2RJ2A

Crystal structure of the sugar recognizing scf ubiquitin ligase at 1.7 resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
185
structure length
185
Chain Sequence
GSHMFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDGNVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution
rcsb
source organism Mus musculus
molecule tags Ligase
total genus 39
structure length 185
sequence length 185
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2rj2A00
4W4ZA 4D8MA 2LW8A 4AAXA 3I2IA 5C70A 1L7RA 2WQ8A 3P6BA 2WO1A 3AC0A 3CDZB 2Y6JA 3HJRA 2WUHA 2Y6GA 1UY1A 5DQ0A 2QQNA 2VMFA 2Y64A 1JZ5A 2ORXA 3T0AA 1KEXA 5B4NA 3MO4A 4ZZ5A 4HG6B 1UY4A 4W50A 2JD9A 2ZEXA 3W5NA 3I2KA 3IAQA 1XC6A 2XOMA 4GWIA 3BN6A 3WNMA 4A6OA 2R7EB 2VZQA 4BK4A 1K3IA 4CU9A 2E33A 4ZXEA 3E1F1 3C7HA 1UY3A 5HXMA 2WO2A 4GWJA 2J1TA 2ZEYA 2QQJA 1UX7A 1ULOA 1JYXA 4W8JA 1GU3A 3K4ZA 1W0NA 2VZVA 4AG4A 1PX4A 1TG7A 5IHRA 4OYUA 2Z4FA 3VD5A 4A45A 1CZVA 3CZUA 4D0QA 2Y8KA 3T0BA 1GMMA 1UY2A 1YQ2A 2J1VA 2EICA 1UWWA 4BJ0A 3T08A 3T2OA 3ZM8A 4DEVA 2VMDA 2BGPA 1GUIA 2C9KA 3C7FA 3BGAA 3C7OA 2WAOA 3EYPA 3VD3A 3A23A 2VJXA 3FHQA 3NRUA 2KD7A 2V4VA 4XUTA 3THDA 2JKXA 2WDBA 4XURA 4ET7A 5JR2A 3VDAA 3W5MA 4A42A 1JHJA 5C71A 3WNLA 2BERA 2EIEA 3IDAA 3SEEA 5CYYA 4XUNA 2W1QA 2VCCA 1DLCA 4MGQA 4QX0A 2L9LA 1JYVA 3CZJA 3LQCA 3WNNA 3NJXA 2Y6HA 1HN1A 1W9SA 3I2FA 2QBXA 2WBKA 3K4AA 4XUOA 4JKKA 4QPWA 3OGSA 1TVGA 5HPOA 2RV9A 1W8OA 4E8CA 3NNGA 3CMGA 1PX3A 4DEQA 2E31A 3K75B 2J1RA 2WO3A 3T2PA 3VD4A 3MV01 2W91A 2YFUA 1DYOA 1I5PA 1JZ3A 1JZ7A 5A1AA 2J1AA 3LPGA 1F4HA 3DYPA 1JZ4A 2Y6KA 2VL4A 1UMHA 5IJRA 2V72A 3OB8A 3T09A 1W9WA 4LKSA 1GOHA 2VM9A 2EIDA 3K77A 1KGYA 1UYZA 2X09A 5G05L 3SKJE 4ZZ8A 1EUTA 1ULPA 2ID4A 5JXGA 4P00B 3PUIA 2W46A 3DECA 2VZPA 1RYYA 3A7QA 1OD3A 3OEBA 5JXJA 3I3DA 4QX2A 1LNSA 1OF3A 3P1IA 3UESA 2XHNA 3THCA 1NUKA 1US2A 2VCBA 2VZTA 5IFTA 4CU7A 3WF2A 2WZ8A 1UYXA 4TTGA 3MUZ1 1K42A 2YC4A 5LCWL 3FL7A 5LA0A 4MADA 3I97A 2J1SA 3WF4A 3ECQA 3CIHA 3UETA 3HEIA 4JHZA 5FUIA 3U37A 2VOTA 1CZSA 3F2ZA 2W1SA 2W5FA 1SG3A 1UXZA 4L0PA 3VDBA 2QQKA 1NAEA 4RN5A 4DXSA 4DUWA 1H6XA 2XQXA 3I3EA 3WF0A 4XVHA 4UOJA 5CZKA 2VZUA 3DYMA 4MGSA 2VQTA 2VC9A 4MOAA 4TXWA 3C8XA 5IFPA 5B4XA 2VZRA 3ACFA 3VDCA 1JZ6A 1GNYA 2CDOA 3LEGA 3WSOA 4DXTA 3I2HA 4KMQA 1R64A 3LE0A 2RVAA 1UMIA 4GZ9A 4PT6A 2OKXA 5JUVA 1O8SA 4OMCA 4ARXA 2JE8A 1JU3A 2EIBA 2ZEZA 4DUVA 2WZEA 3VD7A 1GOGA 1NX9A 1NKGA 1D7PM 4PQQA 1DP0A 3NJVA 2QQMA 4LHSA 4A4AA 3OGVA 1JU4A 4QB1A 2ORZA 3IB3A 1US3A 1K12A 4QAWA 5F7UA 1SDDB 1P8JA 2ZXQA 5DPNA 2W3JA 4BK5A 3WEZA 1BHGA 2PQSA 2Y6LA 4OUEA 1CIYA 3K4DA 2C4XA 3WQBA 3LEKA 1F4AA 3K46A 4M4PA 1O59A 2HYXA 4LPLA 5IYYA 2VR4A 3HN3A 1K45A 2DDUA 2B4KA 1XNAA 1JYNA 4CVUA 1JZ8A 2VO5A 3ACIA 2BGOA 4RYDA 1UY0A 4BXSV 2X05A 2VCAA 4CUAA 2E32A 3HNMA 4OMDA 3VD9A 3T2QA 2W47A 3ABZA 1EUUA 5DN2A 3FN9A 2YB7A 2YG0A 3J7HA 4OZOA 4QB2A 2W94A 3WNOA 4ARYA 1UYYA 1IQDC 2WYSA 3CQOA 2WN2A 3OBAA 4JKMA 3EB7A 3I2JA 4XZUG 4KWUA 4QDQA 3IIIA 2E26A 2J22A 2VMEA 5J1XA 1OH4A 4MO3M 4JKLA 1WCQA 3HNYM 3SEPA 4QB6A 4IUGA 3I3BA 2JDAA 2C26A 2VZ3A 1SHWB 1CZTA 2J1EA 1H6YA 3IAPA 3GGLA 4CU6A 5EJ1B 5EIYB 4UAPA 2ZEWA 3OG2A 3LEIA 1UXXX 2QQIA 3NQHA 2V5DA 3OEAA 1PMHX 2VQUA 4QX1A 2YC2A 5EJZB 1PMJX 4ZY9A 4XUQA 2W9XA 4P02B 1GOFA 1T2XA 1JZ2A 2B9VA 3MBWA 3HNBM 2WABA 1UZ0A 2DCJA 4XUPA 2LS6A 4YPJA 1O8PA 2W87A 2X10A 3C7EA 2QQOA 4FI9A 4JX0A 2VMCA 1CX1A 3LPFA 4QX3A 2VZOA 1JYWA 4PF1A 3GXUA 3JXSA 4A3ZA 1W99A 4QDSA 3MUY1 3GDBA 5LA2A 4QDRA 2VZSA 2W1UA 2BZDA 2WAAA 1OT5A 3A21A 4LQRA 2CDPA 3ETPA 1XNTA 3ACGA 5G04L 3HOBA 2YFZA 2VZ1A 3A22A 4UI9L 3PUHA 3ACHA 3OGRA 4CUCA 4DUXA 2RJ2A 4P5YA 5JXIA 2HLEA 1OF4A 1L7QA 3SKVA 3WNKA 2VTFA 3WNPA 5JMOA 4CU8A 4M4RA 1J84A 2WN3A 3WF1A 5DMYA 2W95A 5I0DA 3GM8A 3FHAA 1W9TA 1J83A 1MPXA 1XPWA 3HPNA 4A44A 3WF3A 5LA1A 1JI6A 1WKYA 3MV11 5JXHA 4KI5M 3CKHA 4E8DA 2BBAA 4A41A 3UNPA 4P08A 4Z2AA 2DCKA 2QQLA 2W92A 3C7GA 2XONA 4BDVB 3I2GA 5C7GA 2W1WA 3D3AA 1GQPA 1W8NA 4CUBA 3T0DA 3DYOA 2J1UA 2J7MA 4DXRA
chains in the Genus database with same CATH superfamily
3WW4A 4IGOA 1V6NA 3AFGA 4C0HA 1TMF3 4CZSA 1I1EA 1WCDJ 3LFIA 3P6BA 2WO1A 4Q2FA 4GULA 4Q4X3 1AHSA 4CEYB 1YRZA 2EXHA 1J3PA 1LHNA 2JECA 1RHI3 4ASMB 5L9VA 2D97A 3AZXA 1W39A 2NPIA 3N7JA 5K0UA 2VW2A 4QKFA 5A7OA 2IVIB 3OUJA 5J7MA 5K0UC 4D6RA 2DVDA 1X8MA 3FJSA 3RYKA 5B4NA 3BTZA 2R32A 4IEPA 2W0XA 1LENA 5JVVA 3MO4A 4XTMA 4HG6B 4B1LA 5IK7A 3URFA 3BB6A 5FP3A 2XXZA 4CEWB 2KA3A 5J09A 2ZPXA 3DF0A 2BRTA 2HJIA 2RM22 2R7EB 1KITA 1NQJA 3E6DA 1EP0A 4ZU5A 1AR83 4BK4A 1ZRIA 4QQHA 5LB6A 4K9SA 1YIPA 2ZHKA 2E33A 4XF9A 2HWE1 1UOGA 1I9RA 2NM1A 2Q0AA 3WQ7A 2BVBA 4AVTA 4Z2WA 4QPYA 4KWJA 5HXMA 1TNRA 5FYTA 4GWJA 5FY0A 4D6QA 4FT8A 1W9YA 1UOFA 2D6PA 2WR9A 1GYKA 3WX5A 3ZYFA 1VAKA 4CDXC 3NKGA 1GQGA 3CL1A 3ZN6A 1V6IA 1E5HA 4HKOA 4LOTA 1JYXA 3K4ZA 4IEQA 2VZVA 4QMAA 4AG4A 1QIQA 1PX4A 1KXGA 4YVSB 5FREA 3BI3A 4OYUA 4Z82A 1WMFA 4L9BA 4TLGA 1ZYBA 1V9U3 3AMMA 5I0RA 1WCUA 3CZUA 4OVEA 4AFBA 3O7OA 1BBT3 4D0QA 2GC1A 4EN8B 2NP0A 2J1VA 2EICA 2VY0A 4WM7C 3ZYBA 5GLUA 3V0BB 5FZ7A 5HV0A 1GWKA 3ENRA 3KT1A 1R093 4LBNA 1CX4A 2K0GA 3LGRA 4XC9A 5A7SA 3BU0A 3JB4C 2ZX3A 3ZSKA 1J3QA 1GUIA 2C9KA 1SFNA 2IFRA 3ZYGA 1IKPA 2CY6A 4K21A 4TN7A 1ENXA 3ZIXA 2G9GA 2PYTA 4XHBA 5F37A 3IPVB 3NAPA 5F2WA 3ITQA 4OCTA 4XBNA 2YGMA 4IERA 1LU2A 2NZ9A 5FZ9A 5ABJA 3E6CC 2PXJA 2ZGKA 3FHQA 2KD7A 2V4VA 3I2OA 2ET1A 3VUOA 5F3EA 1ALYA 2ADDA 4Z1VA 4GWMA 5FOBB 5LK7B 4HSLA 4QKNA 2ZX4A 4A42A 5GZCA 4IV3B 2BJSA 1DDLA 1XSQA 4B3NA 1RC6A 4R4ZA 2PLV3 3WNLA 4RR3C 3IDAA 4JVAA 5CYYA 5A7NA 3JU9A 3MIGA 4NIHA 4U36A 1ASJ2 3G7DA 4CP9A 1FPN1 4MGQA 4Q0UA 4LR4A 1OLRA 1TE1B 3CZJA 3LQCA 3WNNA 2JG9A 2XL9A 3NJXA 3MEPA 3KCCA 5FPUA 1UNBA 1HN1A 3I2FA 3WNXA 1MS8A 2QBXA 2PAKA 3R4DB 4JKKA 4QPWA 3SNMA 3ZXJA 4BMBA 3OGSA 2ZZJA 1ZZCA 4Q4W2 4BXFA 3RQ0A 1PZ9A 5HPOA 1GICA 1W8OA 3QH6A 1YJLA 2YXSA 1RUD3 2PFWA 3JD72 3MW4A 4LUMA 1IPJA 4FXGB 1C5IA 1JUHA 5GLTA 5GLWA 4OHWA 1NA1A 4CU9A 2BOIA 2J1RA 1HLCA 2NQYA 2ADEA 2XVKA 3D6EA 2EXKA 1S0GA 1NZCA 5AFBA 2VOXA 2B9UA 1RUF3 1C3HA 1JZ3A 2D7FA 1Y7BA 1AXZA 4ITCA 3VBHA 1WLWA 5DUWA 5AC91 1F4HA 2VBBA 3LSEA 1O4YA 4XQDA 3AJZA 1C8NA 4RQPA 5ACA3 4CTEA 3VZKA 3AYCA 2Y6KA 2YZ4A 1UMHA 1CJPA 4WVVA 3OB8A 2BDRA 1L7LA 1I5ZA 3OBTA 5FKBA 2ZGTA 3O1VA 4LHKA 1S0IA 3VDDC 3GCXA 4LO6B 4M0HA 5BY5A 1S0CA 3J7NA 5CFCA 4XETA 3BIWE 3WDTA 2EIDA 3SITA 3K77A 1KGYA 4CCEA 2LRPA 4XCBA 5G05L 2VNRA 