A;  3TEZ A;  5HBA A;  2JG8 B;  1RUC 1;  1HW5 A;  2QNK A;  3RI9 A;  1UPI A;  4BME A;  3VL9 A;  1JTZ X;  1NA1 A;  4RS5 C;  1Z7S 2;  3M2M A;  2XUM A;  1JUH A;  3I2G A;  1Q3E A;  3VLB B;  2D5F A;  5JPM B;  2NN8 A;  3HQR A;  5HXV A;  5A3P A;  4KBB A;  5D2A A;  3UKN A;  2FCU A;  4I3G A;  1POV 0;  2DUQ A;  2VNV A;  4EWE A;  2XBO 2;  1KS4 A;  4UW6 A;  5HCH A;  5FFO C;  1MPX A;  3ZMN A;  1NUK A;  1CIY A;  2VUA A;  3MDP A;  1I5P A;  1W2A X;  4K40 A;  1GSL A;  1UYZ A;  4HK8 A;  4XET A;  3LAG A;  3IDB B;  1S0I A;  4NPL A;  2E53 A;  1CAU B;  4LO6 B;  3APB A;  3ZDS A;  2XWJ B;  3AKP A;  1U12 A;  2OZJ A;  3T3Y A;  1S4C A;  1S0E A;  4CEY C;  2WWU A;  2FCV A;  4CP9 B;  3J9S A;  1DZT A;  4KWK A;  1PGW 2;  1W6N B;  1QU0 A;  1VBD 1;  3KV4 A;  1HDK A;  5C5T A;  4NII A;  4MXW B;  5J09 A;  5EZW A;  4TLG A;  4YZ1 A;  5F3I A;  4NIA A;  4IV1 B;  3WDW A;  4H14 A;  3DPR C;  5EIY B;  4PJY A;  3MV1 1;  1UZY A;  1GMM A;  4NE9 A;  1RUH 2;  4XF3 A;  5FMD A;  2Q4S A;  1W6M A;  1UAI A;  4GH4 A;  1DLC A;  1AZD A;  1H1A A;  4QGL A;  4PIX A;  1SLI A;  4RFT 0;  4XDO A;  3FLT A;  3VBR A;  3LKJ A;  5FIX A;  1FX5 A;  3PLQ A;  1C28 A;  3SHR A;  3WR0 A;  5GZE A;  1XQN A;  2JG8 C;  2QQV A;  1HRI 1;  1B09 A;  1QJY 3;  4WV8 A;  1CZT A;  4OHW A;  2W1U A;  3OSD A;  3K3O A;  1TZO A;  2ZEZ A;  1PZ9 A;  1RUE 1;  1D0H A;  2QDR A;  1ND3 A;  2PLV 3;  4AFC A;  5I8S A;  4CTE A;  5BUV A;  3IMN A;  3JQW A;  2VUL A;  5A7W A;  5A7S A;  4DXR A;  3ZYR A;  3I2F A;  4M3C B;  3RMY A;  4CDW A;  1Y9Q A;  2WJS A;  2WUH A;  4YVS C;  1G9A A;  1BK0 A;  3I8T A;  5T5J A;  2GU9 A;  2XR4 A;  4FVV A;  2MEV 1;  1PVX A;  4P5H A;  3BOD A;  1HRV 1;  1KQR A;  2ADD A;  1DFQ A;  1DQ2 A;  3OUJ A;  4FO9 A;  1S0B A;  1CON A;  1IOA A;  2ZOE B;  3K2O A;  1DCS A;  4P5Y A;  5A80 A;  1TQ5 A;  3ZN6 A;  3P3N A;  2VZT A;  4LBL A;  4XTP A;  4QGN A;  4HSJ A;  2P2K A;  3L2Y A;  4R52 A;  4XAB A;  3ZSE A;  5F39 A;  2Z5W A;  1NCR B;  5DUU A;  2XHK A;  4HBN A;  2WNV C;  4NOT A;  4IV1 C;  1IQA A;  2C26 A;  1RUJ 3;  3VD5 A;  1RXG A;  4TN7 A;  4MUV A;  1L3J A;  3ZR5 A;  1Y9M A;  1FOD 3;  4K1Z A;  5H9Q A;  1I3H A;  4GAL A;  1T6G C;  1AR7 1;  3KGL A;  5HPO A;  1VMH A;  1GWM A;  1VP6 A;  3M70 A;  4Y20 B;  5A3L A;  2E7Q A;  3WDX A;  1ASJ 1;  5J7M A;  3OGV A;  2J1R A;  3TNQ A;  4P9I A;  2ARB A;  4LIU A;  4PBO A;  5A3O A;  1ZA4 A;  2XJT A;  1ZX5 A;  4QKD A;  5FY5 A;  2H6B A;  2HWE 1;  2DVA A;  2ZKN A;  5FUP A;  4R9D A;  2TUN A;  4JRL A;  1PO2 1;  2IFW A;  3PU3 A;  4Q8L A;  3IBM A;  4QHB A;  4DY3 A;  1XSR A;  3WZ1 A;  5LA1 A;  2O1Q A;  2B9V A;  2Z42 A;  2HWD 3;  1RUO A;  5CKN A;  2HWB 2;  3KV9 A;  2CWM A;  3ZFF A;  1MVE A;  5APA A;  3O1R A;  5FQ0 A;  2A6W A;  2JKX A;  3ITQ A;  4NIH A;  1YC6 1;  2XBO 1;  2V4V A;  1J1T A;  3HBZ A;  1OD5 A;  5GZD A;  4OZO A;  5FZ3 A;  1BBT 3;  2A7A A;  2WQ8 A;  2G4I A;  3MW4 A;  4IEX A;  3WDY A;  4ATF A;  3N9P A;  1C57 A;  3ZN5 A;  5A6Q A;  5FY0 A;  5C3Q A;  4NRO A;  1W8U A;  4H3W A;  2VGD A;  2SLI A;  2ZAC A;  1MEC 1;  5HI0 A;  3RRD A;  4BU2 A;  1UOB A;  3TNP B;  4MG2 A;  1UXX X;  1NCR C;  1RUD 3;  2HWC 3;  1HJF A;  3DXU A;  1OQD A;  2FZ2 A;  2YZ4 A;  4QAW A;  1SG3 A;  5BNO C;  5FPU A;  2JIJ A;  1JYT A;  3GNE A;  4S2F A;  5F6L B;  1GR3 A;  3Q8C A;  4LKE A;  2B9U A;  2Y0I A;  2YY1 A;  2FDK A;  4EN8 B;  1O4Y A;  5CIR A;  2VCM A;  2X05 A;  3H8U A;  1PO1 3;  3WP6 A;  3NV3 A;  4GQ7 A;  2XUE A;  1GP4 A;  3JZV A;  4ZU7 A;  2UUR A;  2E63 A;  1VRH 1;  2I07 B;  3POW A;  5LRS A;  5FZ0 A;  5ABJ B;  3IM0 A;  4MAD A;  4HT1 T;  5FY1 A;  1UY1 A;  4MXV A;  5JZG B;  1AL2 3;  3KCY A;  5CNA A;  1TNR A;  3MLJ A;  1OKO A;  5JOW A;  1H2M A;  1SDD B;  4YVS A;  3POF A;  5EPA A;  5IYY A;  1KXG A;  3VD7 A;  1RVF 2;  2GH2 A;  2JXA A;  4OI0 A;  4GB3 2;  3DYP A;  1EP0 A;  1D4M 2;  1DZQ A;  1OQ1 A;  1UOJ A;  1V00 A;  2G9G A;  1TG7 A;  4XE9 A;  5DAX A;  3K77 A;  5F2S A;  5BNN A;  2NZ9 A;  3VN4 A;  3KVB A;  4JGZ B;  2JD4 A;  1NG0 A;  4AWD A;  1MQT A;  1IS5 A;  2E26 A;  2YPJ A;  2H0V A;  2ILM A;  2VUC A;  2WA4 A;  4FOQ A;  2XL7 A;  3U10 A;  4XXA A;  3WQ7 A;  4W50 A;  4LLO A;  3U07 A;  5DAW A;  2X53 S;  4Y5S A;  2J22 A;  5FYH A;  5F6K A;  3SEE A;  2QZ2 A;  4E4D X;  5EP9 A;  1QJX 1;  2VD7 A;  4LUK A;  2LRO A;  2V09 A;  2BFU S;  1LRH A;  3IWZ A;  4HSL A;  3T2P A;  2BBA A;  2Y60 A;  3URF A;  2Q30 A;  2GSY A;  2Y8K A;  3PIJ A;  1HQL A;  2LUW A;  1YI7 A;  4R4X A;  4AED A;  3H8R A;  2ZX3 A;  2QBX A;  1OFS A;  4LJH A;  2ZPX A;  1DGW X;  2KXL A;  3ES4 A;  4GA9 A;  2GC1 A;  3HJR A;  4PF5 A;  4AED B;  4JTO A;  2Y33 A;  2J42 A;  2DTW A;  4HN1 A;  4UFH A;  4DMI A;  5ABJ C;  3NAP B;  5JZG C;  5ACA 3;  4XCB A;  1QIQ A;  2ZCW A;  2JKB A;  4LOR A;  3HMY A;  4JZR A;  2XQR A;  1W8N A;  2FMY A;  2RS1 2;  5L7O B;  1NCQ B;  3NJZ A;  4RGA A;  1UXZ A;  1O8P A;  4YFZ A;  3O1O A;  3ZN4 A;  4BLJ A;  4MGY E;  1O8S A;  1UKG A;  1QF3 A;  3OF1 A;  2R49 A;  4MO3 M;  1MS3 A;  1QJY 2;  1GBG A;  2ZKL A;  4XJW A;  2IVJ A;  4OI2 A;  3OY8 A;  1FMD 3;  3WVJ A;  4QPI C;  5EYY A;  4DUV A;  1G9D A;  4JGZ C;  5FYS A;  4IV3 A;  2HWB 1;  4COU A;  1GOH A;  2PLV 2;  1XYO A;  4PLO A;  5CU1 A;  1EAH 3;  2EIB A;  1SBF A;  2BWA A;  3A0K A;  3GCW A;  4JHT A;  5JMO A;  1GIC A;  5FP9 A;  4Z8B A;  1AR9 2;  3DCQ A;  1IKQ A;  3ZVX A;  4LMF A;  3WT3 A;  4KMQ A;  4B7K A;  3M4F A;  2FDJ A;  1ST8 A;  5A6Z A;  1NXM A;  1Y9G A;  4COW A;  1N3O A;  1V0A A;  2X8K A;  3AKQ A;  2D6P A;  1W2O A;  1AX2 A;  4OFG A;  4Q0Q A;  1LR5 A;  1W39 A;  2PQQ A;  3CDZ B;  4PQ9 A;  5ISL A;  2MHF A;  1JXN A;  3BCW A;  4UBH A;  4Q5O A;  4YW2 A;  5JAX A;  3MID A;  4WM8 A;  4QHO A;  3WNN A;  1L7L A;  5JOY A;  1Y43 B;  3GGL A;  4OMD A;  1XOY A;  3ETQ A;  4L2N A;  1RJ7 A;  1XPW A;  4LBM A;  3PMS A;  2Z2S B;  3JU9 A;  3NAP C;  1CD3 G;  2I74 A;  3WNP A;  2PAM A;  5B4N A;  1G9B A;  1FOD 2;  1VBC 2;  1W3X A;  1QKQ A;  1WWY A;  2XML A;  5L7O C;  4HN0 A;  4OHV A;  2IWG B;  1AYN 2;  1NCQ C;  1VPH A;  3B01 A;  4PBP A;  4XF4 A;  4G9S B;  1H6X A;  1LOB A;  1VRB A;  1QJU 3;  2JEN A;  4YW3 A;  2AAC A;  2XPJ A;  1XNC A;  4OHZ A;  4XTM A;  5LY2 A;  3OG2 A;  3AK0 A;  4BIS A;  4BIO A;  5LA0 A;  1GYK A;  3VZM A;  2WNO A;  1SAC A;  2OII A;  1F9K A;  4AFB A;  2OS2 A;  2Z79 A;  5CKQ A;  2RS5 3;  3PVB B;  2QVS B;  2BDR A;  3CJI C;  3CZU A;  2VTX A;  1F31 A;  3U14 A;  3DV8 A;  4QQ2 A;  2W1Q A;  4DFS A;  1X9T A;  5BV6 A;  2PN5 A;  2CGO A;  1RJ8 A;  3JXS A;  3PU8 A;  4YVW C;  1TMF 3;  2QQL A;  3BPS A;  5K8S A;  1LTE A;  1XE0 A;  1IGO A;  3HN1 A;  3N35 A;  4BQ3 A;  2Q5T A;  4LOS A;  3UYJ A;  1ULP A;  1RXF A;  1GQG A;  3MUZ 1;  4W65 A;  5IVF A;  2CSG A;  1PVC 3;  1V9U 2;  4UFL A;  2WLP A;  3SXW A;  2QQO A;  1RC6 A;  2VZV A;  5FO9 B;  1CZS A;  1UF2 C;  4FPF A;  5C8C C;  1EUU A;  5F3G A;  2R0F A;  2EIE A;  3TWI A;  5IT6 A;  4I2O A;  1WA6 X;  3ELN A;  4XZP A;  2R07 2;  3TAY A;  5IJR A;  4YPJ A;  5FZH A;  3USU A;  4E27 A;  5I0S A;  1RUD 2;  1UY4 A;  2HWC 2;  2XG3 A;  1JZ8 A;  1O6U A;  2WZE A;  2FZ1 A;  3RMX A;  1R1A 3;  2EA7 A;  2YU1 A;  3HD8 B;  4XFA A;  3TYJ A;  4EWD A;  1ODM A;  2ZGS A;  2D40 A;  2ZX0 A;  4NRM A;  1QEX A;  3NMB A;  4PI0 A;  3PNA A;  4XF9 A;  5FZ8 A;  1RGS A;  3WG3 A;  4UYB A;  1LES A;  4FI9 A;  4LK7 A;  4C0B A;  4QPI A;  5C3O A;  4LBJ A;  1CIW A;  2RS1 1;  1R08 3;  1STM A;  1SBD A;  2W92 A;  3B9I A;  3ZXA C;  2J1S A;  3BOW A;  2BJS A;  3ES1 A;  3EO6 A;  2G9Z A;  3EQE A;  3RZJ A;  3B93 A;  4AGR A;  3IT8 A;  1LJ7 A;  5EHD A;  3POE A;  1EY2 A;  4TZD A;  2WII B;  5LZ6 A;  1QJY 1;  1RYY A;  3DKQ A;  1QNY A;  1SLT A;  1WCD J;  2QQJ A;  2Y26 A;  2YPD A;  3C2U A;  3KZ4 C;  5IVJ A;  4CRQ A;  1U0A A;  5B4X A;  4NHX A;  5G04 L;  3T0B A;  2PLV 1;  3MFA A;  1AYM 3;  2JB4 A;  4LO8 A;  4JKL A;  1U5X A;  3WP3 A;  2W39 A;  1PHM A;  2X29 A;  1YXW A;  5LK7 B;  3J8F 3;  5F3C A;  1QJE A;  3BKZ A;  3FC0 A;  3WF0 A;  2B45 X;  1NKG A;  3JBG 3;  5FBZ A;  4UWD A;  4KWU A;  3VDA A;  3IIA A;  3ZXD A;  1COV 3;  3S57 A;  1C5H A;  4XW3 A;  4MSV A;  1EYB A;  1T2X A;  1OKQ A;  2PYT A;  1MZ5 A;  2QQM A;  4CUG A;  2XXZ A;  1W28 A;  3MW2 A;  3OPT A;  5GZC A;  5HXM A;  4HPK A;  5FZG A;  2FMD A;  1RUG 3;  3WG2 A;  4RQP B;  2ZZJ A;  3NVC A;  1DYK A;  5C9A C;  4TTG A;  2R7E B;  1US2 A;  4MHR A;  1V6L A;  1BCX A;  3NO8 A;  4U2A A;  2NP0 A;  3OBR A;  3V0B A;  2X10 A;  3H1Y A;  3L2H A;  3VB9 A;  3ZKY A;  4B4P A;  2K9Z A;  1KFU L;  4S2D A;  5EWS A;  2ZGR A;  1UO9 A;  4URA A;  3H8O A;  4C90 A;  1UMZ A;  4XPV A;  2NM1 A;  1FOD 1;  4IE5 A;  5FOJ B;  4A6O A;  1JS9 A;  2BW8 A;  4KU8 A;  1UL9 A;  2DBN A;  5KWR A;  4LE4 A;  3POI A;  3CJI A;  4X6R B;  1GNY A;  1RMU 2;  1OUS A;  4N9I A;  4BQ5 A;  2WT0 A;  3ZFG A;  3E1F 1;  5LB6 A;  4AYU A;  1CAV B;  2Y0O A;  4JGY B;  1X9P A;  2RJ2 A;  4IEU A;  2D3R A;  2NYY A;  2DVG A;  3H50 A;  4HVR A;  4A44 A;  4K6B A;  4EWA A;  2I45 A;  1H6Y A;  2D44 A;  1YQ5 A;  5EV7 A;  1JU4 A;  3GZT B;  4NVP A;  1DDL A;  4X8P A;  2RJK A;  4NIG A;  3O12 A;  1BEV 2;  4Y1V A;  1FMD 2;  2W52 A;  3N9L A;  3AM2 A;  2VOT A;  4FCA A;  5FZL A;  4Z2A A;  1Y7B A;  1I1E A;  1Q8S A;  2HWD 1;  4P00 B;  1W6P A;  3W21 A;  3I59 A;  5LCW L;  1RUF 2;  1Z7S 3;  5J37 A;  3WEZ A;  5AVA A;  2Q1Z B;  5LA9 A;  4LA2 A;  5J3U A;  1LHO A;  4XC9 A;  2BTV C;  1H8T A;  1JBC A;  1BBT 1;  3OGR A;  3UJO A;  1GZC A;  5FTT C;  3ZIX A;  5A1A A;  4XMI A;  1ZZ7 A;  1S55 A;  4IEY A;  4RQP C;  3BOP A;  4AHY A;  1LHV A;  1JZ7 A;  4Y22 A;  1VJ2 A;  4LHS A;  2ZZQ A;  4MGQ A;  2FQP A;  1N3P A;  3V65 A;  4M3C E;  5IW0 A;  3ZFE A;  3OYW A;  1RUD 1;  2HWC 1;  