2VBPA 3M3CA 1GR3A 2A6VA 5FZ0A 2DCZA 4IE5A 1JN2P 4Q27A 4A7ZA 4KGQA 4AFAA 1WMXA 4SLIA 5J48A 5F6KA 5FLHA 1OA3A 4JAAA 4R8HA 1BQPA 4XFAA 4FFHA 2XGXA 3A7QA 4QT6A 5ERLA 2Q8EA 4FTEA 1OD3A 5FZLA 5JXJA 4MHRA 1Z7S1 4QX2A 4CPBD 3MF6A 1LNSA 1ULGA 4JV4A 3WD5A 5EHDA 4DQAA 3UESA 3MHZA 4AEKA 4GWNA 4ZU7A 2OXBA 1NUKA 3AM2A 2O0OA 4IE7A 4Z8BA 4ATEA 5CG8A 1QU0A 2MPFA 5T50A 4X8NA 3O0VA 4WBBA 4FOWA 1LGNA 5A33B 1QQP3 1YFWA 5EQUA 5BNOC 4UXAA 5I0UA 4TTGA 4CP1A 4MXWA 3FL7A 4NN0A 3ZSEA 1RUC3 1W2AX 3CJIB 2Y34A 4K6BA 3J26N 2QZ2A 5LA0A 5FUPA 3I97A 1GNZA 4HN0A 5CFDA 4HPKA 1O5UA 1BVP1 4MYEA 4FAGA 5FK7A 1W2UA 3KMHA 4FPKA 4Q4Y1 5FZIA 4B8EA 5CFDC 3CIHA 1AF9A 2VXRA 2XJQA 2B46X 4NHXA 5CKMA 3RWNA 4BIOA 1T6GC 5LBFA 4JHZA 1XXNA 4OZXA 2F6BA 2YUEA 1WCSA 3VZMA 3ZFEB 4WVMA 4YG3A 3NV2A 4P9JA 1CAUB 2R1DA 1UXZA 1RXFA 2I2SA 2YMZA 2ZGOA 1OQEA 2GSYA 5A7QA 3VZJA 1D4VB 3S6PA 3USUA 2WFPA 3VDBA 4GH4B 3P3NA 1RUNA 5DUVA 2CWSA 1G8WA 3RI8A 4CCMA 2MEV3 2WZR3 3D0JA 3AZYA 4C8DA 5DG2A 3I59B 3ZVXA 2GC0A 1OFNA 1QEXA 3IBMA 2RDRA 3GZEA 1MEC3 4WV8A 2UYBA 5FXZA 1W8HA 1W8FA 4XFIA 5E89A 2ZKNA 2HWD3 1RMU3 4XVHA 4LA3A 5CZKA 1QJY2 2KR2A 2O14A 4CXYA 1OFSA 1WUVA 3C3VA 1RUG3 3DYMA 4ZS3A 1YCIA 4MOAA 4IW3A 4RHV1 3NJYA 5FP8A 4AEJA 3EJKA 1PIV2 2R072 2PMWB 1AX2A 2XQRA 3ACFA 3H42B 1JZ6A 4RL7A 3N9MA 1VBE1 1X33A 2DCTA 4EROA 5C9AA 4XYXA 3HQUA 4XDOA 3TBDA 4ZXKA 5C9AC 3I2HA 2DVGA 3FFZA 4LK6A 4Y22A 3B93A 4LJHA 1LEMA 4XHXA 4N90A 5SV5A 4AR2A 2FMDA 2HWF2 4IESA 4IEVA 1SLLA 1O8SA 5GKAC 4ARXA 4E2QA 3KS7A 4ZU4A 2DVFA 1JU3A 2AENA 2ZEZA 2WZEA 2RR12 2YYOA 4CDWB 5FWEA 2AEZA 5L9RA 1GP6A 2X8KA 3SMHA 2RJKA 1RUE3 1BJQA 5FOJB 4DINB 2OIIA 3ME2A 2JDUA 3P5BA 4AVCA 4PQQA 1RJ7A 1Z0HA 3NJVA 4OI1A 2HEVF 2FCUA 4WM8A 4XBQA 4LXLA 2FDJA 3O12A 4WM8C 1XYNA 1HV1A 1F5JA 1PK6A 1KS4A 2OUHA 4LKFA 1SDDB 3VKOA 3AYDA 2XBO3 2W3JA 4QHOA 2E7QA 1PK6C 1BHGA 2Y6LA 4OUEA 4CDUC 2JE9A 5JOYA 1ZRFA 2R062 1F4AA 1PM7A 3KHBA 1DYKA 1O59A 4EE2A 5A32A 1QDCA 4F83A 1A34A 3V0AA 1ND3A 1DGWA 3GYDA 1K45A 3BODA 2DDUA 1RVF2 2B4KA 1LKNA 1VJ2A 1ND3C 1PNFA 1CGPA 2WNVC 4CVUA 2QUOA 4RYDA 2ZX2A 2P37A 4Q0SA 1JYCA 1EV13 5FPBA 4BA6A 5A3MA 1Q8OA 3H1YA 3HVDA 2PA7A 3NNFA 3AKSA 1EUUA 1R1A2 3FBMA 5DN2A 1WW4A 2YB7A 3J7HA 1PGW1 1UYYA 1IQDC 1ZBA1 2WYSA 3CQOA 5FO8B 2GMEA 2YDEA 4XZUG 4KWUA 1JHNA 4AVAA 1SLTA 1HXS2 1IG3A 3AVRA 1D0HA 3IIIA 2IXIA 3VBOA 4JTOA 5J1XA 4D94A 1OH4A 4MO3M 1NLSA 3FX3A 5JLVA 2FDFA 1UZYA 3OY8B 4NWVA 3VBOC 3FHIB 3FBYA 1SPPA 4HFSA 3KHCA 4Q0VA 4N9HA 1X7NA 2RMU2 3GHMA 3J8F3 4QB6A 5D21A 1HV0A 4O7XA 3DKQA 5DDJ3 5IWFA 1WZXA 3I3BA 3ZYHA 4OI4A 2C26A 2BWCA 1BMV1 3MPPG 1H6YA 1NCRB 1VBA2 4PLMA 3JZVA 5EJ1B 3PURA 4BQ4A 1AYN1 1GANA 2C6SA 5IVYA 3O1PA 4QQOA 3IKWA 3LEIA 1RUF2 5LZ6A 2WNOA 3W58A 1RUI2 1UXXX 5FZBA 2X5IC 2V5DA 4YFWA 3VHPA 4XMIA 2XL7A 4HSJA 5K4LA 1LECA 1SLIA 2OZ6A 5FZFA 5FMCA 3RFRA 4ZKTB 3N9QA 3PHMA 4MX3A 3WUCA 3H8OA 1PO23 4META 4P02B 2A3YA 3MICA 4HVOA 4I02A 1GWMA 2W39A 3N7KA 5LA9A 3ZX7A 5CKNA 2DFCA 5FTTC 2FCTA 1KJRA 4LBQA 1C8M1 1W6MB 1VBC3 3Q8FA 4MZUA 3FMGA 2D6LX 2W87A 3KT4A 2XJVA 3OD0A 4DOUA 2FDKA 1AVBA 3ZXEA 3KSCA 2BWAA 1LGBA 4NUBA 5HCHA 4QPGB 2HKXA 1UD1A 1YO8A 3E5QA 1AYM3 2DVAA 4JX0A 1AL21 1TME3 2VMCA 3IT8A 2XHKA 2WFF2 4R9DA 4XEZA 5I0TA 2D44A 1RGSA 4BU2A 5A3TA 2VW0A 1VRBA 3LPFA 4FPHA 1CX1A 5B2GB 2Z5WA 1JYWA 4OHZA 2Q1MA 2XWJB 1H0BA 4UF0A 2DTWA 1W99A 2JDPA 1YLLA 3N36A 5FMOS 5T5LA 4W6WA 4E27A 2AZ5A 3GDBA 4LO4B 4ATFA 5EYXA 3KV6A 3JBG3 1A6CA 2WAAA 4LE4A 5FY1A 4AAPA 1S0JA 2WYFA 1EAH2 1UOJA 4JGZA 3ZFGA 5KXCA 1QQP2 5D8AC 4CSWA 1JBCA 1AUYA 3AYEA 4RFRB 5C5TA 1B35B 1BKZA 1V6OA 1FOD2 5KXEA 1NZIA 3SH5A 1XNTA 5DZGA 4EV0A 1UIJA 5KWRA 3CBNA 3HOBA 4LLFA 3U4XA 1DFQA 3O5SA 2UWAA 1OQDA 3A0KA 3PUHA 2GC2A 2RS32 5KBFA 4EWDA 2RJ2A 1W6OA 2UY8A 4P5YA 4NIIA 3O1RA 2XLGA 1OF4A 4AI8A 5FXWA 5A7WA 1ZRRA 2JKBA 1RUJ1 1MR5A 5JMOA 3ZDVA 2SBAA 1J84A 4PDWA 4Q4V3 1W90A 4O65A 5A3OA 4IV1B 1GNHA 3ILFA 3GM8A 4PDWC 5KHGA 3WDUA 4D6SA 5FRAA 1W9TA 4Q29A 1TZOA 4JCKA 3NVCA 5FP4A 3VBUB 1MEC2 4PQ9A 4GMP0 1V6MA 2O8OA 3ZO0B 3AMHA 1OI6A 2R042 2XG3A 2DF7A 4TLFA 5HCAA 1W3VA 2IXKA 3EBRA 1RUH2 4FPGA 1OKQA 3GBGA 1S0DA 4YZ1A 3UNPA 2AYHA 2HWB2 1ND2A 1ODMA 4LO5B 3T2TA 2JDYA 4X8PA 2DCKA 1SMVA 3JQXA 3QH7A 5FZ3A 1ND2C 1W6NA 2XONA 3AKPA 1YQ8A 3APBA 5FQ0B 5FYZA 4BDVB 1D2SA 2ZAAA 1VMHA 1H9WA 3D3AA 5D2AA 2W2IA 2VTXA 5KXBA 2XJUA 3ELNA 3T1MA 1XOYA 1O5LA 1U0AA 1BK1A 3MLLA 4DXRA 1IZ3A 2P6HA 2FZ2A 4D8MA 2LW8A 4AAXA 4AZZA 1DQ0A 1W8TA 4Y33A 1DGWX 1N3OA 4K20A 2OQ6A 3TN93 3UJQA 5LEKA 2RS53 3CDZB 3LZZA 1SDWA 5KHHA 1R083 4OQ8A 1XBFA 2RS12 2RM21 3B01A 1O3QA 4MGTA 2WJSA 5DQ0A 2QQNA 1JZ5A 1H2NA 4FOVA 4A7KA 2ZOEB 4EN9B 3T0AA 1KEXA 5F5AA 3RVHA 3TAYA 2WS92 5GALA 2E51A 1W6QA 4XE9A 5FYMA 4ZZ5A 3I3MA 2JD9A 5FXXA 3VBSB 3J7LA 2QCSB 5EJ3A 4CE8A 1QJX1 4Z92B 1LULA 3IAQA 2YPJA 3IDEA 4YSFA 2YY1A 2E53A 3BN6A 1S1AA 3WNMA 1X50A 4NMIA 4LBOA 2VZQA 3DEMA 4IQPA 1AR62 3AK0A 2IVJA 2UWBA 4OHVA 2FDIA 1IG0A 3ZYIB 3LF7A 3ST7A 3C7HA 1MS9A 3AYAA 1MVQA 1NLRA 2WRAA 4I2OA 3KM5A 4LBQD 5IVFA 4H7MA 1G7YA 3VBFA 1JW6A 4PIZA 2UWCA 1ULOA 3VBFC 1RTVA 1GU3A 4XFHA 1W0NA 1WBFA 4CUGA 1CVNA 2GZWA 3VD5A 4UW6A 4A45A 3X29B 1UPSA 1CZVA 4LE3A 2OZJA 3R4UA 4FOYA 1ZA4A 3T0BA 1UY2A 2BYVE 3RG0A 3WCSA 1MACA 3T2OA 2VCMA 3ZKUA 3R4SA 3ZSMA 4EN0A 4GJZA 3ZIWA 4FAHA 4AYUA 4YVWA 3ZFFA 3GZTB 3FE5A 3QD6A 3WDWA 3RNSA 4P9YA 1CJDA 3ZPOA 4Y1UA 5FZOA 3ZFFC 4NPMA 5I0SA 2ZMLA 1QJU3 3ZSJA 1VRH2 1WBLA 2VJXA 3AKRA 1STMA 3H8UA 5KC6A 4R4XA 5A7PA 2WSUA 4R52A 3THDA 4ZS2A 4IEXA 2WDBA 4XURA 1N1VA 2YBPA 1RXGA 1CONA 2W52A 3QOPA 5IK8A 5T54A 3NAPB 5ABJB 3MI8A 3ZN5A 4Q4W1 5FYUA 3ZXFA 2VOKA 3WQ0A 4SBVA 3AP5A 3JD71 3DGTA 4GB32 3SEEA 2CU5A 4QPIA 4XUNA 5FZ6A 3UGHA 3WG1A 1O3TA 3S0MA 3N9PA 4P9GA 1YFXA 2IC1A 4Y26A 1JYVA 5H9RA 2EAKA 2JENA 1HKDA 3EXUA 4QGLA 2BNMA 1LOEA 1UKRA 3KVBA 3K4AA 4XUOA 1D4M3 5A1FA 2PQQA 4CP9B 3O1SA 5FZ4A 1HRV2 2RV9A 1HB2A 3H3ZA 4N53A 4B4RA 2JG9B 1PO13 4N53C 2DV9A 4XFFA 1PX3A 3KGLA 4R9AA 5FLJA 1ULDA 3VN4A 4UBGA 2WO3A 4ZONA 2WIIB 2UU8A 2EAAA 4FP3A 1YQCA 2W91A 2YFUA 2YBSA 1DQ4A 4M01A 4XZPA 1I5PA 5AVAA 1IPSA 1VBD3 2O8QA 3CJXA 4H3WA 4Q26A 3LPGA 1NA1B 2MHFA 4HKLA 1QH6A 1E5RA 3DYPA 5C3OA 1JZ4A 4MGKE 5BNNB 2AGSA 5IJRA 2B8MA 2V72A 3NV4A 2H0VA 3T09A 1VMFA 2JIJA 4LKSA 3VBHB 2A5ZA 1UX6A 2C0ZA 1RITA 1UZWA 2XKPA 3E5UA 4NHMA 5FYYA 5J96B 3WHUA 4RQPB 3GBFA 3LAGA 2VU9A 4QQLA 5CU1A 1O3SA 3TNQA 1UYZA 1ZBE2 4O61A 5L7OB 3ON7A 4ZZ8A 5FWJA 1EUTA 2ID4A 3KQRA 5JXGA 1OOPB 2HWE3 4NHLA 4XF1A 3UKVA 2R30A 3PUIA 5CFCB 4IE6A 1M06G 1MS4A 2E63A 3SC7X 3DKWA 2V09A 4N9IA 3WV6A 5I8YA 4HONA 1N3PA 1HQNA 4PBPA 1DZRA 4I09A 2LUWA 3PIJA 4LA2A 4NHYA 5BV6A 2ARBA 2K2SA 2XUMA 3UKTA 1XNKA 3HQXA 1VE0A 4KU8A 1CN1A 5JZGA 2ZACA 5C3QA 2XHNA 5FLIA 2OT7A 5JZGC 2WSVA 4FQZA 5GLVA 3VKLA 4LBKA 4LBMA 4INDA 2W68A 3IMNA 1IGOA 4TWTA 2WZPP 2VCBA 2D93A 4NR1A 4Q1RA 3RYRA 1IHMA 1OSGA 3PLQA 4CU7A 1X9TA 2WZ8A 4NOTA 3FWEA 4ONUA 2H6CA 4CDXA 3MUZ1 1GZCA 1TMF1 4IE4A 3ALQA 5E88A 5JOZA 4COZA 3LOIA 1QJX2 4HXCA 4XIOA 3ZXDA 2ENRA 4AVVA 1GBGA 1SCRA 4BLJA 3RSJA 4KGGA 4Q0PA 1ST8A 5ANQA 1LOFC 1QOSA 2Y6FA 1GSLA 3ECQA 2CGNA 3UETA 3RWKX 4EJRA 4YLZA 5FUIA 5IAVA 1CZSA 3JB8A 3LA2A 4BISA 4WM7A 5CFDB 1Q3EA 2JJ6A 4XACA 1SG3A 4PI2A 3OCPA 1QJY1 1AR92 2ZMNA 3CU7A 5HCFA 3ZYJB 3FZ3A 2JDKA 2QQKA 5A80A 4AHXA 4GXLA 1PIV1 2R071 3U07A 2ZGPA 2XPJA 4H14A 4HK8A 1ODNA 1LU1A 2PAEA 3CLPA 3J9SA 1FPN3 1X82A 1F5FA 3S57A 2HWF1 4IGQA 4KU7A 5T52A 4S2DA 4ASLA 2V73A 1JUIA 1XRUA 4QXHA 3RYPA 2VQTA 3OPTA 1CIWA 1SLBA 2ZX1A 3B02A 1H1AA 2A3XA 3MYXA 1RB8G 2RJLA 2OYZA 1PGL2 5IFPA 5B4XA 3VDCA 4RR3A 1GNYA 2A6WA 2RR11 2CDOA 2ZAHA 3WSOA 3MLKA 2VNGA 4UFMA 4AFDA 1NCQC 4YW6A 1YFUA 2DUQA 2WKKA 1C57A 1V9U1 4YGCA 1D2QA 1WMDA 2OW4A 4X6RB 3B9IA 2FDGA 4QXCA 3PUSA 3M3OA 4Q8KA 3L9JT 4GZ9A 1IPKA 4QGMA 2PN5A 5JUVA 4MG2A 3I54A 4OMCA 2BW8A 2JE8A 5C8WA 1C5HA 4E4ZA 1AR72 4PI0A 4Y22B 5CKQA 4BIFA 5AC93 2GU9A 3HR9A 5L19A 5F5CA 3VD7A 2R061 5A6YA 4XF0A 3NNMA 2IWGB 3FLRA 1VBB2 1FMD2 4YW5A 4QQ2A 5F3CA 1RVF1 5DZFA 4EZHA 3RJ2X 2QQPA 2ETEA 4AOCA 4LHSA 2QQMA 4FPFA 1MZ6A 1QF3A 3TB0A 3OGVA 3UT0A 1JU4A 3C2UA 4QM9A 4C0BA 5F5QA 3Q8BA 2CV6A 1K12A 3BYWA 5F7UA 1CAXA 2CHHA 5I8SA 4COYA 1KFUL 1P8JA 3CO2A 5DPNA 1CQ9A 1NYWA 1POV1 3WEZA 1EPWA 5FR3A 4N43B 3K4DA 2C4XA 5A6XA 4H2AA 1ZRDA 5GZDA 3K46A 3POYA 2PLV1 1R1A1 4WM8B 2JB8A 2HYXA 4LHNA 4XFBA 5IYYA 2ZKLA 3HN3A 5FK8A 5C8CA 3QLQA 2ATFA 3VDDA 3WDXA 1CD3G 1PK6B 2XVGA 3I2DA 4RA0A 4D7YA 5A3NA 5C8CC 3RDIA 4LORA 1H8TB 1OHFA 4CDQB 3ACIA 1XYOA 2VMGA 5FZCA 1QDOA 2BGCA 4HOOA 4BXSV 2X05A 1C1LA 1K5MA 1HXS1 1UAIA 1V6JA 4OUMA 1Z7S3 4UW4A 4CUAA 1K5MC 2VECA 3AKTA 1UMZA 4P9LA 4OMDA 3VD9A 3KV5A 3NNLA 1Z78A 4GMP3 1Q8QA 3ABZA 2RMU1 3WDYA 3BALA 3NV1A 4AK3A 4FPCA 2VE1A 4OZOA 3U75A 3WNOA 2WN2A 1C1FA 1RL3A 4CEYC 1VBA1 1URXA 3S5AA 4FPJA 2PHRA 5I8TA 2DWRA 1H8VA 2CGOA 1HW5A 4BPZA 1RUF1 2BUKA 1FX5A 1RUI1 1ZA7A 4LLOA 4AW7A 3S5QA 5LRSA 1A8DA 3WY6A 1WCQA 4Q4Y3 4NVPA 4XXAA 3ZMOA 1QJEA 3QCWA 5CISA 1BVVA 3A0NA 3HN1A 3WCRA 1ENSA 2AH2A 1G86A 2JDAA 1H1MA 1LHVA 2PHLA 3LEMA 3BKZA 5BNOA 1CZTA 4CEWC 3N9OA 1SPPB 4FTBA 4CU6A 2WNUB 4Y20B 5LRRA 1AJOA 1E5IA 4UAPA 5LK5A 3NL1A 1LHUA 2I45A 5J3UA 2B42B 2HWC2 2AR6A 1N1TA 4YW4A 3DN7A 1S2BA 3H1WA 2TBVA 4CCDA 2BEOA 2P4EA 3BU7A 5EJZB 3ZKYA 1A78A 5L36A 2ZMKA 4ZY9A 5H9SA 3V65A 4Q1PA 4XUQA 2VUJA 2W9XA 5JSRA 5M0TA 4A7YA 2WFF1 4YVSA 4YGDA 5C5UA 1BYHA 1TMF2 2B9VA 3OBZA 1YHFA 4YVSC 3WOGA 5BNQA 1IOAA 1N1YA 2WABA 3HNBM 4GALA 4RHV3 4Q4X2 5FZGA 1O8PA 1RHI2 3LA3A 2VUAA 3GZAA 5IVCA 1VBE3 4LNVA 5HBAA 2X10A 3C7EA 2FZ1A 4XW3A 2B7YA 2CWMA 5EV7A 3RGBA 2A1XA 4LBQB 1EAH1 1XNCA 3HT2A 2RE9A 1QQP1 2D6NA 4JRAA 1VB4A 2VZOA 4NRQA 5CG9A 1E5SA 5F32A 5CVRA 2PHXA 3GJAA 4Y1XA 1FOD1 5C3PA 3JXSA 2X29A 1JMUB 1YEWA 5FPZA 4JDOA 1J59A 5IAXA 4QDSA 3WINE 3AZZA 1AR82 2JE7A 4UT5A 3AMPA 2VZSA 4CXWA 2BZDA 5F3GA 3A21A 2Y38A 2RS31 5KR7A 2VOWA 2OPKA 2ARCA 4FFGA 4IV3C 1COV3 4UF0B 5EYYA 3U78A 3TYJA 2D6OX 4HETA 5FYSA 4XPVA 2XB6C 4AI3A 4YG6A 3OSDA 2QQWA 3ETPA 1ENQA 4RGAA 5T5OA 2RDNA 1X8EA 4OHYA 4AF9A 4H7LA 5LASA 3ZFGB 4JGZB 3M7AA 1OMIA 4LO7A 3ACGA 1ZZ9A 1NXD1 1F9KA 1VB2A 2DYCA 2WZR1 4YZ2A 1F2NA 3A22A 4EWAA 1JYIA 5E8AA 5E6HA 1MS3A 1O4TA 1V9U2 1MEC1 4CUCA 3R0RA 4AFCA 5KHJA 5FYCA 1BBT2 5K8SA 2HLEA 3MIDA 1XJAA 3LFMA 2R041 1FXZA 5EXOA 1SFYA 3SKVA 1RUH1 5CIRA 2VTFA 4HN1A 3N9LA 3WNPA 2JDNA 1R092 2XKOA 4IETA 2HWB1 4M4RA 4CDUA 1W03A 4QWNA 3WF1A 3BTYA 3PJQA 1V70A 1MQTB 1W6OB 2W95A 4FPEA 4K40A 3DL3A 5DXDA 5FIXA 4AEDB 3L2HA 3WXPA 5A7WB 2D43A 5BNPB 2WNVA 3UKNA 4D3WA 2XWBB 4A44A 5FZAA 3WF3A 1JI6A 3KF5A 1Q8VA 1WKYA 2O1QA 2QTWB 5FY5A 3MV11 5JXHA 1W6PA 3CKHA 4E8DA 1OXCA 4UFLA 4P08A 4BM8A 1H2MA 4BOWA 4PBOA 2QQLA 1SLAA 1XE8A 4CCOA 2W92A 2WWJA 5JSOA 2RS11 4C1WA 1LOAA 1BCXA 2PLV2 1HRI3 2W1WA 2EA7A 3DPRB 3HT1A 1GQPA 1S0FA 2A6ZA 4QX8A 5GLZA 2JG8A 1DQ5A 1QXJA 2WO7A 4XILA 5A3PA 2HBUA 2PHUA 2J7MA 3CF6E 3BOWA 5FUNA 2JG8C 3N7LA 2WS91 3GALA 5C70A 3I2IA 1YXWA 3POEA 4PLOA 1VAMA 3TRSB 5GZEA 3D8CA 3FFQA 1AYN3 1U12A 4QXBA 4XJ9A 3O1TA 3O0WA 3AC0A 3WQ1A 4MLOA 1ONAA 4AVSA 3KQ4B 5LY1A 4NIGA 2Y6JA 2F4PA 2WUHA 2WQ4A 2Q8DA 4WZFA 2Y6GA 1HB4A 1UY1A 1AR61 1RUD2 1PGSA 2VMFA 4Z07A 3WR0A 4E4HA 2ORXA 1AXYA 4BQWA 1OQ1A 4FXKB 3IDCB 1QOOA 2R0FA 5JAXA 4JGYB 1XSRA 5F3IA 4W50A 1SFPA 4BZ4A 4A2UA 4FVVA 4CCJA 5LBCA 2X5IA 1C8M3 1E57A 1S0EA 1Y43B 2QKDA 3I2KA 4S2GA 5HCBA 5C3SA 1XC6A 2JD4A 1NE6A 4LHLA 4PCRA 4A6OA 5K7PA 4AI0A 2DUOA 1W6QB 1AJKA 4U2AA 3F95A 3VKMA 5ACA2 4PHZA 4K7JA 1HN0A 4ZXEA 3E6BA 2GN7A 4NO4A 2CL2A 3OOXA 4Y3OA 3CJIC 3TEXA 5FFOC 1AL23 1UY3A 2YPDA 3NJZA 2J1TA 3H3UA 4URAA 2ZEYA 1JS9A 3H7YA 4DRVA 3RZHA 2ZGQA 4K1YA 1DQ2A 4BQ1A 4AVBA 3LB9A 4S2FA 3MFCA 2A3WA 5DAQA 3UJOA 3WZ1A 4MGIE 2NMNA 2K46A 1TNFA 4W8JA 4BWOA 1W8ZA 2B45X 3ZPYA 1CAUA 1QOTA 1TG7A 3ZFEC 2Z4FA 2PHWA 1OA2A 3LDBA 4GH4A 1N47A 5F6LB 4YM3A 5F1RA 2WLPA 1VRH1 4GH4C 4JQTA 1OURA 2Y8KA 1LOCA 1OKOA 1GMMA 1YQ2A 3VZOA 5FCCA 1UWWA 2BNOA 4BJ0A 5IVVA 3T08A 5A3LA 2A73B 2ES3A 4DEVA 2GNMA 3S7IA 1OUSA 3Q9OA 4L92A 2BGPA 5HV4A 3N4MA 3MIFA 4C91A 2GMPA 3C7FA 4W6YA 1W2TA 3NWKA 5FPLA 5JIUA 1HX6A 4GB31 4FPYA 5DABA 3ROUA 5JCTA 3WT3A 1RJ8A 2Y33A 5D8AA 1D0GA 1PVC3 3PDQA 2OS2A 1NY72 3NRUA 1LODA 1O3RA 1W04A 4XUTA 3EO6A 3IMMA 5KC5A 4COUA 5C4WB 2PHDA 4B7KA 4ET7A 4YVWB 2QE3A 1RUJ3 1RUC2 2XJSA 3ATGA 3POBA 3VDAA 4DXZA 5JR2A 3VHOA 5FZOB 1I3HA 1JHJA 3NNJA 5C71A 3MZHA 4CCLA 5A70A 2RG4A 5E1RA 1HRV1 4FBFA 2P17A 4KBBA 2BERA 4BQYA 1KD7A 4IE0A 2VNVA 4XCAA 5SV8A 2W1QA 1O91A 1V00A 1N3QA 1IKQA 2KXLA 1SLCA 4XDPA 4QX0A 2L9LA 1S2KA 4CDWA 3LWCA 5A3UA 4YWAA 3KV4A 5IK5A 1AL0G 4LO8A 3DCQA 4CDWC 3ZYPA 2Q1ZB 5EPAA 1DQ1A 1A8MA 2B39A 5DAWA 4QPIB 4LIUA 1G9FA 5F9TA 2ZTNA 4IDZA 1DYPA 5F5IA 5HI0A 5JI9A 1UU4A 3UGFA 2MEV2 2WZR2 5FJKA 1CR7A 1KJLA 2KM2A 3OYWA 3VBRA 3VBRC 1GZWB 1QMJA 2F4LA 4RGGA 4QHBA 2HWD2 2YC0A 1RMU2 3VZLA 4GIQA 3VD4A 3MV01 5T3NA 4UBHA 1SBDA 4YGBA 2QNKA 1RUG2 5A6QA 2GNTA 1NG0A 1Q8PA 4ASKA 