4D7Y A;  1ZZ6 A;  2V5Y A;  5FK7 A;  1JHJ A;  1OHF A;  1UY3 A;  1N3Q A;  1MR5 A;  3KMH A;  1VBA 2;  1WMD A;  3LD8 A;  2QQP A;  2IVI B;  4NHM A;  2X5I A;  5K9Y A;  2P6H A;  1PO1 1;  1KJL A;  5KXE A;  3NWK A;  1H1M A;  1LOG A;  1D2S A;  5JI7 A;  3ILN A;  3I3M A;  1TME 2;  2ZAB A;  4ZU4 A;  1RUH 3;  1SBE A;  3RI8 A;  1AR6 2;  3WHU A;  1AL2 1;  3AYD A;  3PVO A;  2A71 A;  3FFQ A;  3NNL A;  1WW7 A;  3WD5 A;  5B2G B;  2IXH A;  2P37 A;  1OQE A;  1QJU 2;  4KG0 A;  2YBS A;  3MIB A;  4QKF A;  3N9M A;  1UZW A;  3JB8 A;  1OOP B;  3EYP A;  1POV 3;  1O5L A;  2VZQ A;  2WWJ A;  3JD7 2;  4DUX A;  4MV2 A;  4CVU A;  1HX6 A;  2WQZ C;  4AI3 A;  3IKW A;  4X8N A;  4CCL A;  5AVP A;  3LFI A;  1NE4 A;  2YC0 A;  4QB6 A;  4CCJ A;  2E6V A;  5C9A A;  3O1V A;  2ZA9 A;  4XUT A;  4P9Y A;  4FPJ A;  4ES8 A;  4IGP A;  4ONU A;  1E5S A;  3ZSM A;  4LBQ A;  3H1W A;  4AW7 A;  2XJQ A;  2NMN A;  1PVC 2;  4M01 A;  5EXO A;  1X8M A;  4XJZ A;  1YYN A;  2BER A;  3LQC A;  3I2J A;  3SCH A;  1YEW A;  4I0A A;  3RPQ A;  4BJ0 A;  1NY7 1;  1XSQ A;  4MVT A;  4R8H A;  2YGM A;  2HBU A;  4JV4 A;  4E4H A;  1W9S A;  4OI1 A;  3TEW A;  1SMV A;  1XU1 A;  4D6S A;  3T09 A;  1UW8 A;  5CYY A;  2WT1 A;  1GV9 A;  3I2H A;  4AXO A;  1W6M B;  4YZ3 A;  2YYO A;  5EJZ B;  3PUS A;  1QOO A;  5FYC A;  1QGL A;  2VU9 A;  3HBK A;  5FP4 A;  4FPY A;  1ZM1 A;  3AP6 A;  3OBA A;  3V0A A;  2WRA A;  1SLL A;  5ACA 1;  5JI9 A;  2DFB A;  1Z78 A;  2J1T A;  2RE9 A;  3PJQ A;  5FP3 A;  3EHK A;  3VDB A;  2H0B A;  2XLF A;  5T5L A;  4EN7 B;  5FK8 A;  1H30 A;  1OOP C;  4N8M A;  1BZW A;  2BUK A;  3GBW A;  5EYX A;  3OCP A;  1UZV A;  3VBF B;  4M3C F;  1BEV 1;  1FMD 1;  4PDW A;  2WO7 A;  4A6S A;  1UIK A;  4Q4Y 2;  1PMI A;  4Q0V A;  3ACF A;  4CDX B;  3BGA A;  3EBR A;  4DEQ A;  5C3P A;  4QX3 A;  4CA9 A;  1AVB A;  4Z07 A;  1JHN A;  3N9N A;  4D3W A;  1AYM 2;  5IK8 A;  1GQP A;  3AZY A;  4ZU5 A;  1VR3 A;  1EAH 1;  2W2I A;  3E5X A;  1N1V A;  2HWF 3;  4YSF A;  5E88 A;  2WNU B;  3TB0 A;  3AB0 A;  4XDQ A;  1ND2 B;  1UCX A;  4DZG A;  4MYE A;  4QM8 A;  3JBG 2;  1JMU B;  4TXW A;  4AVB A;  4NR1 A;  3PVE A;  4YGD A;  2XVK A;  1URX A;  1VBB 2;  3KLS A;  5CFD B;  3RNS A;  4OI4 A;  2J1E A;  1J3R A;  5T5O A;  1WLW A;  5GM0 A;  1RUG 2;  4JKM A;  2AZ5 A;  5FMO L;  3HVD A;  2ERF A;  2QKD A;  1SLB A;  2LTN A;  1JYV A;  1HN0 A;  3BVC A;  4OZX A;  4WM7 B;  3P5B A;  1VBA 1;  1UY2 A;  4R9A A;  4BMB A;  4M0H A;  1XNT A;  5BNQ A;  3ILR A;  5L9V A;  3IN9 A;  3WX5 A;  2JG9 B;  3LA2 A;  3GZE A;  1VB2 A;  4H7M A;  3RYP A;  1GP5 A;  2BNN A;  3HWJ A;  4QX1 A;  3RZG A;  3SC7 X;  1W2T A;  2F4L A;  1RL3 A;  5IVB A;  4N43 B;  2PHX A;  3KT1 A;  1AR6 1;  3ZXF A;  5C7G A;  4OUM A;  3T08 A;  2AUY A;  1O7F A;  4A7K A;  3GYD A;  1QJU 1;  1YQC A;  4JTN A;  1OUX A;  3GM8 A;  2KM2 A;  1DHK B;  3HEI A;  5FZI A;  3LDB A;  1H2N A;  3VBF C;  2NQY A;  1BKZ A;  1KDM A;  2VMC A;  4Q8K A;  4XJ8 A;  3GZA A;  1RVF 3;  2A3X A;  5FPV A;  4CDX C;  4GB3 3;  1ULO A;  2RS5 1;  5FQ0 B;  3ZYB A;  4CDU B;  2OA2 A;  2XQX A;  2WS9 3;  3CBN A;  1D4M 3;  3QBQ A;  4IXL A;  2VH9 A;  4QGM A;  3SKV A;  3ENR A;  5JSR A;  1W05 A;  3N3H A;  4JAA A;  4LO4 B;  1WCS A;  1K5M B;  2P6C A;  3POJ A;  1TMF 1;  2WNU C;  3UL2 A;  1ENQ A;  1KFX L;  3FBM A;  4UI9 L;  3ZXE A;  1JYW A;  4D7T A;  4AI0 A;  3PJY A;  5BPX A;  1ND2 C;  4CCC A;  1ZRF A;  1DYO A;  5A1L A;  1XB9 A;  1HQW A;  5F2W A;  1PVC 1;  3TN9 2;  4AG4 A;  1IG0 A;  3C7H A;  3RWK X;  1U5Y A;  5CFD C;  2YHJ A;  3VDD B;  3BI3 A;  5FP7 A;  1HLC A;  1JYX A;  1GU3 A;  4JVA A;  3VBH C;  3OPW A;  3AJY A;  1YJL A;  1Q8Q A;  4LK6 A;  4CE8 A;  1SLC A;  2DUO A;  3VHR A;  5FZ6 A;  1H1I A;  3LA3 A;  2ZGQ A;  5DAQ A;  4WM7 C;  5A6X A;  2GC2 A;  3TEX A;  2WFF 2;  3QAC A;  1G7Y A;  2D7F A;  4CU9 A;  3VHN A;  5C6C A;  4CCK A;  5FZO A;  4AOC A;  4AZZ A;  3M3I A;  3MLL A;  1BVP 1;  1H4H A;  1R1A 1;  3MFC A;  2EAK A;  3CKH A;  5DG1 A;  4N9H A;  4MGI E;  2BGO A;  3VD4 A;  4AFA A;  1MZF A;  4BQY A;  4AVA A;  1DYP A;  3K75 B;  3KGZ A;  3GXU A;  4N43 C;  4C8D A;  1OH4 A;  4Y24 A;  2JDN A;  1QQP 2;  3AKR A;  2VG9 A;  3ACG A;  3BU0 A;  4N90 A;  1R08 1;  2W1S A;  3GJA A;  2WAA A;  4QMA A;  4CU7 A;  5F5I A;  1EPW A;  2RS1 3;  2BU9 A;  3AVS A;  5JIA A;  4GAZ A;  3WCS A;  3I4I A;  4MX3 A;  3GJB A;  2WSV A;  1SPP A;  4N7U A;  4Y3O A;  1LNS A;  2Z69 A;  4XBN A;  1YIP A;  2IXL A;  1NQD A;  4CDU C;  3OEB A;  2C4X A;  4E2G A;  4ET7 A;  5DMY A;  2BOJ A;  5CFC A;  5LBE A;  1DQ4 A;  5FY9 A;  1K5M C;  1O5U A;  2DWR A;  5LEK A;  1AYM 1;  3KCX A;  3KD4 A;  2JEM A;  3EXU A;  4V2V A;  3SH5 A;  2ZHK A;  3LEK A;  3J8F 1;  4NAO A;  2VMD A;  2BEO A;  3WW1 A;  4DEV A;  5D21 A;  2RDN A;  4OVE A;  4HON A;  3T2Q A;  2B7Y A;  3VDD C;  3ZXJ A;  3JBG 1;  3RGB A;  3TOJ A;  1COV 