1CPMA 5JR7B 5A1AA 1ZBE1 2J1AA 2RM23 3U0ZA 4NAMA 3HBKA 3BUCA 2GDFA 1BEV3 1WW5A 4LKDA 5DAVA 1REFA 4LT5A 1WW6A 2DTYA 2VMIA 1QJZA 2GP5A 1MS0A 2ZHNA 1GOHA 1OD5A 1H2KA 2VGDA 4J6GA 2WT1A 1FV3A 4E4SA 2VVFA 4HKWA 4YZ5A 2IZWA 1QNYA 1WA6X 2BQPA 3TWIA 3VKFC 5I93A 5JIAA 5IW0A 5JDBA 1Q8SA 4HL0A 3T4VA 1ENRA 1RUE2 1W0PA 2VUDA 4UYBA 2ZGUA 1Q43A 3RMYA 3UYJA 5IVBA 3D0SA 1YJKA 2VZPA 3K3NA 3UV9A 2Z79A 1H1IA 5K0UB 2BOJA 4YW7A 4XTPA 3RRDA 2C1FA 2XBO2 2D3SA 2VG9A 3N7MA 4D69A 1YQ5A 1VLNA 2ZGMA 3I4IA 4GD4A 1H2LA 3ORJA 4OI0A 1NCRC 2BU9A 3THPA 1FAYA 1US2A 1W0OA 4B4QA 3RJRA 2CAVA 4AHYA 1JXNA 2D98A 1QXRA 1ZZ7A 1GFF2 2VZTA 2PAMA 5FXVA 5J98B 4IXLA 5IFTA 3RZZA 1UYXA 1YI7A 2GAUA 1K42A 3K48A 1AR91 5LCWL 1DGLA 1EV12 3HQRA 5FO9B 3ZSLA 3LD8A 1Y9QA 4MADA 2TUNA 3T4HB 4D7TA 2J1SA 1WGPA 3LOBA 1WD4A 2H6BA 4YW2A 3WF4A 3HAGA 2VBDA 2V4AA 4CDXB 3HEIA 1KS5A 1NLQA 1W8UA 3PTYA 2IXCA 1ASJ3 2VOTA 3ZN6B 1ZREA 3DUIA 4GA9A 2XMLA 3BPZA 2W5FA 3PVEA 4D7SA 3Q8CA 4QPGA 5LATA 3KD4A 2ZX0A 1APNA 2Q30A 3GHNA 4Q8LA 4OLLA 1Y3TA 4QPGC 1PGL1 4Y4YA 1SZBA 4Q4W3 2IXJA 4WM7B 2P3KA 5I91A 3J8F2 3JD73 3K51A 3M70A 4I0WB 5DDJ2 1LOBA 3OPWA 4XJUA 4QU2A 4DXSA 5IT6A 5JWPA 1LESA 3IIAA 4JDMA 4DUWA 1CESA 3WP5A 2XQXA 5FPAA 3I3EA 4FCAA 1VP6A 2YROA 1LHWA 1LOGA 1BK0A 3MIHA 3MPBA 5L73A 4Y4RA 1LAJA 5FZHA 2LM3A 2VZUA 2PHFA 4F7ZA 1O4ZA 4QKDA 2NN8A 4XF3A 4TXWA 4CRQA 1AR71 4AGRA 2VZRA 1DBNA 5A1LA 2YGLA 4DIQA 2C5DA 4AHWA 4YZ4A 4UW3A 1BLZA 1VBB1 1B35A 1FMD1 4DXTA 5CA6A 3VLBB 5IVEA 3FLPA 1B35C 1PO22 2GMMA 4KMQA 1R64A 3LE0A 4RR3B 1LJ7A 3AX4A 1C28A 2UYAA 1NOVA 4PT6A 4Q5OA 5FY4A 2OKXA 4B4PA 4DNYA 5C3RA 4XOGA 4YRDA 4AQSA 1CAVA 2WWSA 1VBC2 1OUXA 5FZEA 2Q8OA 3RZJA 4DUVA 1GOGA 1NX9A 1OA4A 2CAUA 2QDNA 4PF5A 1J58A 3O14A 5FZMA 5L9BA 4L97A 2A6YA 1X9PA 3VGIA 1R1ZA 5AVPA 3RZGA 4L11A 4Y1YA 1AYM2 1D7PM 3R05A 1TME2 2Q4SA 4Y1ZA 1DP0A 3N3HA 3SCFA 4B1MA 3B69A 4IV1C 5FBZA 4QB1A 2ORZA 3IB3A 1US3A 1V0AA 4QAWA 3SQOA 5H9QA 2VQ0A 2VQAA 4G9SB 5FMDA 3VBUA 3BTAA 4TZDA 5J36A 2ZZQA 2ZXQA 4DO0A 2VW1A 4BK5A 3VBUC 2PQSA 2I74A 2JXAA 2R0HA 1CIYA 3WQBA 3LEKA 4LBJA 1VAVA 4M4PA 2YHJA 3H3LA 1YWKA 4LPLA 5K9YA 3JBG2 3BOPA 3TEZA 1XNAA 4DPNA 2Y60A 1JYNA 3WW1A 1JZ8A 1XU1A 3GBWA 1TEIA 3O1MA 2BGOA 1ZM1A 1UY0A 4AL9A 4QQPA 3VL8A 1G9AA 3UL2A 4GKYA 1GV9A 2WQZC 4RGKA 2E32A 1U5ZA 4RS5A 1ZRCA 1UYPA 3HNMA 3KV9A 1DCSA 3H0OA 2OA2A 3VDDB 4RS5C 5CNAA 3T2QA 4V2WA 4GJYA 4EQVA 1HJFA 2G4IA 4K1ZA 5BXXA 2FQPA 4I30A 4ARYA 4QB2A 2W94A 3KF3A 3OBAA 3J4UH 3VKNA 1SBEA 4JKMA 2BBVA 4JZRA 4XAAA 3L2YA 3I2JA 1O6UA 1U5IA 4TYSA 1K5JA 4H55A 1SACA 4QDQA 4I0BA 3B94A 4GKXA 2E26A 2J22A 3CNAA 2Y26A 4XQWA 3IWZA 2HWC1 2HEWF 1VBD1 4Q4V2 3T1LA 2ARXA 3DXUA 5EP9A 3HNYM 3D5OA 4KWKA 4B7EA 1POQA 3VBSA 1G9CA 3H50A 4XJAA 4UW5A 3MF9A 3VBSC 4YGEA 1W8WA 2VZ3A 2BFUL 1SHWB 1ZZ8A 3T3YA 3VHRA 1N1SA 3KCXA 5GZGA 3AJYA 3IAPA 1CAWA 4BQ3A 4KG0A 2XR4A 3D82A 1QJY3 3NMBA 4DS0A 3V56A 4NPLA 5EIYB 2NLRA 3W59A 1QGLA 1J3RA 1LOFA 4M3CF 4Q4X1 3CHXA 1PIV3 2R073 1RHI1 5BNOB 3OEAA 2A6XA 1PMHX 1YQ6A 4CPBA 1PZ8A 4C90A 2JIGA 4IEZA 1J1TA 1PMJX 1BEV2 2WLQA 4F8AA 4MXWB 3BCWA 5FYVA 1RUOA 2DCYA 1VMJA 3OD4A 3ZXLA 4HT1T 4HPKB 1GOFA 1T2XA 4PJYA 3ZR5A 1LRHA 2HWF3 4RFT0 2PTMA 1HIXA 4KL1A 4XAEA 5APAA 1UZ0A 3RMXA 3TN92 4HVQA 2P3JA 2FBEA 2RS52 1Y9MA 5FBJA 1QXPA 1R082 4FFIA 1QWRA 2BP6A 3IM0A 2RR13 4WVMB 1QHDA 1AR81 4M3CA 1DG6A 2QQOA 4J1WA 4M3CE 4ES8A 2XDVA 3OTFA 3USUB 4FI9A 3WG4A 3OBRA 1XQNA 2VULA 5CEHA 1AZDA 3PMEA 3LIHA 1I6XA 2DBIA 2F17A 4JHTA 3ZXGA 5CB7A 4DFSA 3U1XA 4NIDA 4WZCA 3LSDA 1X36A 2R063 3ES1A 3I8TA 4KWLA 1NCQA 3UGGA 1YYNA 3M3QA 2W1UA 2A7AA 1OT5A 1RVF3 1DGRA 4ZPIA 4LQRA 4NAOA 4CCCA 2UURA 1BBT1 3NAPC 5ABJC 2D6KA 4I3PA 2R49A 1REDA 2CDPA 3AL5A 4UWDA 5T5PA 5C9AB 2XH6A 1YFYA 1R091 1W3XA 3PVNA 5FZ1A 4LKEA 3T30A 1POV3 1YNAA 4EN7B 4AWDA 4J25A 2WA4A 2YV8A 3ES4A 5FP7A 4CA9A 3POIA 1R1A3 3S30A 4CP0A 3TOJA 3B3QE 4UI9L 5FV3A 1G9DA 1QH7A 1ULEA 3CEWA 2VNOA 3OGRA 1J1LA 5DZEA 5FZDA 1KRIA 4UFHA 2P1BA 3H8XA 1IS6A 1HXS3 4HANA 3WNKA 1FNZA 4AE2A 2AEYA 1TQ5A 1UZVA 2JG9C 1Y4WA 1O7FA 2WN3A 4B29A 2ZABA 1MZFA 1PM4A 5DMYA 5I0DA 3POGA 3FHAA 4E2GA 2RMU3 1C4RA 5CAZA 2CNAA 1J83A 3ZYRA 3P3PA 4IL7A 2J42A 1QJU2 2P34A 4CDUB 4DRRA 4XFCA 3A4UA 4BLIA 5T55A 5HXVA 1SBFA 1VBA3 2GH2A 2YU1A 4MVTA 1NA1C 3TEWA 5DUUA 5A32B 4ZHNA 5BNNA 1FATA 3V0AB 1ND3B 3KT7A 4AQ2A 2WNVB 2E7AA 5BNNC 3FLTA 1RUI3 5FY8A 3PUQA 3C7GA 2BV4A 4YM1A 3BIEA 2D5HA 4BH9A 4DZGA 2D3RA 5C7GA 2JDMA 3VBHC 4FPLA 1RUD1 1W8NA 1W6PB 5A6ZA 3RS6A 4CEYA 4XDQA 4RQPC 4CUBA 4M0NA 3B00A 2J1UA 5C6CA 3D4KA 4NRPA 1OLMA 2P3YA 1GP4A 3WP3A 1OLME 3LDRA 4W4ZA 3ZOIA 5L7OA 5L7OC 2GH8A 1L7RA 1SQ4A 2N7GA 3PL0A 3B7MA 1OOPA 4OUSA 1WLTA 2CYFA 2JEMA 2WQ8A 5GM0A 1YC61 2D40A 2ERFA 1OOPC 1D4M2 4QX7A 1DGRN 2VMHA 1Q5OA 2JG8B 4YZ3A 3HJRA 4BQXA 2ILMA 4ES9A 5CFCC 3M3EA 4MGZE 4PLNA 2QQUA 3FUQA 1GKBA 3M1HA 4P9XA 5FY7A 3SH3A 1BZWA 3KCYA 5ACA1 2ARAA 2Y64A 4XMAA 1PO12 4CEWA 1DQ6A 2RDQA 3VBOB 4XQ4A 3IN9A 1EYBA 2IXHA 3PVBB 1T6BX 5FP9A 3VHNA 2G1MA 2WFF3 5FY9A 1JOPA 1UY4A 2Z42A 3PTRB 3IDBB 3I7DA 2ZEXA 3USSA 3W5NA 1S2EA 3KZ4C 2XJPA 2P5BA 3AP9A 4PIYA 1UCXA 1VBD2 1L3JA 2XOMA 4GWIA 5D1IA 4AQ6A 1GQHA 2ZJCA 3AXEA 3HBZA 3OUHA 3QBQA 1K3IA 4GMP1 3WW3A 2WL1A 4JQRA 3ZR6A 2X5IB 3E1F1 1EAH3 4XXPA 1XE7A 2WO2A 1VIWB 3LIGA 2VUCA 2Z69A 4X6QB 4MV2A 4BHPA 4KNCA 2QQJA 1UX7A 3WG3A 1FOD3 1V6KA 1DHKB 1H4HA 5H9PA 5BYNA 2AUYA 3O0XA 1UIKA 3KB5A 3PUAA 2XJRA 5CADA 1WWYA 2JWPA 3HMYA 5IHRA 3V0BA 5EFUA 4N8MA 2HWE2 4AQTA 4YW3A 2RS33 2YU2A 2SLIA 3Q8EA 4GQ7A 3TEYA 1NY71 1QKQA 3NKTA 2Z2SB 3NSTA 4Z2AA 1IS3A 1U5XA 3IPVA 4LIVA 2BPA2 4S2HA 1RUC1 4AFMA 1SCSA 3B5LB 3ZM8A 2VMDA 4EYUA 4JTNA 2WA3A 2RHPA 3FC0A 1SEFA 3BGAA 2Q5TA 4UFJA 3NW4A 1AX0A 2GP3A 2QQVA 3C7OA 3WDVA 2WINB 4COVA 4IV3A 1PHMA 2WAOA 3EYPA 3VD3A 3THTA 3A23A 1DIWA 2VOVA 3WP6A 4TSVA 3BVCA 2D3PA 2R043 2UY9A 3DXTA 5F39A 2DFBA 2JKXA 1RUH3 5JPNB 1W05A 3HD8B 4P5HA 3W5MA 3LA7A 2HWB3 1OH3A 2QVSB 3H7JA 1HQLA 4Y24A 5D8AB 3E5XA 4NIAA 3PNAA 2MEV1 4HLTA 2EIEA 2NYYA 5A3WA 2PELA 5CBLA 2MNGA 3POFA 2IFWA 4NHKA 4XJZA 4BB3A 5J37A 2VCCA 1LEDA 1DLCA 3TNPB 4QU1A 1W28A 2HWD1 1RMU1 3PU3A 4ORFA 3M8LA 5LBBA 3U10A 3JCIA 2Y6HA 1W9SA 3AP4A 2WBKA 1RUG1 4K3UA 1H9PA 1JYTA 2NMOA 1XB9A 1PMIA 2RS13 1TVGA 1UO9A 2P2KA 5FYBA 4HVRA 4E8CA 3NNGA 1DZQA 3OGJA 4YYOA 3ZDSA 1ZBA3 3CMGA 2WWUA 1S55A 4L8QA 1FPN2 2WC2A 4Y5Z0 3VL9A 4DEQA 4I0AA 2WS93 2E31A 2I07B 1GLHA 2A70A 3K75B 3NO8A 4N43A 1YUDA 4PDWB 1COV1 3T2PA 3I49A 4N43C 4XJWA 2OUJA 3SXWA 3EQEA 4KQ7A 4RD7A 5FPVA 1DYOA 1QY4A 2LTNA 3OYWB 4LEJA 3VBRB 3WVJA 4Q0QA 1G6NA 2VAUA 1JZ7A 3ASIA 1OPMA 1ULCA 4CDQA 1H8TA 4OQ9A 3AL6A 1U5YA 4OI2A 2OX0A 4DY3A 4CDQC 1H8TC 4LBLA 1AR63 1MS1A 5JSPA 3U14A 3U4SA 2VL4A 3LKJA 4QKBA 1RUE1 2XLFA 1Y9GA 2H0BA 2CTVA 1ND2B 3OPZA 1W9WA 2G9FA 1W6NB 2IXLA 2LROA 1WD3A 2VM9A 2TNFA 2B5HA 1HJGA 4R9BA 4V1PA 4KH9A 4DB5A 3NV3A 1Q56A 2XBO1 2ZHLA 4MHUA 2X09A 4JC1A 3SKJE 5AC92 5IATA 3SHRA 1ULPA 3OUIA 3GCWA 4BMEA 1W2NA 4P00B 2HH9A 5C33A 4L2NA 2EXIA 1F15A 2W46A 1XNDA 3DECA 5JMCA 1S0BA 4AHZA 1REEA 5FDBA 1RYYA 5GJ6A 5LW9A 3OEBA 3EHKA 1YIFA 3I3DA 5FZ8A 4JDNA 1EV11 1OPOA 2HEYF 4HK9A 2EIGA 3VB9A 5A33A 2FMYA 1OF3A 4FSJA 3GZUC 3WP4A 3WLUA 3P1IA 1MVEA 5AFEA 3FUOA 4CCNA 2WNUA 2ZGRA 4Y20A 2EXJA 5LY2A 3BPSA 3THCA 1HRI1 3CJIA 2WNUC 2ET7A 3SCHA 1DZTA 1YI9A 3J7MA 1ZZBA 4GAZA 1VRH3 4A3XA 3RZMA 3WF2A 3AZWA 4FO9A 4NWWA 3POSA 4AGGA 2DU0A 2YC4A 3SCGA 1UL9A 1Z7S2 3OJBA 3EMRA 3E97A 3ZFEA 4P9WA 4WVZA 1GZTA 4FPOB 5BUVA 4MSVA 4R9CA 3MGUA 1KFXL 1OLQA 4HMZA 3J8F1 4EN6B 3BTXA 4GB33 3QACA 4V2VA 5DDJ1 2FCVA 4BCUA 3U37A 3VBFB 1UZZA 3RZKA 1QNWA 5KXDA 4BYYA 4OULA 4FOQA 3F2ZA 3H9AA 2W1SA 3I59A 3V64A 4YG0A 1UKGA 1GP5A 3ETQA 4IEOA 2C9AA 4L0PA 1DU3D 2YBKA 1GWLA 5LEJA 2QJVA 2GNBA 1PVXA 2OQ7A 2ZS6B 4RSUA 1NAEA 1UN1A 1HRV3 2ZGSA 3I3QA 4KBZA 2BNNA 2AC1A 2K9ZA 2W08A 4Q4Y2 1AXKA 1KDMA 3IZOA 4NROA 4RN5A 3PVOA 2WT0A 5EWSA 1POV0 5E16A 2HBTA 1H6XA 1PO21 2IUWA 4DMIA 4XJ8A 2E9QA 1NQDA 2R16A 4MXVA 2VVEA 3RZLA 3WF0A 4UOJA 1PNGA 3RPQA 2GC3A 3ZFFB 1XNBA 4MGSA 2VC9A 1AX1A 4OFGA 2QZ3A 2C24A 2Q1FA 1VBC1 1WA4A 3C8XA 2WT2A 3N9NA 1LCLA 5LWBA 5DAXA 3ACLA 1UU5A 5DG1A 3LEGA 1LHOA 4K8FA 1AYM1 1TME1 2BVVA 2G19A 3M4FA 5FYIA 5JPMB 4E2SA 3ZFGC 4JGZC 2EVXA 2Y0IA 2RVAA 4YARA 1UMIA 4COWA 4CP2A 1EY2A 4RHV2 1MS5A 1XU2A 2EIBA 1ZBE3 1ZNPA 2GALA 3LDKA 1VBE2 3DV8A 1KQRA 1WLCA 4NJ4A 4DY5A 4LOSA 2VPVA 3JBG1 3W20A 5F8PA 1NKGA 4XF4A 5IVJA 1CAVB 1PVC1 3AZVA 1MQTA 4Y5TA 4AEDA 2JB4A 4A4AA 1HQWA 2E7TA 5JOXA 1MQTC 4AEDC 4N53B 5BNPA 1JH5A 5FYHA 5FMOL 1JODA 1F35A 5BNPC 4C1XA 2GN3A 1F31A 1G9BA 3OF1A 1UPIA 1QJFA 2FDHA 4XBLA 4AI1A 4NPRA 1HB1A 4YM2A 1GZ9A 1UW8A 1MZ5A 2OPWA 3HIFA 2VR4A 4OHXA 2OVUA 4I01A 2R6QA 1ZZ6A 3MLJA 1WLDA 1COV2 4W65A 3JQWA 4HZFA 5F2SA 2VO5A 3DPRA 3G6JB 2VCAA 1KDKA 2XUEA 4EZ4A 4E9KA 5ISLA 1QJX3 2JX9A 3DPRC 4W6XA 1RINA 4KG8A 1ULFA 1UOBA 4N7UA 1FNYA 1V6LA 4Q4V1 2W47A 2DU1A 5ANNA 3PIGA 4EWEA 3FN9A 1WCKA 5TSWA 4G3YC 3ZXKA 3ILNA 2YG0A 2ZBJA 3OY8A 4L99A 1H4GA 4M00A 1LTEA 2JICA 4RS5B 2XVLA 5IK4A 3M3IA 3EB7A 4YM0A 5GZFA 5KHIA 5FJHA 1AR93 2VD7A 4LTAA 4CCKA 4QX5A 4ISQA 1EPZA 1FT9A 2VMEA 1RIRA 2EALA 3KGZA 3VZNA 4JKLA 4P9IA 1NCRA 4O9GA 4JGYA 4IEWA 1A3KA 3SEPA 4JGYC 1HDKA 3KWVA 2GNDA 4ISRA 4IUGA 1BEV1 4AGVA 1ZX5A 2VTXJ 1CPNA 3ZXAC 1PGW2 1IQAA 3K2OA 4UFKA 2D5FA 1ZBA2 3PJYA 1OC1A 2J1EA 5JOWA 5JZGB 4FTSA 3GGLA 1CWPA 1W9FA 1LGCA 3AMNA 1JOBA 3KVAA 2LALA 1S4CA 3WW2A 1H30A 2RDSA 2V5YA 1ACCA 2VH9A 3TN91 2EF6A 2ZEWA 3OG2A 2VXJA 2RS51 2JDZA 3ZN4A 4QHZA 1R081 2E6VA 2QQIA 3NQHA 2VQUA 4QM8A 4QX1A 1BXHA 5FZKA 1HRI2 2YC2A 1CAWB 2P3IA 1HB3A 1W6MA 2AACA 1VPHA 3AP6A 2G9ZA 1VR3A 1BMV2 1FI2A 1OVSA 1NXMA 2QFEA 4FFFA 4IGPA 3MBWA 3M2MA 1FV2A 1JZ2A 1JOJA 3AB0A 3K3OA 3B9CA 1AYN2 2CSGA 4IEUA 5IUQA 1OVPA 2ZA9A 2DCJA 1FYUA 4FQ4A 4XUPA 1B09A 2LS6A 4YPJA 1WMEA 3JUUA 3Q8AA 1AR73 4YW1A 4BQ5A 3ILRA 2XJTA 4P14A 3SISA 4F3JA 2DUPA 2JDHA 4XIKA 4CXXA 1VBB3 3W9AA 1FMD3 4J1XA 3H8RA 4LULA 3S7EA 3AP7A 5FAXA 3GNEA 4AXOA 3HWJA 2DVBA 3VV1A 4BE3A 4Y1VA 3W21A 1LR5A 4XABA 3LCPA 5FKCA 4QX3A 4NRMA 3ZMNA 1W06A 3H1MA 3PMSA 3MDPA 4PF1A 4M3CB 2DURA 1MZEA 3GXUA 1NE4A 1LB2A 1C8M2 2BTVC 4A3ZA 3MIEA 3AFKA 3O1UA 4HBNA 3MW2A 3MUY1 5LA2A 1ZVFA 5C4WA 4K8RB 4QDRA 1IS5A 4URTA 1DLLA 4PIXA 5C4WC 2Q8CA 1PZ7A 2DBNA 4YVWC 1UU6A 1ASJ1 3MW3A 1AL22 4O9EA 3AXDA 4LITA 2CGPA 2AREA 2D6MA 3POJA 2TEPA 4LK7A 1XE0A 3U11A 1DF0A 2WNEA 1WW7A 1NCQB 1UQXA 4I3GA 3ZLIA 3MIBA 4WVWA 2R1BA 4YNIA 2ZGNA 3AMQA 3UK9A 1IS4A 4MH0E 1XYPA 5G04L 3KLSA 3GF6A 2YFZA 4G4FA 2VZ1A 3R6SA 2X53S 5KHKA 4IEYA 4UFIA 3WUDA 1F8VA 1VALA 3ACHA 3N35A 1QJU1 3POWA 4NE9A 4DUXA 3O1OA 4QPIC 4IV1A 5JXIA 4LUKA 2QDRA 1L7QA 2HYKA 3INAA 2ZHMA 1OBNA 2P6CA 2PHTA 3SH4A 4MUVA 5EZWA 4LMFA 5T5JA 4CU8A 1GZWA 2A75A 4E4DX 4MGYE 1M4WA 4N7IA 1W2OA 1NT0A 3WHTA 2Y0OA 4QD2A 3GJBA 4A6SA 3RI9A 3OGGA 1JTZX 5FMBA 5FO7B 1CAXB 5DUXA 1MPXA 1XPWA 1PVC2 2XLAA 3HPNA 5BPXA 4QGNA 3SLIA 4BQ2A 5FQ0A 5LA1A 2BFUS 4QXKA 3MFAA 3AVSA 4YFZA 2FD8A 5DAPA 2ZCWA 5LBEA 4Y5SA 4KI5M 3WG2A 2FHRA 4FP2A 4XFGA 2BBAA 5JI7A 1RUJ2 4A41A 5C8CB 1D4M1 2VVDA 2HWC3 2A71A 2ZGLA 3I2GA 4AI9A 3PU8A 3AKQA 4JRLA 1K5MB 4AI2A 4CYDA 1PO11 4AEMA 3T0DA 3DYOA 1UF2C 5FPXA
chains in the Genus database with same CATH topology
4W4ZA 4D8MA 2LW8A 4AAXA 3I2IA 5C70A 1L7RA 2WQ8A 3P6BA 2WO1A 3AC0A 3CDZB 2Y6JA 3HJRA 2WUHA 2Y6GA 1UY1A 5DQ0A 2QQNA 2VMFA 2Y64A 1JZ5A 2ORXA 3T0AA 1KEXA 5B4NA 3MO4A 4ZZ5A 4HG6B 1UY4A 4W50A 2JD9A 2ZEXA 3W5NA 3I2KA 3IAQA 1XC6A 2XOMA 4GWIA 3BN6A 3WNMA 4A6OA 2R7EB 2VZQA 4BK4A 1K3IA 4CU9A 2E33A 4ZXEA 3E1F1 3C7HA 1UY3A 5HXMA 2WO2A 4GWJA 2J1TA 2ZEYA 2QQJA 1UX7A 1ULOA 1JYXA 4W8JA 1GU3A 3K4ZA 1W0NA 2VZVA 4AG4A 1PX4A 1TG7A 5IHRA 4OYUA 2Z4FA 3VD5A 4A45A 1CZVA 3CZUA 4D0QA 2Y8KA 3T0BA 1GMMA 1UY2A 1YQ2A 2J1VA 2EICA 1UWWA 4BJ0A 3T08A 3T2OA 3ZM8A 4DEVA 2VMDA 2BGPA 1GUIA 2C9KA 3C7FA 3BGAA 3C7OA 2WAOA 3EYPA 3VD3A 3A23A 2VJXA 3FHQA 3NRUA 2KD7A 2V4VA 4XUTA 3THDA 2JKXA 2WDBA 4XURA 4ET7A 5JR2A 3VDAA 3W5MA 4A42A 1JHJA 5C71A 3WNLA 2BERA 2EIEA 3IDAA 3SEEA 5CYYA 4XUNA 2W1QA 2VCCA 1DLCA 4MGQA 4QX0A 2L9LA 1JYVA 3CZJA 3LQCA 3WNNA 3NJXA 2Y6HA 1HN1A 1W9SA 3I2FA 2QBXA 2WBKA 3K4AA 4XUOA 4JKKA 4QPWA 3OGSA 1TVGA 5HPOA 2RV9A 1W8OA 4E8CA 3NNGA 3CMGA 1PX3A 4DEQA 2E31A 3K75B 2J1RA 2WO3A 3T2PA 3VD4A 3MV01 2W91A 2YFUA 1DYOA 1I5PA 1JZ3A 1JZ7A 5A1AA 2J1AA 3LPGA 1F4HA 3DYPA 1JZ4A 2Y6KA 2VL4A 1UMHA 5IJRA 2V72A 3OB8A 3T09A 1W9WA 4LKSA 1GOHA 2VM9A 2EIDA 3K77A 1KGYA 1UYZA 2X09A 5G05L 3SKJE 4ZZ8A 1EUTA 1ULPA 2ID4A 5JXGA 4P00B 3PUIA 2W46A 3DECA 2VZPA 1RYYA 3A7QA 1OD3A 3OEBA 5JXJA 3I3DA 4QX2A 1LNSA 1OF3A 3P1IA 3UESA 2XHNA 3THCA 1NUKA 1US2A 2VCBA 2VZTA 5IFTA 4CU7A 3WF2A 2WZ8A 1UYXA 4TTGA 3MUZ1 1K42A 2YC4A 5LCWL 3FL7A 5LA0A 4MADA 3I97A 2J1SA 3WF4A 3ECQA 3CIHA 3UETA 3HEIA 4JHZA 5FUIA 3U37A 2VOTA 1CZSA 3F2ZA 2W1SA 2W5FA 1SG3A 1UXZA 4L0PA 3VDBA 2QQKA 1NAEA 4RN5A 4DXSA 4DUWA 1H6XA 2XQXA 3I3EA 3WF0A 4XVHA 4UOJA 