1;  3KCC A;  1AR9 3;  3BTA A;  4QXH A;  1QOS A;  3WDV A;  4QB1 A;  3LWC A;  2A70 A;  1XXN A;  1NLS A;  2JB8 A;  1I5Z A;  2RG4 A;  3H1M A;  4FP3 A;  2ZMK A;  4XUR A;  1OSG A;  4O9G A;  4QX5 A;  3ZR6 A;  2VOV A;  5DUV A;  1NZI A;  1RUG 1;  2OPW A;  3UKT A;  1PMJ X;  2WQ4 A;  3AP4 A;  3PHM A;  5T54 A;  2AH2 A;  5FP8 A;  2HEW F;  3MF6 A;  4CDQ B;  2JD9 A;  4EQV A;  4ZY9 A;  1RED A;  2VW0 A;  3N9O A;  3MPP G;  4AE2 A;  2GH8 A;  5I8T A;  4OCT A;  4BQ4 A;  1UU5 A;  1AJO A;  1QOT A;  4URT A;  2GNB A;  1CJP A;  4B1M A;  5LBC A;  1FT9 A;  4QXK A;  1YFX A;  2VEC A;  4OYU A;  4AGG A;  1X33 A;  1LEN A;  3FHI B;  3JQX A;  4P9G A;  3K4Z A;  4AL9 A;  2RM2 3;  4LPL A;  4PLN A;  5FZK A;  2BOI A;  5IK4 A;  3BUC A;  4JDN A;  3ETP A;  1JOD A;  4LHK A;  1JI6 A;  4AFM A;  4Q4V 2;  4LBN A;  2RVA A;  5F8P A;  3WF1 A;  1UMI A;  2HYK A;  1VBC 3;  4A41 A;  3J26 N;  3UJQ A;  1AYN 3;  4WZC A;  3LIG A;  1JYI A;  1E5R A;  2A6X A;  3MIF A;  4COY A;  1CAW B;  4XIL A;  4FPH A;  1O3R A;  4RS5 A;  4BDV B;  4XIO A;  3ZYH A;  4CEW B;  4XCA A;  1REF A;  3AL6 A;  3NV4 A;  4YWA A;  4AI8 A;  5JDB A;  1SQ4 A;  3D6E A;  2VUD A;  3J7N A;  1LCL A;  2BGC A;  4LKF A;  3E6C C;  3GZU C;  3FUQ A;  1NLQ A;  4XHB A;  3VBH A;  3L9J T;  4DNY A;  3D0S A;  1O4Z A;  2QQK A;  3I3B A;  2ADE A;  2AEZ A;  3VBS B;  5A33 A;  1Z7S 1;  5KXD A;  2WWS A;  1Q8O A;  3DUI A;  2HWF 2;  1GZW B;  2VMI A;  2DVB A;  4ISQ A;  4DO0 A;  5DZF A;  4ZZ8 A;  1ZRR A;  2O0O A;  3K4D A;  3SMH A;  1W03 A;  2D98 A;  4CEY A;  4R4Z A;  1I6X A;  1ULE A;  2E31 A;  2VBB A;  1V9U 3;  3LB9 A;  4PLM A;  1UPS A;  2VJX A;  4CP0 A;  5BNP B;  2PAK A;  5FZA A;  5LAS A;  2ZHN A;  4XUQ A;  2W46 A;  1H2K A;  2XJU A;  1OF4 A;  2QQU A;  3HOB A;  3SNM A;  4N53 B;  2VBD A;  1RUN A;  3DPR A;  5FZB A;  5LRR A;  5E8A A;  4HVO A;  2R07 3;  4XFH A;  3Q8F A;  3W9A A;  4AI9 A;  5CG9 A;  2WFP A;  3ZYG A;  4MLO A;  2VOK A;  4JQR A;  3FHA A;  1PGW 1;  1LGB A;  4UF0 B;  2V72 A;  4GIQ A;  3AXE A;  4DUW A;  2DTY A;  2XJV A;  2VMG A;  2LM3 A;  2JG8 A;  3SEP A;  5CZK A;  3RJ2 X;  2N7G A;  5F3E A;  4UW3 A;  3SH4 A;  3N9Q A;  1J3P A;  1RUH 1;  1ZZ9 A;  1DGR A;  2I2S A;  5K0U B;  2VOW A;  2HYX A;  2BNO A;  3OBT A;  3CLP A;  5L36 A;  4LKS A;  4YYO A;  4EYU A;  5FY4 A;  4CSW A;  1GNH A;  3S5A A;  4FPC A;  3AMH A;  1QJZ A;  5FZC A;  1US3 A;  1POV 1;  2K2S A;  5ANN A;  4R9C A;  5J36 A;  3VD3 A;  2GC3 A;  3OTF A;  2G9F A;  3LSE A;  5A3U A;  2OZ6 A;  2JDP A;  5C5U A;  3GCX A;  4YZ5 A;  4IGQ A;  3VBS C;  2WS9 2;  1CAX B;  1CAU A;  2VQA A;  4M4R A;  4P9W A;  1UYY A;  2D6O X;  1C8N A;  3I3D A;  5DPN A;  5IHR A;  4XBL A;  4XFF A;  1CX4 A;  2JDK A;  4WBB A;  3K48 A;  3NKG A;  4CP9 A;  2MNG A;  4RHV 2;  2WZ8 A;  2JDZ A;  5BNP C;  2WBK A;  1W6N A;  2R04 3;  3A4U A;  1DZR A;  4BM8 A;  4QU1 A;  5F1R A;  1RHI 2;  2VMF A;  2XVG A;  4MXW A;  2JE8 A;  2WNV A;  3MV0 1;  4MZU A;  2ET1 A;  4N53 C;  1APN A;  4IV1 A;  5F5C A;  3RVH A;  3THC A;  5JXI A;  1AR8 3;  2CAU A;  4ZS2 A;  3KHC A;  5KXC A;  4RL7 A;  3VBO B;  4HFS A;  3MIC A;  3CL1 A;  4KL1 A;  4ZZ5 A;  4MGZ E;  3OBZ A;  3SIT A;  5JPN B;  3NRU A;  3RS6 A;  3I54 A;  5JXH A;  4LUM A;  2AC1 A;  2ZGP A;  4YG3 A;  2VTX J;  4YAR A;  1F5J A;  3WP5 A;  1VE0 A;  3I2I A;  4ERO A;  1K42 A;  2HEV F;  1QNW A;  5JCT A;  3MBW A;  3NJV A;  1N1T A;  1Q8V A;  3O0W A;  4FPG A;  1Z0H A;  5BY5 A;  2VXJ A;  1FAT A;  1G9C A;  2QDN A;  4L9B A;  1C8M 3;  5K0U C;  4BE3 A;  1PGL 2;  2OUH A;  4E8C A;  4JHZ A;  3HR9 A;  1RMU 3;  2JDU A;  2PHU A;  3SH3 A;  2Q1F A;  2UWA A;  4NHK A;  2W68 A;  2CU5 A;  4M3C A;  1AX1 A;  2WIN B;  1VBE 2;  4RR3 B;  5T52 A;  3THP A;  3ACL A;  2JWP A;  3LF7 A;  3VBU B;  4BXF A;  2G1M A;  4FOV A;  2EIC A;  4LA3 A;  2PHF A;  3AMN A;  2Y6J A;  3N4M A;  1HN1 A;  4NN0 A;  2FCT A;  2Y6L A;  4U36 A;  4H7L A;  3M3E A;  1BEV 3;  4EN6 B;  2ORX A;  5A3N A;  5FPZ A;  2WC2 A;  4UBG A;  3I97 A;  2HWF 1;  2VUJ A;  3MF9 A;  5K4L A;  3VHP A;  1RUF 3;  1CJD A;  4HPK B;  4YG0 A;  2YUE A;  3H3U A;  5JWP A;  2SBA A;  2YMZ A;  4YGC A;  3T4H B;  2GN3 A;  1NCR A;  2ENR A;  3SCG A;  1CQ9 A;  4AVT A;  4J1X A;  4GWN A;  3BIE A;  2DCK A;  4D6R A;  2PHD A;  4B4R A;  5BNO A;  2GP5 A;  1RIT A;  3RWN A;  3VBO C;  4A4A A;  3UGF A;  1O4T A;  2QQW A;  4KWJ A;  3T2O A;  1DG6 A;  1LHU A;  1DP0 A;  2WZR 3;  3ECQ A;  5FZD A;  1WA4 A;  5CEH A;  4P9L A;  3JUU A;  3K4A A;  4Y20 A;  5A7P A;  2GAL A;  4PQQ A;  3T1M A;  1FYU A;  2W94 A;  4A45 A;  4AQT A;  2VZP A;  4B1L A;  1Y4W A;  2VVE A;  3R05 A;  1LKN A;  1VBA 3;  2PFW A;  1UD1 A;  2R1D A;  3H7Y A;  1LOF C;  3M3Q A;  1YHF A;  2RM2 2;  3PUR A;  3S6P A;  1S0D A;  3SKJ E;  5IAX A;  1OXC A;  3WF2 A;  2XOM A;  2DCY A;  2ID4 A;  3KT4 A;  5FY8 A;  1TME 3;  2C1F A;  5FO7 B;  5IK7 