5CZKA 2VZUA 3DYMA 4MGSA 2VQTA 2VC9A 4MOAA 4TXWA 3C8XA 5IFPA 5B4XA 2VZRA 3ACFA 3VDCA 1JZ6A 1GNYA 2CDOA 3LEGA 3WSOA 4DXTA 3I2HA 4KMQA 1R64A 3LE0A 2RVAA 1UMIA 4GZ9A 4PT6A 2OKXA 5JUVA 1O8SA 4OMCA 4ARXA 2JE8A 1JU3A 2EIBA 2ZEZA 4DUVA 2WZEA 3VD7A 1GOGA 1NX9A 1NKGA 1D7PM 4PQQA 1DP0A 3NJVA 2QQMA 4LHSA 4A4AA 3OGVA 1JU4A 4QB1A 2ORZA 3IB3A 1US3A 1K12A 4QAWA 5F7UA 1SDDB 1P8JA 2ZXQA 5DPNA 2W3JA 4BK5A 3WEZA 1BHGA 2PQSA 2Y6LA 4OUEA 1CIYA 3K4DA 2C4XA 3WQBA 3LEKA 1F4AA 3K46A 4M4PA 1O59A 2HYXA 4LPLA 5IYYA 2VR4A 3HN3A 1K45A 2DDUA 2B4KA 1XNAA 1JYNA 4CVUA 1JZ8A 2VO5A 3ACIA 2BGOA 4RYDA 1UY0A 4BXSV 2X05A 2VCAA 4CUAA 2E32A 3HNMA 4OMDA 3VD9A 3T2QA 2W47A 3ABZA 1EUUA 5DN2A 3FN9A 2YB7A 2YG0A 3J7HA 4OZOA 4QB2A 2W94A 3WNOA 4ARYA 1UYYA 1IQDC 2WYSA 3CQOA 2WN2A 3OBAA 4JKMA 3EB7A 3I2JA 4XZUG 4KWUA 4QDQA 3IIIA 2E26A 2J22A 2VMEA 5J1XA 1OH4A 4MO3M 4JKLA 1WCQA 3HNYM 3SEPA 4QB6A 4IUGA 3I3BA 2JDAA 2C26A 2VZ3A 1SHWB 1CZTA 2J1EA 1H6YA 3IAPA 3GGLA 4CU6A 5EJ1B 5EIYB 4UAPA 2ZEWA 3OG2A 3LEIA 1UXXX 2QQIA 3NQHA 2V5DA 3OEAA 1PMHX 2VQUA 4QX1A 2YC2A 5EJZB 1PMJX 4ZY9A 4XUQA 2W9XA 4P02B 1GOFA 1T2XA 1JZ2A 2B9VA 3MBWA 3HNBM 2WABA 1UZ0A 2DCJA 4XUPA 2LS6A 4YPJA 1O8PA 2W87A 2X10A 3C7EA 2QQOA 4FI9A 4JX0A 2VMCA 1CX1A 3LPFA 4QX3A 2VZOA 1JYWA 4PF1A 3GXUA 3JXSA 4A3ZA 1W99A 4QDSA 3MUY1 3GDBA 5LA2A 4QDRA 2VZSA 2W1UA 2BZDA 2WAAA 1OT5A 3A21A 4LQRA 2CDPA 3ETPA 1XNTA 3ACGA 5G04L 3HOBA 2YFZA 2VZ1A 3A22A 4UI9L 3PUHA 3ACHA 3OGRA 4CUCA 4DUXA 2RJ2A 4P5YA 5JXIA 2HLEA 1OF4A 1L7QA 3SKVA 3WNKA 2VTFA 3WNPA 5JMOA 4CU8A 4M4RA 1J84A 2WN3A 3WF1A 5DMYA 2W95A 5I0DA 3GM8A 3FHAA 1W9TA 1J83A 1MPXA 1XPWA 3HPNA 4A44A 3WF3A 5LA1A 1JI6A 1WKYA 3MV11 5JXHA 4KI5M 3CKHA 4E8DA 2BBAA 4A41A 3UNPA 4P08A 4Z2AA 2DCKA 2QQLA 2W92A 3C7GA 2XONA 4BDVB 3I2GA 5C7GA 2W1WA 3D3AA 1GQPA 1W8NA 4CUBA 3T0DA 3DYOA 2J1UA 2J7MA 4DXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4Z A;  4D8M A;  2LW8 A;  4AAX A;  3I2I A;  5C70 A;  1L7R A;  2WQ8 A;  3P6B A;  2WO1 A;  3AC0 A;  3CDZ B;  2Y6J A;  3HJR A;  2WUH A;  2Y6G A;  1UY1 A;  5DQ0 A;  2QQN A;  2VMF A;  2Y64 A;  1JZ5 A;  2ORX A;  3T0A A;  1KEX A;  5B4N A;  3MO4 A;  4ZZ5 A;  4HG6 B;  1UY4 A;  4W50 A;  2JD9 A;  2ZEX A;  3W5N A;  3I2K A;  3IAQ A;  1XC6 A;  2XOM A;  4GWI A;  3BN6 A;  3WNM A;  4A6O A;  2R7E B;  2VZQ A;  4BK4 A;  1K3I A;  4CU9 A;  2E33 A;  4ZXE A;  3E1F 1;  3C7H A;  1UY3 A;  5HXM A;  2WO2 A;  4GWJ A;  2J1T A;  2ZEY A;  2QQJ A;  1UX7 A;  1ULO A;  1JYX A;  4W8J A;  1GU3 A;  3K4Z A;  1W0N A;  2VZV A;  4AG4 A;  1PX4 A;  1TG7 A;  5IHR A;  4OYU A;  2Z4F A;  3VD5 A;  4A45 A;  1CZV A;  3CZU A;  4D0Q A;  2Y8K A;  3T0B A;  1GMM A;  1UY2 A;  1YQ2 A;  2J1V A;  2EIC A;  1UWW A;  4BJ0 A;  3T08 A;  3T2O A;  3ZM8 A;  4DEV A;  2VMD A;  2BGP A;  1GUI A;  2C9K A;  3C7F A;  3BGA A;  3C7O A;  2WAO A;  3EYP A;  3VD3 A;  3A23 A;  2VJX A;  3FHQ A;  3NRU A;  2KD7 A;  2V4V A;  4XUT A;  3THD A;  2JKX A;  2WDB A;  4XUR A;  4ET7 A;  5JR2 A;  3VDA A;  3W5M A;  4A42 A;  1JHJ A;  5C71 A;  3WNL A;  2BER A;  2EIE A;  3IDA A;  3SEE A;  5CYY A;  4XUN A;  2W1Q A;  2VCC A;  1DLC A;  4MGQ A;  4QX0 A;  2L9L A;  1JYV A;  3CZJ A;  3LQC A;  3WNN A;  3NJX A;  2Y6H A;  1HN1 A;  1W9S A;  3I2F A;  2QBX A;  2WBK A;  3K4A A;  4XUO A;  4JKK A;  4QPW A;  3OGS A;  1TVG A;  5HPO A;  2RV9 A;  1W8O A;  4E8C A;  3NNG A;  3CMG A;  1PX3 A;  4DEQ A;  2E31 A;  3K75 B;  2J1R A;  2WO3 A;  3T2P A;  3VD4 A;  3MV0 1;  2W91 A;  2YFU A;  1DYO A;  1I5P A;  1JZ3 A;  1JZ7 A;  5A1A A;  2J1A A;  3LPG A;  1F4H A;  3DYP A;  1JZ4 A;  2Y6K A;  2VL4 A;  1UMH A;  5IJR A;  2V72 A;  3OB8 A;  3T09 A;  1W9W A;  4LKS A;  1GOH A;  2VM9 A;  2EID A;  3K77 A;  1KGY A;  1UYZ A;  2X09 A;  5G05 L;  3SKJ E;  4ZZ8 A;  1EUT A;  1ULP A;  2ID4 A;  5JXG A;  4P00 B;  3PUI A;  2W46 A;  3DEC A;  2VZP A;  1RYY A;  3A7Q A;  1OD3 A;  3OEB A;  5JXJ A;  3I3D A;  4QX2 A;  1LNS A;  1OF3 A;  3P1I A;  3UES A;  2XHN A;  3THC A;  1NUK A;  1US2 A;  2VCB A;  2VZT A;  5IFT A;  4CU7 A;  3WF2 A;  2WZ8 A;  1UYX A;  4TTG A;  3MUZ 1;  1K42 A;  2YC4 A;  5LCW L;  3FL7 A;  5LA0 A;  4MAD A;  3I97 A;  2J1S A;  3WF4 A;  3ECQ A;  3CIH A;  3UET A;  3HEI A;  4JHZ A;  5FUI A;  3U37 A;  2VOT A;  1CZS A;  3F2Z A;  2W1S A;  2W5F A;  1SG3 A;  1UXZ A;  4L0P A;  3VDB A;  2QQK A;  1NAE A;  4RN5 A;  4DXS A;  4DUW A;  1H6X A;  2XQX A;  3I3E A;  3WF0 A;  4XVH A;  4UOJ A;  5CZK A;  2VZU A;  3DYM A;  4MGS A;  2VQT A;  2VC9 A;  4MOA A;  4TXW A;  3C8X A;  5IFP A;  5B4X A;  2VZR A;  3ACF A;  3VDC A;  1JZ6 A;  1GNY A;  2CDO A;  3LEG A;  3WSO A;  4DXT A;  3I2H A;  4KMQ A;  1R64 A;  3LE0 A;  2RVA A;  1UMI A;  4GZ9 A;  4PT6 A;  2OKX A;  5JUV A;  1O8S A;  4OMC A;  4ARX A;  2JE8 A;  1JU3 A;  2EIB A;  2ZEZ A;  4DUV A;  2WZE A;  3VD7 A;  1GOG A;  1NX9 A;  1NKG A;  1D7P M;  4PQQ A;  1DP0 A;  3NJV A;  2QQM A;  4LHS A;  4A4A A;  3OGV A;  1JU4 A;  4QB1 A;  2ORZ A;  3IB3 A;  1US3 A;  1K12 A;  4QAW A;  5F7U A;  1SDD B;  1P8J A;  2ZXQ A;  5DPN A;  2W3J A;  4BK5 A;  3WEZ A;  1BHG A;  2PQS A;  2Y6L A;  4OUE A;  1CIY A;  3K4D A;  2C4X A;  3WQB A;  3LEK A;  1F4A A;  3K46 A;  4M4P A;  1O59 A;  2HYX A;  4LPL A;  5IYY A;  2VR4 A;  3HN3 A;  1K45 A;  2DDU A;  2B4K A;  1XNA A;  1JYN A;  4CVU A;  1JZ8 A;  2VO5 A;  3ACI A;  2BGO A;  4RYD A;  1UY0 A;  4BXS V;  2X05 A;  2VCA A;  4CUA A;  2E32 A;  3HNM A;  4OMD A;  3VD9 A;  3T2Q A;  2W47 A;  3ABZ A;  1EUU A;  5DN2 A;  3FN9 A;  2YB7 A;  2YG0 A;  3J7H A;  4OZO A;  4QB2 A;  2W94 A;  3WNO A;  4ARY A;  1UYY A;  1IQD C;  2WYS A;  3CQO A;  2WN2 A;  3OBA A;  4JKM A;  3EB7 A;  3I2J A;  4XZU G;  4KWU A;  4QDQ A;  3III A;  2E26 A;  2J22 A;  2VME A;  5J1X A;  1OH4 A;  4MO3 M;  4JKL A;  1WCQ A;  3HNY M;  3SEP A;  4QB6 A;  4IUG A;  3I3B A;  2JDA A;  2C26 A;  2VZ3 A;  1SHW B;  1CZT A;  2J1E A;  1H6Y A;  3IAP A;  3GGL A;  4CU6 A;  5EJ1 B;  5EIY B;  4UAP A;  2ZEW A;  3OG2 A;  3LEI A;  1UXX X;  2QQI A;  3NQH A;  2V5D A;  3OEA A;  1PMH X;  2VQU A;  4QX1 A;  2YC2 A;  5EJZ B;  1PMJ X;  4ZY9 A;  4XUQ A;  2W9X A;  4P02 B;  1GOF A;  1T2X A;  1JZ2 A;  2B9V A;  3MBW A;  3HNB M;  2WAB A;  1UZ0 A;  2DCJ A;  4XUP A;  2LS6 A;  4YPJ A;  1O8P A;  2W87 A;  2X10 A;  3C7E A;  2QQO A;  4FI9 A;  4JX0 A;  2VMC A;  1CX1 A;  3LPF A;  4QX3 A;  2VZO A;  1JYW A;  4PF1 A;  3GXU A;  3JXS A;  4A3Z A;  1W99 A;  4QDS A;  3MUY 1;  3GDB A;  5LA2 A;  4QDR A;  2VZS A;  2W1U A;  2BZD A;  2WAA A;  1OT5 A;  3A21 A;  4LQR A;  2CDP A;  3ETP A;  1XNT A;  3ACG A;  5G04 L;  3HOB A;  2YFZ A;  2VZ1 A;  3A22 A;  4UI9 L;  3PUH A;  3ACH A;  3OGR A;  4CUC A;  4DUX A;  2RJ2 A;  4P5Y A;  5JXI A;  2HLE A;  1OF4 A;  1L7Q A;  3SKV A;  3WNK A;  2VTF A;  3WNP A;  5JMO A;  4CU8 A;  4M4R A;  1J84 A;  2WN3 A;  3WF1 A;  5DMY A;  2W95 A;  5I0D A;  3GM8 A;  3FHA A;  1W9T A;  1J83 A;  1MPX A;  1XPW A;  3HPN A;  4A44 A;  3WF3 A;  5LA1 A;  1JI6 A;  1WKY A;  3MV1 1;  5JXH A;  4KI5 M;  3CKH A;  4E8D A;  2BBA A;  4A41 A;  3UNP A;  4P08 A;  4Z2A A;  2DCK A;  2QQL A;  2W92 A;  3C7G A;  2XON A;  4BDV B;  3I2G A;  5C7G A;  2W1W A;  3D3A A;  1GQP A;  1W8N A;  4CUB A;  3T0D A;  3DYO A;  2J1U A;  2J7M A;  4DXR A; 
#chains in the Genus database with same CATH topology
 3WW4 A;  4IGO A;  1V6N A;  3AFG A;  4C0H A;  1TMF 3;  4CZS A;  1I1E A;  1WCD J;  3LFI A;  3P6B A;  2WO1 A;  4Q2F A;  4GUL A;  4Q4X 3;  1AHS A;  4CEY B;  1YRZ A;  2EXH A;  1J3P A;  1LHN A;  2JEC A;  1RHI 3;  4ASM B;  5L9V A;  2D97 A;  3AZX A;  1W39 A;  2NPI A;  3N7J A;  5K0U A;  2VW2 A;  4QKF A;  5A7O A;  2IVI B;  3OUJ A;  5J7M A;  5K0U C;  4D6R A;  2DVD A;  1X8M A;  3FJS A;  3RYK A;  5B4N A;  3BTZ A;  2R32 A;  4IEP A;  2W0X A;  1LEN A;  5JVV A;  3MO4 A;  4XTM A;  4HG6 B;  4B1L A;  5IK7 A;  3URF A;  3BB6 A;  5FP3 A;  2XXZ A;  4CEW B;  2KA3 A;  5J09 A;  2ZPX A;  3DF0 A;  2BRT A;  2HJI A;  2RM2 2;  2R7E B;  1KIT A;  1NQJ A;  3E6D A;  1EP0 A;  4ZU5 A;  1AR8 3;  4BK4 A;  1ZRI A;  4QQH A;  5LB6 A;  4K9S A;  1YIP A;  2ZHK A;  2E33 A;  4XF9 A;  2HWE 1;  1UOG A;  1I9R A;  2NM1 A;  2Q0A A;  3WQ7 A;  2BVB A;  4AVT A;  4Z2W A;  4QPY A;  4KWJ A;  5HXM A;  1TNR A;  5FYT A;  4GWJ A;  5FY0 A;  4D6Q A;  4FT8 A;  1W9Y A;  1UOF A;  2D6P A;  2WR9 A;  1GYK A;  3WX5 A;  3ZYF A;  1VAK A;  4CDX C;  3NKG A;  1GQG A;  3CL1 A;  3ZN6 A;  1V6I A;  1E5H A;  4HKO A;  4LOT A;  1JYX A;  3K4Z A;  4IEQ A;  2VZV A;  4QMA A;  4AG4 A;  1QIQ A;  1PX4 A;  1KXG A;  4YVS B;  5FRE A;  3BI3 A;  4OYU A;  4Z82 A;  1WMF A;  4L9B A;  4TLG A;  1ZYB A;  1V9U 3;  3AMM A;  5I0R A;  1WCU A;  3CZU A;  4OVE A;  4AFB A;  3O7O A;  1BBT 3;  4D0Q A;  2GC1 A;  4EN8 B;  2NP0 A;  2J1V A;  2EIC A;  2VY0 A;  4WM7 C;  3ZYB A;  5GLU A;  3V0B B;  5FZ7 A;  5HV0 A;  1GWK A;  3ENR A;  3KT1 A;  1R09 3;  4LBN A;  1CX4 A;  2K0G A;  3LGR A;  4XC9 A;  5A7S A;  3BU0 A;  3JB4 C;  2ZX3 A;  3ZSK A;  1J3Q A;  1GUI A;  2C9K A;  1SFN A;  2IFR A;  3ZYG A;  1IKP A;  2CY6 A;  4K21 A;  4TN7 A;  1ENX A;  3ZIX A;  2G9G A;  2PYT A;  4XHB A;  5F37 A;  3IPV B;  3NAP A;  5F2W A;  3ITQ A;  4OCT A;  4XBN A;  2YGM A;  4IER A;  1LU2 A;  2NZ9 A;  5FZ9 A;  5ABJ A;  3E6C C;  2PXJ A;  2ZGK A;  3FHQ A;  2KD7 A;  2V4V A;  3I2O A;  2ET1 A;  3VUO A;  5F3E A;  1ALY A;  2ADD A;  4Z1V A;  4GWM A;  5FOB B;  5LK7 B;  4HSL A;  4QKN A;  2ZX4 A;  4A42 A;  5GZC A;  4IV3 B;  2BJS A;  1DDL A;  1XSQ A;  4B3N A;  1RC6 A;  4R4Z A;  2PLV 3;  3WNL A;  4RR3 C;  3IDA A;  4JVA A;  5CYY A;  5A7N A;  3JU9 A;  3MIG A;  4NIH A;  4U36 A;  1ASJ 2;  3G7D A;  4CP9 A;  1FPN 1;  4MGQ A;  4Q0U A;  4LR4 A;  1OLR A;  1TE1 B;  3CZJ A;  3LQC A;  3WNN A;  2JG9 A;  2XL9 A;  3NJX A;  3MEP A;  3KCC A;  5FPU A;  1UNB A;  1HN1 A;  3I2F A;  3WNX A;  1MS8 A;  2QBX A;  2PAK A;  3R4D B;  4JKK A;  4QPW A;  3SNM A;  3ZXJ A;  4BMB A;  3OGS A;  2ZZJ A;  1ZZC A;  4Q4W 2;  4BXF A;  3RQ0 A;  1PZ9 A;  5HPO A;  1GIC A;  1W8O A;  3QH6 A;  1YJL A;  2YXS A;  1RUD 3;  2PFW A;  3JD7 2;  3MW4 A;  4LUM A;  1IPJ A;  4FXG B;  1C5I A;  1JUH A;  5GLT A;  5GLW A;  4OHW A;  1NA1 A;  4CU9 A;  2BOI A;  2J1R A;  1HLC A;  2NQY A;  2ADE A;  2XVK A;  3D6E A;  2EXK A;  1S0G A;  1NZC A;  5AFB A;  2VOX A;  2B9U A;  1RUF 3;  1C3H A;  1JZ3 A;  2D7F A;  1Y7B A;  1AXZ A;  4ITC A;  3VBH A;  1WLW A;  5DUW A;  5AC9 1;  1F4H A;  2VBB A;  3LSE A;  1O4Y A;  4XQD A;  3AJZ A;  1C8N A;  4RQP A;  5ACA 3;  4CTE A;  3VZK A;  3AYC A;  2Y6K A;  2YZ4 A;  1UMH A;  1CJP A;  4WVV A;  3OB8 A;  2BDR A;  1L7L A;  1I5Z A;  3OBT A;  5FKB A;  2ZGT A;  3O1V A;  4LHK A;  1S0I A;  3VDD C;  3GCX A;  4LO6 B;  4M0H A;  5BY5 A;  1S0C A;  3J7N A;  5CFC A;  4XET A;  3BIW E;  3WDT A;  2EID A;  3SIT A;  3K77 A;  1KGY A;  4CCE A;  2LRP A;  4XCB A;  5G05 L;  2VNR A;  2VBP A;  3M3C A;  1GR3 A;  2A6V A;  5FZ0 A;  2DCZ A;  4IE5 A;  1JN2 P;  4Q27 A;  4A7Z A;  4KGQ A;  4AFA A;  1WMX A;  4SLI A;  5J48 A;  5F6K A;  5FLH A;  1OA3 A;  4JAA A;  4R8H A;  1BQP A;  4XFA A;  4FFH A;  2XGX A;  3A7Q A;  4QT6 A;  5ERL A;  2Q8E A;  4FTE A;  1OD3 A;  5FZL A;  5JXJ A;  4MHR A;  1Z7S 1;  4QX2 A;  4CPB D;  3MF6 A;  1LNS A;  1ULG A;  4JV4 A;  3WD5 A;  5EHD A;  4DQA A;  3UES A;  3MHZ A;  4AEK A;  4GWN A;  4ZU7 A;  2OXB A;  1NUK A;  3AM2 A;  2O0O A;  4IE7 A;  4Z8B A;  4ATE A;  5CG8 A;  1QU0 A;  2MPF A;  5T50 A;  4X8N A;  3O0V A;  4WBB A;  4FOW A;  1LGN A;  5A33 B;  1QQP 3;  1YFW A;  5EQU A;  5BNO C;  4UXA A;  5I0U A;  4TTG A;  4CP1 A;  4MXW A;  3FL7 A;  4NN0 A;  3ZSE A;  1RUC 3;  1W2A X;  3CJI B;  2Y34 A;  4K6B A;  3J26 N;  2QZ2 A;  5LA0 A;  5FUP A;  3I97 A;  1GNZ A;  4HN0 A;  5CFD A;  4HPK A;  1O5U A;  1BVP 1;  4MYE A;  4FAG A;  5FK7 A;  1W2U A;  3KMH A;  4FPK A;  4Q4Y 1;  5FZI A;  4B8E A;  5CFD C;  3CIH A;  1AF9 A;  2VXR A;  2XJQ A;  2B46 X;  4NHX A;  5CKM A;  3RWN A;  4BIO A;  1T6G C;  5LBF A;  4JHZ A;  1XXN A;  4OZX A;  2F6B A;  2YUE A;  1WCS A;  3VZM A;  3ZFE B;  4WVM A;  4YG3 A;  3NV2 A;  4P9J A;  1CAU B;  2R1D A;  1UXZ A;  1RXF A;  2I2S A;  2YMZ A;  2ZGO A;  1OQE A;  2GSY A;  5A7Q A;  3VZJ A;  1D4V B;  3S6P A;  3USU A;  2WFP A;  3VDB A;  4GH4 B;  3P3N A;  1RUN A;  5DUV A;  2CWS A;  1G8W A;  3RI8 A;  4CCM A;  2MEV 3;  2WZR 3;  3D0J A;  3AZY A;  4C8D A;  5DG2 A;  3I59 B;  3ZVX A;  2GC0 A;  1OFN A;  1QEX A;  3IBM A;  2RDR A;  3GZE A;  1MEC 3;  4WV8 A;  2UYB A;  5FXZ A;  1W8H A;  1W8F A;  4XFI A;  5E89 A;  2ZKN A;  2HWD 3;  1RMU 3;  4XVH A;  4LA3 A;  5CZK A;  1QJY 2;  2KR2 A;  2O14 A;  4CXY A;  1OFS A;  1WUV A;  3C3V A;  1RUG 3;  3DYM A;  4ZS3 A;  1YCI A;  4MOA A;  4IW3 A;  4RHV 1;  3NJY A;  5FP8 A;  4AEJ A;  3EJK A;  1PIV 2;  2R07 2;  2PMW B;  1AX2 A;  2XQR A;  3ACF A;  3H42 B;  1JZ6 A;  4RL7 A;  3N9M A;  1VBE 1;  1X33 A;  2DCT A;  4ERO A;  5C9A A;  4XYX A;  3HQU A;  4XDO A;  3TBD A;  4ZXK A;  5C9A C;  3I2H A;  2DVG