A;  4LOT A;  2Q8C A;  1ACC A;  1AR6 3;  4RR3 C;  2W0X A;  1VMJ A;  1V6O A;  3VGI A;  3VBU C;  1W8Z A;  3U37 A;  2GNM A;  5GLW A;  3H3L A;  4CCN A;  1RVF 1;  3FWE A;  5FKB A;  1NLR A;  2ZEY A;  4XFB A;  1KD7 A;  3IMM A;  1W6Q B;  3DEC A;  4GB3 1;  5KXB A;  3JD7 3;  3HT2 A;  5C71 A;  1VAK A;  1WBF A;  1D4M 1;  2JE9 A;  2WS9 1;  5BXX A;  4IES A;  1OA3 A;  3UV9 A;  2XJP A;  2VCB A;  5JOX A;  4QQH A;  3CMG A;  1BLZ A;  5JLV A;  4IW3 A;  5CB7 A;  3MGU A;  2BP6 A;  3R6S A;  4IQP A;  3PME A;  4QU2 A;  4S2G A;  3B94 A;  2BBV A;  5FZF A;  2A6Y A;  1ZA7 A;  4OUL A;  3ZLI A;  3EB7 A;  4HK9 A;  4ASL A;  1CR7 A;  4QPG B;  1G9F A;  1DBN A;  1RHI 1;  3IPV B;  1WMX A;  3ORJ A;  3OYW B;  3J4U H;  4FOY A;  2B39 A;  2Y64 A;  1WW5 A;  2VZ3 A;  4LNV A;  1ZRE A;  1X36 A;  4R9B A;  4NID A;  4I30 A;  1ULD A;  5IWF A;  1PZ7 A;  2DCJ A;  4FSJ A;  3NJX A;  1NYW A;  1ZRD A;  3TEY A;  2XDV A;  5T55 A;  1DQ1 A;  2GAU A;  5ABJ A;  5JZG A;  1HV1 A;  2WN3 A;  2CV6 A;  2VQT A;  4AVS A;  3HNM A;  3LDK A;  3LDR A;  2J7M A;  5C4W B;  4RYD A;  2DYC A;  1MS8 A;  1LB2 A;  4KU7 A;  2QUO A;  4UW5 A;  3BPZ A;  4ARY A;  5DZE A;  3S30 A;  4FFH A;  2P1B A;  2UYA A;  1PGL 1;  1UOF A;  4Q29 A;  1J3Q A;  4JC1 A;  2JIC A;  1C3H A;  3NV2 A;  4ISR A;  4CCO A;  4IER A;  1VAV A;  1Q5O A;  2DDU A;  4Y26 A;  2FDG A;  1F15 A;  2RDR A;  3NNG A;  4JGZ A;  3WSO A;  2EXK A;  3W59 A;  4V1P A;  1YUD A;  1ZBE 2;  5IVY A;  3NKT A;  1ENX A;  1W8O A;  4OUS A;  3CEW A;  4BXS V;  2Y6G A;  1B35 B;  2VZO A;  2EAA A;  4B8E A;  4YW6 A;  1ZRI A;  4J25 A;  4RGG A;  5C3R A;  2D6K A;  3I2D A;  2VY0 A;  4I09 A;  5EJ3 A;  2TNF A;  1OLM E;  4Q4Y 3;  4Z82 A;  1Q56 A;  3FZ3 A;  5FLI A;  2P5B A;  2P3J A;  2Y6H A;  4OLL A;  3WLU A;  3WP4 A;  1FV2 A;  3KS7 A;  3W58 A;  4BPZ A;  1PX3 A;  1MS4 A;  5CVR A;  3MIE A;  5KC6 A;  3GF6 A;  4Q4W 2;  5AC9 2;  3D8C A;  2D43 A;  4QM9 A;  4QPG C;  4BK5 A;  5KHJ A;  4QKB A;  3U78 A;  3A21 A;  3WDT A;  5IK5 A;  1JZ5 A;  1AR9 1;  4PF1 A;  5IVE A;  4D94 A;  2R04 2;  3MW3 A;  3LIH A;  3U75 A;  1VBB 3;  2C9K A;  2VR4 A;  3KB5 A;  4K1Y A;  4XAE A;  4JX0 A;  1AR8 2;  3NAP A;  3N7J A;  3LE0 A;  5C4W C;  2ARX A;  5L7O A;  3GBG A;  3WY6 A;  4W6X A;  1VAM A;  1NCQ A;  5DAV A;  3T30 A;  3LEI A;  1PM7 A;  1PK6 B;  4YM1 A;  4CU6 A;  2LRP A;  1FNZ A;  2DVD A;  2RM2 1;  2ZS6 B;  3T0D A;  2FD8 A;  4AEK A;  3IB3 A;  2FDH A;  4NWV A;  1DLL A;  4XEZ A;  3ME2 A;  4UXA A;  1YIF A;  4N7I A;  1VBC 1;  1RTV A;  3J7L A;  4DXZ A;  3RDI A;  1C8M 2;  1AYN 1;  3T2T A;  2DF7 A;  3WNX A;  3IZO A;  4C1W A;  4WVM B;  1M06 G;  4PDW B;  4O9E A;  4A7Y A;  4YVW A;  3D0J A;  1B35 C;  4K8F A;  2OYZ A;  1CPN A;  3TBD A;  1ZBA 2;  1GQH A;  1ZYB A;  1W04 A;  2YB7 A;  1W3V A;  3QD6 A;  4FXK B;  4QD2 A;  4FBF A;  1OI6 A;  3W5N A;  1AX0 A;  2P3K A;  2VW1 A;  5C8C A;  5D8A B;  4QT6 A;  3WUD A;  4P02 B;  2CDO A;  1PIV 2;  2RS3 2;  4I3P A;  3FLP A;  4A3Z A;  2Q8D A;  3CHX A;  3PUH A;  4W4Z A;  4FFF A;  1WD3 A;  4FP2 A;  1FXZ A;  3TN9 3;  3VKM A;  1V9U 1;  2YBK A;  3D3A A;  2GDF A;  2FHR A;  4NMI A;  1W9T A;  3B02 A;  4G3Y C;  4AHW A;  3B00 A;  1PNG A;  4TYS A;  1WW4 A;  4L99 A;  5E6H A;  5JSP A;  5T5P A;  1JYN A;  2XLG A;  4BCU A;  3S0M A;  3POS A;  3FMG A;  3NV1 A;  3QH6 A;  4IE4 A;  2R07 1;  3FBY A;  1F2N A;  5FJH A;  1WME A;  2WZR 2;  2XKO A;  4L92 A;  1DIW A;  2WFF 3;  1PK6 C;  4LO5 B;  2L9L A;  3UNP A;  2X09 A;  1YFU A;  2WAB A;  2KD7 A;  3CNA A;  1W6O B;  4J6G A;  1R1Z A;  1S0F A;  5FBJ A;  3O1M A;  1HB3 A;  4LT5 A;  1GOF A;  4MGK E;  1O3T A;  4IEZ A;  4Y1Z A;  5J98 B;  4E4S A;  1S1A A;  1YI9 A;  4SBV A;  3VZO A;  1EV1 2;  3ZYF A;  5JOZ A;  2XJS A;  3BN6 A;  4A3X A;  5H9S A;  1QQP 3;  1TE1 B;  2GMP A;  1N1Y A;  1KJR A;  1UIJ A;  4BK4 A;  1OVP A;  1QY4 A;  4BQW A;  1CGP A;  1A34 A;  1YLL A;  3AZW A;  3FN9 A;  3GHM A;  3ZYP A;  4RN5 A;  5FPB A;  2E7T A;  3BB6 A;  4JGY C;  1LGN A;  4GMP 3;  1HIX A;  3ACI A;  2ZTN A;  4JDM A;  4P14 A;  4AI2 A;  2ZBJ A;  2C24 A;  5FZM A;  4CPB A;  4PIZ A;  2RR1 3;  1NA1 B;  1ZNP A;  3WNO A;  4AEJ A;  1JZ2 A;  2ETE A;  1VMF A;  3OPZ A;  4KWL A;  5D8A C;  4HAN A;  2JDY A;  2PMW B;  3IDA A;  2IUW A;  2ZX4 A;  3WNK A;  5FMO S;  4I02 A;  4AQS A;  2W87 A;  3HQU A;  4QXB A;  3IDC B;  1YNA A;  4CUA A;  4ZXE A;  4QDS A;  1H9P A;  5KHH A;  4CXY A;  1HB1 A;  2UWC A;  1KDK A;  3LEG A;  5L9B A;  2R04 1;  4L8Q A;  3HQX A;  3NL1 A;  2QTW B;  1UWW A;  2LAL A;  4IEO A;  3POB A;  3BAL A;  4XMA A;  5I93 A;  2FDI A;  1AR8 1;  4LBK A;  2Y6F A;  4OMC A;  1OPM A;  4XFI A;  4EZ4 A;  1UN1 A;  1QXR A;  2DUP A;  1LEM A;  5FAX A;  4BOW A;  5A6Y A;  5I0D A;  1FNY A;  2QFE A;  4DRR A;  3VZN A;  1KS5 A;  4I01 A;  1PZ8 A;  1RUC 2;  1X82 A;  2IXI A;  1IPJ A;  3MPB A;  2YFZ A;  4Q4X 2;  2ZGT A;  2ZX2 A;  3RSJ A;  2CWS A;  4GH4 B;  2O8O A;  1DGR N;  3GDB A;  2DCT A;  1C8M 1;  2OW4 A;  3VBR B;  4Q4V 3;  1IPS A;  5IAT A;  3M3O A;  1WCK A;  4O65 A;  4ZKT B;  1RMU 1;  4HL0 A;  2ZXQ A;  3G6J B;  4RGK A;  2A6V A;  5I0U A;  3WW3 A;  3K51 A;  5FV3 A;  1H8V A;  5DUX A;  5E89 A;  2E9Q A;  5TSW A;  3H42 B;  3VDC A;  1ND3 B;  5T50 A;  4B7E A;  2BVB A;  5A7W B;  2A6Z A;  1OUR A;  1W8H A;  1JUI A;  1OPO A;  4JKK A;  4AEM A;  4CDW B;  2E33 A;  1YQ8 A;  4IEW A;  1HKD A;  4RQP A;  1OLQ A;  2JE7 A;  4KH9 A;  2DUR A;  5FYV A;  5FXZ A;  3KQ4 B;  1VBD 2;  1S0G A;  4XUN A;  1RUF 1;  4F7Z A;  4PHZ A;  2D3S A;  3OGG A;  4QXC A;  2R30 A;  5JR7 B;  2YGL A;  3R4S A;  4DRV A;  1O3Q A;  3ZKU A;  3LEM A;  4Y1U A;  1R09 3;  2YDE A;  3WDU A;  4QPY A;  4F83 A;  5CA6 A;  4Z1V A;  1AF9 A;  2YC4 A;  4YNI A;  3ZN6 B;  4FFI A;  5LW9 A;  4FAG A;  1FAY A;  4YM0 A;  3LOI A;  4XFC A;  1WD4 A;  2G19 A;  3B69 A;  3ILF A;  2WZR 1;  4BQ2 A;  3ZYJ B;  1Q8P A;  2XVL A;  3B7M A;  2WN2 A;  5GLV A;  4F8A A;  3K3N A;  4M00 A;  2C5D A;  1J84 A;  1HRI 2;  1WZX A;  4K21 A;  3B9C A;  2JJ6 A;  1DU3 D;  2W47 A;  1CAV A;  4B29 A;  2WO3 A;  2D6N A;  2P3Y A;  2ZGU A;  4GH4 C;  4JGY A;  1RUE 2;  1WCU A;  5FPL A;  1LHN A;  1OVS A;  4AQ2 A;  3OD4 A;  4C0H A;  1EV1 1;  3HN3 A;  2O14 A;  1I9R A;  1AXK A;  5DZG A;  2VQU A;  5EQU A;  5KHK A;  5C33 A;  5FUI A;  3ZSL A;  1A8D A;  3OGJ A;  4FPO B;  4BA6 A;  2VBP A;  1TME 1;  5A7O A;  5KR7 A;  3OJB A;  5HCF A;  5L19 A;  2VCA A;  4K20 A;  2RDQ A;  1X50 A;  4QB2 A;  1PNF A;  4ARX A;  3KM5 A;  4Q26 A;  2MEV 2;  5IFP A;  2QZ3 A;  2BV4 A;  4P08 A;  5L73 A;  2DV9 A;  1F5F A;  1ND3 C;  5GZF A;  1QMJ A;  4LTA A;  4AR2 A;  5IVV A;  5C70 A;  5JMC A;  2V5D A;  4PI2 A;  4ZPI A;  3JD7 1;  4CDW C;  1AXY A;  1UZ0 A;  1M4W A;  1XNB A;  3AL5 A;  4XQ4 A;  4XZU G;  1V6K A;  1IS4 A;  2W5F A;  4H2A A;  3ACH A;  3AX4 A;  1JOP A;  4XXP A;  3ZFF B;  3BTZ A;  1S2K A;  1WLC A;  3KHB A;  4LE3 A;  1E5I A;  3AP7 A;  4FFG A;  1D4V B;  1EUT A;  4EE2 A;  5A3M A;  5A70 A;  4H55 A;  4LQR A;  5A32 B;  5M0T A;  2ARC A;  1UYX A;  2R32 A;  5GZG A;  4ITC A;  4XQD A;  2YV8 A;  4J1W A;  1MS5 A;  4QKN A;  4GMP 0;  2XL9 A;  1RUI 3;  1GAN A;  3DPR B;  3NNM A;  4RHV 3;  4A2U A;  3BYW A;  1AR7 2;  3H9A A;  3AKT A;  2VZU A;  2ZGK A;  3ZOI A;  1RHI 3;  3UGG A;  3KVA A;  1TVG A;  3DF0 A;  1ASJ 2;  1TNF A;  4HLT A;  5IAV A;  2PHW A;  2V4A A;  3CJX A;  3NST A;  4IEP A;  4ZXK A;  4F3J A;  2HWE 2;  2GND A;  1PO2 2;  3THT A;  5A3T A;  4Q4X 1;  1XE7 A;  2P17 A;  3WQ1 A;  3PDQ A;  3P3P A;  1LOE A;  3AJZ A;  2TBV A;  2ZHL A;  1D7P M;  2IXC A;  4YW5 A;  3VZK A;  1HB2 A;  1OOP A;  2JG9 C;  3THD A;  3UKV A;  2UYB A;  4OHY A;  2ORZ A;  3Q8A A;  3A0N A;  4YRD A;  4YVS B;  1LOD A;  3ROU A;  3W20 A;  5IFT A;  4OUE A;  3WOG A;  2E51 A;  2WO1 A;  4E8D A;  4LIV A;  1CWP A;  3GBF A;  4KNC A;  2CDP A;  1GWL A;  1VBE 3;  3J7H A;  3E5Q A;  3O14 A;  1DQ6 A;  4LHN A;  5BNN B;  2VW2 A;  1JZ4 A;  1MEC 2;  2EAL A;  3ZFF C;  4LHL A;  4JRA A;  2RR1 2;  3V56 A;  4COV A;  1SCS A;  4UFK A;  4YZ2 A;  5A32 A;  5I8Y A;  1MQT B;  3BU7 A;  2WLQ A;  4Q4Y 1;  4D0Q A;  3FHQ A;  2R06 2;  3RJR A;  2JEC A;  3DKW A;  1F4A A;  1WUV A;  1YWK A;  3MZH A;  1K45 A;  2Q1M A;  3AP9 A;  2CTV A;  2WNV B;  1ULF A;  2ET7 A;  2YG0 A;  3OGS A;  1PX4 A;  3S7E A;  4P9X A;  3UGH A;  1NOV A;  2W9X A;  3AYA A;  2BGP A;  1DGL A;  3FLR A;  1VRH 2;  3O0X A;  2BPA 2;  1VBB 1;  4LIT A;  4KQ7 A;  3C7E A;  5DDJ 3;  2EIG A;  2OQ7 A;  2VZ1 A;  4CP2 A;  1BMV 2;  4YZ4 A;  1K12 A;  1XRU A;  1XYP A;  2O8Q A;  2Y34 A;  2XWB B;  4CCE A;  2EXI A;  2HBT A;  2VE1 A;  3NQH A;  2PHT A;  2WO2 A;  2J1U A;  1MVQ A;  3AFK A;  4E9K A;  4NPM A;  5FOB B;  5HV0 A;  3H3Z A;  3RZM A;  1X7N A;  1X8E A;  2XH6 A;  2VO5 A;  1AL0 G;  3DYM A;  4AAX A;  1AJK A;  1DF0 A;  4V2W A;  5ANQ A;  1LHW A;  3VBF A;  1F4H A;  4Y5Z 0;  3ZMO A;  2AYH A;  3ZXL A;  5JIU A;  5FR3 A;  1ENS A;  4AHZ A;  1OMI A;  4LO7 A;  1HXS 3;  4CDX A;  5AFE A;  3I49 A;  3T0A A;  2FBE A;  5FPX A;  2EF6 A;  5GAL A;  4HZF A;  3FJS A;  1REE A;  2ZAH A;  3WHT A;  2B5H A;  1J1L A;  5BNN C;  1A8M A;  5FLJ A;  2WNU A;  3KV5 A;  1W0N A;  1VAL A;  3OY8 B;  4WVV A;  4AGV A;  1J83 A;  1KGY A;  2VL4 A;  1H4G A;  3MEP A;  4XUP A;  2RMU 2;  4OQ8 A;  1ND2 A;  4IV3 B;  4GXL A;  1MQT C;  5IVC A;  1QJX 2;  5FYU A;  5C8W A;  2D97 A;  4FOW A;  1K5J A;  4QX7 A;  2BZD A;  5CFD A;  3ZPY A;  2EVX A;  3ZPO A;  3DGT A;  3U1X A;  4DXS A;  4C91 A;  5BNO B;  2D3P A;  1UU4 A;  2HKX A;  4Y5T A;  1V6M A;  4MGT A;  4GWI A;  4WM7 A;  1SHW B;  3TN9 1;  1W9Y A;  5FZE A;  3A7Q A;  1R09 2;  4QPW A;  5DXD A;  4Q1R A;  1MZ6 A;  1MS0 A;  4SLI A;  2JG9 A;  3C7F A;  2AEY A;  2EXH A;  4Q0P A;  2Q8E A;  1A6C A;  3QOP A;  4WM8 B;  4AED C;  4DXT A;  2YFU A;  4CDQ C;  1N47 A;  4XQW A;  4N43 A;  2XJR A;  3WG1 A;  2UU8 A;  5F32 A;  4BIF A;  1JN2 P;  1OLM A;  2WFF 1;  1QXP A;  2XGX A;  1UMH A;  1SLA A;  1JH5 A;  4HXC A;  1W99 A;  3U11 A;  5FDB A;  4QQO A;  4YGE A;  1IS3 A;  1LOA A;  2LW8 A;  4JCK A;  2DVF A;  4HKO A;  5EFU A;  3FE5 A;  4A42 A;  1H0B A;  5KBF A;  3RZH A;  4DS0 A;  3HT1 A;  4DIQ A;  1OBN A;  1QQP 1;  1W2N A;  3S7I A;  4CDU A;  4D7S A;  1L7Q A;  4XF0 A;  2BQP A;  5DN2 A;  1UYP A;  1YO8 A;  1J58 A;  4BLI A;  4Y4R A;  4CXX A;  1HB4 A;  5FXV A;  1WW6 A;  3SLI A;  1K5M A;  3AMQ A;  4Y33 A;  5I0R A;  1UOG A;  1PM4 A;  4DPN A;  5CKM A;  2PQS A;  4GMP 1;  4CEW C;  1L7R A;  4IV3 C;  5FMC A;  1IG3 A;  5FYI A;  1QH6 A;  4D8M A;  1ZBE 3;  1BK1 A;  1P8J A;  2RR1 1;  1NT0 A;  3R4D B;  1POQ A;  2WZP P;  3LCP A;  3VDD A;  3PL0 A;  4TSV A;  4HMZ A;  2ZML A;  2R06 1;  1C5I A;  1EPZ A;  1GWK A;  5J96 B;  3B3Q E;  5A7N A;  1NXD 1;  1S0C A;  5FCC A;  5H9P A;  4YW1 A;  2W95 A;  2WT2 A;  1K3I A;  1ZZ8 A;  3AFG A;  3ZXK A;  2C9A A;  4Q4W 3;  3PTR B;  3V64 A;  5AC9 3;  5T3N A;  2ATF A;  2CGP A;  2K46 A;  3F95 A;  3B5L B;  5A7Q A;  1RUI 2;  1N1S A;  5F7U A;  5K7P A;  3WIN E;  4WM8 C;  3O1P A;  3VKO A;  1BMV 1;  2W1W A;  3U4X A;  4IET A;  1HQN A;  3USU B;  2HJI A;  2NLR A;  1Q43 A;  3AZV A;  4MGS A;  2DCZ A;  5GJ6 A;  1UKR A;  3MUY 1;  3AXD A;  4QQL A;  4UAP A;  3MIG A;  5HCA A;  4E4Z A;  1HV0 A;  1IPK A;  4RA0 A;  2ZEX A;  4K8R B;  3PVN A;  1OA2 A;  5LWB A;  3I3Q A;  3KF3 A;  3AYE A;  5KC5 A;  4ASM B;  3EMR A;  4QPI B;  1DQ5 A;  1DQ0 A;  1FV3 A;  1UX7 A;  4IDZ A;  5CAZ A;  3VD9 A;  4FTS A;  3WNM A;  2YXS A;  1GOG A;  3FUO A;  1XNA A;  1HJG A;  1ULC A;  5LBF A;  2J1A A;  1WKY A;  4Q4V 1;  5FXW A;  2Q0A A;  3SIS A;  5C3S A;  3S5Q A;  3TRS B;  1KRI A;  2PAE A;  4KGQ A;  3H7J A;  3I3E A;  2VXR A;  3VL8 A;  5FZ7 A;  1XC6 A;  2D6L X;  5FUN A;  3O0V A;  4YW7 A;  2Y38 A;  4DQA A;  4QX8 A;  5DQ0 A;  5AFB A;  3VKL A;  3KV6 A;  4NHY A;  2RMU 1;  4Q27 A;  1W90 A;  3IAQ A;  4YM2 A;  3AP5 A;  4GKX A;  4IGO A;  4NO4 A;  4EN9 B;  2VMH A;  2VCC A;  1ZBA 3;  2JDM A;  4XOG A;  1GLH A;  2EXJ A;  5FZ1 A;  4NWW A;  1UZZ A;  2JX9 A;  1NQJ A;  4GJY A;  5D1I A;  5FRE A;  2IXK A;  1LU1 A;  4XFG A;  4CDQ A;  4AF9 A;  4W6W A;  4IEQ A;  1LED A;  1NE6 A;  1V6N A;  1W8F A;  3K46 A;  1PIV 3;  2CGN A;  1CVN A;  2RS3 3;  1AUY A;  3E5U A;  4HKL A;  4WVZ A;  3DYO A;  5E16 A;  5F5A A;  3E97 A;  1F8V A;  4FAH A;  1R09 1;  4CYD A;  1O3S A;  3NNJ A;  4FQZ A;  5DUW A;  4E2Q A;  1IS6 A;  4PIY A;  2HEY F;  4NAM A;  3WV6 A;  1UU6 A;  1XE8 A;  1ONA A;  1RIR A;  2NPI A;  4Q0U A;  5DAB A;  3V0B B;  1A3K A;  5DDJ 2;  4NPR A;  3LPF A;  1D0G A;  1XJA A;  5G05 L;  1JU3 A;  5GKA C;  1YFW A;  4KGG A;  1CAW A;  1ZZC A;  2GN7 A;  4CCD A;  2B42 B;  4CEW A;  3KF5 A;  3LPG A;  3CJI B;  4Y1Y A;  1JOB A;  4CPB D;  4ORF A;  3RFR A;  3KSC A;  1CZV A;  4QDQ A;  1J59 A;  3ZFG B;  1G86 A;  1W0O A;  2QQI A;  4QHZ A;  4YVW B;  2VTF A;  1EV1 3;  5KHG A;  2R6Q A;  4MH0 E;  4NHL A;  4XAC A;  4Z92 B;  4G4F A;  4LEJ A;  1H9W A;  1HXS 2;  4HET A;  4O7X A;  1E5H A;  2QCS B;  4UFM A;  5FYY A;  3VBS A;  1QWR A;  3NJY A;  2UY9 A;  2BWC A;  1AXZ A;  1FPN 3;  1GZW A;  1V70 A;  3U4S A;  4ZS3 A;  3NNF A;  4RD7 A;  3ZO0 B;  5C8C B;  2WA3 A;  4IUG A;  1W6P B;  4LBQ D;  2CYF A;  2C6S A;  2PHL A;  3E6B A;  3I59 B;  5ERL A;  4CUB A;  2VNO A;  4M0N A;  5BNP A;  3RZK A;  1WCQ A;  3LZZ A;  4UFI A;  3HIF A;  2BRT A;  1JYC A;  3G7D A;  1KIT A;  1W2U A;  4RFR B;  5LK5 A;  4AK3 A;  4N53 A;  4UW4 A;  1H2L A;  4XYX A;  1NAE A;  1H8T B;  4BB3 A;  3SQO A;  3UT0 A;  3U0Z A;  1RUJ 2;  5GLU A;  2ZGL A;  4P9J A;  2VQ0 A;  3JCI A;  5LAT A;  4MHU A;  1RUI 1;  4RHV 1;  3VKN A;  4DB5 A;  4FQ4 A;  1LGC A;  3MLK A;  4Y22 B;  1W9W A;  5DAP A;  4UF0 A;  3E6D A;  4L97 A;  2A3W A;  3ZFE B;  2BFU L;  1YQ6 A;  3D4K A;  1A78 A;  4XAA A;  2DBI A;  4NUB A;  4NRQ A;  4JQT A;  4FPL A;  1SFN A;  2ZGM A;  1QHD A;  2R1B A;  5I0T A;  5K0U A;  1S2B A;  2K0G A;  1MS1 A;  1SDW A;  3VHO A;  3HNB M;  1NZC A;  2X5I B;  1JZ6 A;  3UES A;  4D69 A;  2VAU A;  1UQX A;  1ZVF A;  3DN7 A;  1RUC 3;  3KT7 A;  4COZ A;  4IE7 A;  2QE3 A;  4TWT A; 
#chains in the Genus database with same CATH homology
 3OEA A;  1GUI A;  3WNO A;  1JZ2 A;  3IDA A;  4MAD A;  1UY1 A;  3WNK A;  4CU9 A;  2EID A;  3HPN A;  2W87 A;  1SDD B;  3OB8 A;  4CUA A;  4ZXE A;  3CKH A;  4QDS A;  5IYY A;  3VD7 A;  1UY0 A;  2BGO A;  3VD4 A;  3LEG A;  3DYP A;  3K75 B;  3GXU A;  1OH4 A;  1UWW A;  1TG7 A;  3K77 A;  3ACG A;  2W1S A;  4OMC A;  2WAA A;  3P1I A;  4CU7 A;  5I0D A;  2E26 A;  2WAO A;  4W50 A;  1LNS A;  2J1V A;  2YFZ A;  3OEB A;  2J22 A;  2C4X A;  4ET7 A;  3SEE A;  5DMY A;  3GDB A;  3F2Z A;  3T2P A;  3LEK A;  1PMH X;  2BBA A;  2VMD A;  2ZXQ A;  4DEV A;  2Y8K A;  3T2Q A;  2W91 A;  4UOJ A;  3III A;  2QBX A;  5LA2 A;  4MOA A;  3VDC A;  4QB1 A;  3HJR A;  4XUR A;  1OD3 A;  2B4K A;  1PMJ X;  4JKK A;  2QQN A;  3MO4 A;  2JD9 A;  1W8N A;  4ZY9 A;  2E33 A;  4KI5 M;  1OT5 A;  1UXZ A;  1O8P A;  2VM9 A;  4XUN A;  4OYU A;  1O8S A;  4MO3 M;  3K4Z A;  4LPL A;  2JDA A;  5JUV A;  2YC4 A;  3ETP A;  4DUV A;  1JI6 A;  2RVA A;  3WF1 A;  1UMI A;  4A41 A;  1GOH A;  2WN2 A;  2EIB A;  1J84 A;  5JMO A;  3CQO A;  4BDV B;  2W47 A;  2XON A;  2WO3 A;  4KMQ A;  3HN3 A;  2VQU A;  2QQK A;  5FUI A;  3CDZ B;  3I3B A;  2VCA A;  3WNN A;  4QB2 A;  4OMD A;  3GGL A;  4ARX A;  4ZZ8 A;  1XPW A;  5IFP A;  4P08 A;  3K4D A;  2Z4F A;  2E31 A;  5C70 A;  2V5D A;  2VJX A;  5B4N A;  3WNP A;  3FL7 A;  1UZ0 A;  4XUQ A;  4XZU G;  2W46 A;  1OF4 A;  2W5F A;  3ACH A;  3HOB A;  3ABZ A;  1H6X A;  1EUT A;  3OG2 A;  4LQR A;  5LA0 A;  3C7G A;  1UYX A;  3C8X A;  3FHA A;  2V72 A;  4DUW A;  4QDR A;  2VZU A;  3SEP A;  4CU8 A;  3CZU A;  5CZK A;  1TVG A;  2W1Q A;  3JXS A;  2QQL A;  3IAP A;  5JR2 A;  2HYX A;  3A22 A;  4LKS A;  4GZ9 A;  1ULP A;  3MUZ 1;  2VME A;  2VZS A;  2W3J A;  1US3 A;  1D7P M;  2QQO A;  2VZV A;  3VD3 A;  1CZS A;  2HLE A;  1EUU A;  3THD A;  2EIE A;  1BHG A;  2VC9 A;  3UET A;  5IJR A;  4YPJ A;  2ZEW A;  4M4R A;  2YC2 A;  2ORZ A;  1UYY A;  5IFT A;  3I3D A;  5DPN A;  1UY4 A;  5IHR A;  4OUE A;  1KEX A;  2WO1 A;  1JZ8 A;  2WZE A;  4E8D A;  5J1X A;  2WZ8 A;  2CDP A;  2WBK A;  3J7H A;  1JZ4 A;  2WYS A;  2VMF A;  4FI9 A;  2JE8 A;  3THC A;  3MV0 1;  4HG6 B;  3W5M A;  5JXI A;  4W8J A;  2W92 A;  4D0Q A;  3FHQ A;  2J1S A;  1YQ2 A;  4ZZ5 A;  1F4A A;  1K45 A;  3NRU A;  5JXH A;  2YG0 A;  3OGS A;  1PX4 A;  1K42 A;  3I2K A;  1RYY A;  3I2I A;  2QQJ A;  4QX0 A;  3WQB A;  3MBW A;  2W9X A;  3NJV A;  5B4X A;  2BGP A;  5G04 L;  5JXG A;  3T0B A;  3C7E A;  2VZ1 A;  4JKL A;  1K12 A;  4E8C A;  3NQH A;  4JHZ A;  2WO2 A;  2J1U A;  4CUC A;  3WF0 A;  1NKG A;  4KWU A;  3VDA A;  2VO5 A;  1T2X A;  3DYM A;  2QQM A;  2EIC A;  2OKX A;  4AAX A;  2Y6K A;  5HXM A;  1CX1 A;  2Y6J A;  3ZM8 A;  1HN1 A;  1F4H A;  2Y6L A;  2ORX A;  4TTG A;  3WF3 A;  2R7E B;  1US2 A;  3CZJ A;  3T0A A;  3I97 A;  1OF3 A;  2X10 A;  2XHN A;  2E32 A;  1W0N A;  3C7O A;  1R64 A;  1J83 A;  1KGY A;  2LS6 A;  2VL4 A;  4XUP A;  5JXJ A;  2DCK A;  4A6O A;  3PUI A;  4A4A A;  2BZD A;  4GWJ A;  1GNY A;  3A23 A;  3T2O A;  1DP0 A;  4XUO A;  3ECQ A;  3E1F 1;  3K4A A;  4PQQ A;  4DXS A;  2W94 A;  4A45 A;  2VZP A;  2RJ2 A;  1NX9 A;  4GWI A;  1SHW B;  4A44 A;  1JZ3 A;  1H6Y A;  1IQD C;  1JU4 A;  3A7Q A;  4QPW A;  3AC0 A;  4Z2A A;  3SKJ E;  3C7F A;  2VOT A;  3WF2 A;  4P00 B;  2XOM A;  2ID4 A;  4DXT A;  2YFU A;  2RV9 A;  5LCW L;  5EJ1 B;  3WEZ A;  2VZR A;  1O59 A;  3WNL A;  3HNY M;  4XVH A;  1UMH A;  1W99 A;  3U37 A;  3OGR A;  4PT6 A;  2LW8 A;  2ZEY A;  5A1A A;  3DEC A;  1JZ7 A;  4A42 A;  4QX2 A;  5C71 A;  2WDB A;  4LHS A;  4L0P A;  4MGQ A;  2VCB A;  1L7Q A;  3P6B A;  3CMG A;  5DN2 A;  1JHJ A;  3WF4 A;  3CIH A;  1UY3 A;  2PQS A;  4M4P A;  1L7R A;  3EB7 A;  4D8M A;  1P8J A;  2Y64 A;  2VZ3 A;  2DCJ A;  3NJX A;  3I2G A;  2WN3 A;  2W95 A;  2VQT A;  3HNM A;  1K3I A;  2J7M A;  4RYD A;  1MPX A;  1NUK A;  1CIY A;  3EYP A;  2VZQ A;  4DUX A;  1I5P A;  4ARY A;  5F7U A;  1UYZ A;  4CVU A;  2W1W A;  4QB6 A;  2DDU A;  4MGS A;  3MUY 1;  3NNG A;  4UAP A;  3WSO A;  4XUT A;  2ZEX A;  1W8O A;  4BXS V;  2Y6G A;  2VZO A;  5EIY B;  2BER A;  1UX7 A;  3MV1 1;  3VD9 A;  3LQC A;  1GMM A;  3I2J A;  3WNM A;  1GOG A;  4BJ0 A;  1XNA A;  1DLC A;  2J1A A;  1WKY A;  2Y6H A;  1W9S A;  1PX3 A;  3T09 A;  5CYY A;  3I2H A;  3I3E A;  1XC6 A;  5DQ0 A;  4BK5 A;  1CZT A;  3A21 A;  5EJZ B;  1JZ5 A;  2W1U A;  3IAQ A;  4PF1 A;  3OBA A;  2ZEZ A;  2VCC A;  2C9K A;  2VR4 A;  2J1T A;  4JX0 A;  3VDB A;  4DXR A;  3I2F A;  3LE0 A;  2WUH A;  3LEI A;  3K46 A;  4CU6 A;  3DYO A;  3T0D A;  3IB3 A;  4P5Y A;  4DEQ A;  3ACF A;  3BGA A;  4QX3 A;  2VZT A;  1GQP A;  3LPF A;  5G05 L;  1JU3 A;  2C26 A;  3VD5 A;  4TXW A;  3LPG A;  2YB7 A;  2J1E A;  5HPO A;  1CZV A;  4QDQ A;  2QQI A;  2VTF A;  4JKM A;  3W5N A;  3OGV A;  2J1R A;  1JYV A;  4P02 B;  2CDO A;  4A3Z A;  1UY2 A;  3PUH A;  4W4Z A;  1XNT A;  3D3A A;  4IUG A;  4QX1 A;  1W9T A;  5LA1 A;  2B9V A;  4CUB A;  5C7G A;  1JYN A;  1WCQ A;  3T08 A;  2JKX A;  3GM8 A;  1NAE A;  3HEI A;  2V4V A;  2L9L A;  3UNP A;  2X09 A;  4OZO A;  2WAB A;  2KD7 A;  2VMC A;  2WQ8 A;  1GOF A;  1ULO A;  1W9W A;  2XQX A;  3SKV A;  3BN6 A;  1UXX X;  4BK4 A;  4UI9 L;  1JYW A;  3FN9 A;  4QAW A;  1DYO A;  4RN5 A;  1SG3 A;  3HNB M;  1JZ6 A;  4AG4 A;  3C7H A;  3UES A;  3ACI A;  2X05 A;  1JYX A;  1GU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...