A;  3FFZ A;  4LK6 A;  4Y22 A;  3B93 A;  4LJH A;  1LEM A;  4XHX A;  4N90 A;  5SV5 A;  4AR2 A;  2FMD A;  2HWF 2;  4IES A;  4IEV A;  1SLL A;  1O8S A;  5GKA C;  4ARX A;  4E2Q A;  3KS7 A;  4ZU4 A;  2DVF A;  1JU3 A;  2AEN A;  2ZEZ A;  2WZE A;  2RR1 2;  2YYO A;  4CDW B;  5FWE A;  2AEZ A;  5L9R A;  1GP6 A;  2X8K A;  3SMH A;  2RJK A;  1RUE 3;  1BJQ A;  5FOJ B;  4DIN B;  2OII A;  3ME2 A;  2JDU A;  3P5B A;  4AVC A;  4PQQ A;  1RJ7 A;  1Z0H A;  3NJV A;  4OI1 A;  2HEV F;  2FCU A;  4WM8 A;  4XBQ A;  4LXL A;  2FDJ A;  3O12 A;  4WM8 C;  1XYN A;  1HV1 A;  1F5J A;  1PK6 A;  1KS4 A;  2OUH A;  4LKF A;  1SDD B;  3VKO A;  3AYD A;  2XBO 3;  2W3J A;  4QHO A;  2E7Q A;  1PK6 C;  1BHG A;  2Y6L A;  4OUE A;  4CDU C;  2JE9 A;  5JOY A;  1ZRF A;  2R06 2;  1F4A A;  1PM7 A;  3KHB A;  1DYK A;  1O59 A;  4EE2 A;  5A32 A;  1QDC A;  4F83 A;  1A34 A;  3V0A A;  1ND3 A;  1DGW A;  3GYD A;  1K45 A;  3BOD A;  2DDU A;  1RVF 2;  2B4K A;  1LKN A;  1VJ2 A;  1ND3 C;  1PNF A;  1CGP A;  2WNV C;  4CVU A;  2QUO A;  4RYD A;  2ZX2 A;  2P37 A;  4Q0S A;  1JYC A;  1EV1 3;  5FPB A;  4BA6 A;  5A3M A;  1Q8O A;  3H1Y A;  3HVD A;  2PA7 A;  3NNF A;  3AKS A;  1EUU A;  1R1A 2;  3FBM A;  5DN2 A;  1WW4 A;  2YB7 A;  3J7H A;  1PGW 1;  1UYY A;  1IQD C;  1ZBA 1;  2WYS A;  3CQO A;  5FO8 B;  2GME A;  2YDE A;  4XZU G;  4KWU A;  1JHN A;  4AVA A;  1SLT A;  1HXS 2;  1IG3 A;  3AVR A;  1D0H A;  3III A;  2IXI A;  3VBO A;  4JTO A;  5J1X A;  4D94 A;  1OH4 A;  4MO3 M;  1NLS A;  3FX3 A;  5JLV A;  2FDF A;  1UZY A;  3OY8 B;  4NWV A;  3VBO C;  3FHI B;  3FBY A;  1SPP A;  4HFS A;  3KHC A;  4Q0V A;  4N9H A;  1X7N A;  2RMU 2;  3GHM A;  3J8F 3;  4QB6 A;  5D21 A;  1HV0 A;  4O7X A;  3DKQ A;  5DDJ 3;  5IWF A;  1WZX A;  3I3B A;  3ZYH A;  4OI4 A;  2C26 A;  2BWC A;  1BMV 1;  3MPP G;  1H6Y A;  1NCR B;  1VBA 2;  4PLM A;  3JZV A;  5EJ1 B;  3PUR A;  4BQ4 A;  1AYN 1;  1GAN A;  2C6S A;  5IVY A;  3O1P A;  4QQO A;  3IKW A;  3LEI A;  1RUF 2;  5LZ6 A;  2WNO A;  3W58 A;  1RUI 2;  1UXX X;  5FZB A;  2X5I C;  2V5D A;  4YFW A;  3VHP A;  4XMI A;  2XL7 A;  4HSJ A;  5K4L A;  1LEC A;  1SLI A;  2OZ6 A;  5FZF A;  5FMC A;  3RFR A;  4ZKT B;  3N9Q A;  3PHM A;  4MX3 A;  3WUC A;  3H8O A;  1PO2 3;  4MET A;  4P02 B;  2A3Y A;  3MIC A;  4HVO A;  4I02 A;  1GWM A;  2W39 A;  3N7K A;  5LA9 A;  3ZX7 A;  5CKN A;  2DFC A;  5FTT C;  2FCT A;  1KJR A;  4LBQ A;  1C8M 1;  1W6M B;  1VBC 3;  3Q8F A;  4MZU A;  3FMG A;  2D6L X;  2W87 A;  3KT4 A;  2XJV A;  3OD0 A;  4DOU A;  2FDK A;  1AVB A;  3ZXE A;  3KSC A;  2BWA A;  1LGB A;  4NUB A;  5HCH A;  4QPG B;  2HKX A;  1UD1 A;  1YO8 A;  3E5Q A;  1AYM 3;  2DVA A;  4JX0 A;  1AL2 1;  1TME 3;  2VMC A;  3IT8 A;  2XHK A;  2WFF 2;  4R9D A;  4XEZ A;  5I0T A;  2D44 A;  1RGS A;  4BU2 A;  5A3T A;  2VW0 A;  1VRB A;  3LPF A;  4FPH A;  1CX1 A;  5B2G B;  2Z5W A;  1JYW A;  4OHZ A;  2Q1M A;  2XWJ B;  1H0B A;  4UF0 A;  2DTW A;  1W99 A;  2JDP A;  1YLL A;  3N36 A;  5FMO S;  5T5L A;  4W6W A;  4E27 A;  2AZ5 A;  3GDB A;  4LO4 B;  4ATF A;  5EYX A;  3KV6 A;  3JBG 3;  1A6C A;  2WAA A;  4LE4 A;  5FY1 A;  4AAP A;  1S0J A;  2WYF A;  1EAH 2;  1UOJ A;  4JGZ A;  3ZFG A;  5KXC A;  1QQP 2;  5D8A C;  4CSW A;  1JBC A;  1AUY A;  3AYE A;  4RFR B;  5C5T A;  1B35 B;  1BKZ A;  1V6O A;  1FOD 2;  5KXE A;  1NZI A;  3SH5 A;  1XNT A;  5DZG A;  4EV0 A;  1UIJ A;  5KWR A;  3CBN A;  3HOB A;  4LLF A;  3U4X A;  1DFQ A;  3O5S A;  2UWA A;  1OQD A;  3A0K A;  3PUH A;  2GC2 A;  2RS3 2;  5KBF A;  4EWD A;  2RJ2 A;  1W6O A;  2UY8 A;  4P5Y A;  4NII A;  3O1R A;  2XLG A;  1OF4 A;  4AI8 A;  5FXW A;  5A7W A;  1ZRR A;  2JKB A;  1RUJ 1;  1MR5 A;  5JMO A;  3ZDV A;  2SBA A;  1J84 A;  4PDW A;  4Q4V 3;  1W90 A;  4O65 A;  5A3O A;  4IV1 B;  1GNH A;  3ILF A;  3GM8 A;  4PDW C;  5KHG A;  3WDU A;  4D6S A;  5FRA A;  1W9T A;  4Q29 A;  1TZO A;  4JCK A;  3NVC A;  5FP4 A;  3VBU B;  1MEC 2;  4PQ9 A;  4GMP 0;  1V6M A;  2O8O A;  3ZO0 B;  3AMH A;  1OI6 A;  2R04 2;  2XG3 A;  2DF7 A;  4TLF A;  5HCA A;  1W3V A;  2IXK A;  3EBR A;  1RUH 2;  4FPG A;  1OKQ A;  3GBG A;  1S0D A;  4YZ1 A;  3UNP A;  2AYH A;  2HWB 2;  1ND2 A;  1ODM A;  4LO5 B;  3T2T A;  2JDY A;  4X8P A;  2DCK A;  1SMV A;  3JQX A;  3QH7 A;  5FZ3 A;  1ND2 C;  1W6N A;  2XON A;  3AKP A;  1YQ8 A;  3APB A;  5FQ0 B;  5FYZ A;  4BDV B;  1D2S A;  2ZAA A;  1VMH A;  1H9W A;  3D3A A;  5D2A A;  2W2I A;  2VTX A;  5KXB A;  2XJU A;  3ELN A;  3T1M A;  1XOY A;  1O5L A;  1U0A A;  1BK1 A;  3MLL A;  4DXR A;  1IZ3 A;  2P6H A;  2FZ2 A;  4D8M A;  2LW8 A;  4AAX A;  4AZZ A;  1DQ0 A;  1W8T A;  4Y33 A;  1DGW X;  1N3O A;  4K20 A;  2OQ6 A;  3TN9 3;  3UJQ A;  5LEK A;  2RS5 3;  3CDZ B;  3LZZ A;  1SDW A;  5KHH A;  1R08 3;  4OQ8 A;  1XBF A;  2RS1 2;  2RM2 1;  3B01 A;  1O3Q A;  4MGT A;  2WJS A;  5DQ0 A;  2QQN A;  1JZ5 A;  1H2N A;  4FOV A;  4A7K A;  2ZOE B;  4EN9 B;  3T0A A;  1KEX A;  5F5A A;  3RVH A;  3TAY A;  2WS9 2;  5GAL A;  2E51 A;  1W6Q A;  4XE9 A;  5FYM A;  4ZZ5 A;  3I3M A;  2JD9 A;  5FXX A;  3VBS B;  3J7L A;  2QCS B;  5EJ3 A;  4CE8 A;  1QJX 1;  4Z92 B;  1LUL A;  3IAQ A;  2YPJ A;  3IDE A;  4YSF A;  2YY1 A;  2E53 A;  3BN6 A;  1S1A A;  3WNM A;  1X50 A;  4NMI A;  4LBO A;  2VZQ A;  3DEM A;  4IQP A;  1AR6 2;  3AK0 A;  2IVJ A;  2UWB A;  4OHV A;  2FDI A;  1IG0 A;  3ZYI B;  3LF7 A;  3ST7 A;  3C7H A;  1MS9 A;  3AYA A;  1MVQ A;  1NLR A;  2WRA A;  4I2O A;  3KM5 A;  4LBQ D;  5IVF A;  4H7M A;  1G7Y A;  3VBF A;  1JW6 A;  4PIZ A;  2UWC A;  1ULO A;  3VBF C;  1RTV A;  1GU3 A;  4XFH A;  1W0N A;  1WBF A;  4CUG A;  1CVN A;  2GZW A;  3VD5 A;  4UW6 A;  4A45 A;  3X29 B;  1UPS A;  1CZV A;  4LE3 A;  2OZJ A;  3R4U A;  4FOY A;  1ZA4 A;  3T0B A;  1UY2 A;  2BYV E;  3RG0 A;  3WCS A;  1MAC A;  3T2O A;  2VCM A;  3ZKU A;  3R4S A;  3ZSM A;  4EN0 A;  4GJZ A;  3ZIW A;  4FAH A;  4AYU A;  4YVW A;  3ZFF A;  3GZT B;  3FE5 A;  3QD6 A;  3WDW A;  3RNS A;  4P9Y A;  1CJD A;  3ZPO A;  4Y1U A;  5FZO A;  3ZFF C;  4NPM A;  5I0S A;  2ZML A;  1QJU 3;  3ZSJ A;  1VRH 2;  1WBL A;  2VJX A;  3AKR A;  1STM A;  3H8U A;  5KC6 A;  4R4X A;  5A7P A;  2WSU A;  4R52 A;  3THD A;  4ZS2 A;  4IEX A;  2WDB A;  4XUR A;  1N1V A;  2YBP A;  1RXG A;  1CON A;  2W52 A;  3QOP A;  5IK8 A;  5T54 A;  3NAP B;  5ABJ B;  3MI8 A;  3ZN5 A;  4Q4W 1;  5FYU A;  3ZXF A;  2VOK A;  3WQ0 A;  4SBV A;  3AP5 A;  3JD7 1;  3DGT A;  4GB3 2;  3SEE A;  2CU5 A;  4QPI A;  4XUN A;  5FZ6 A;  3UGH A;  3WG1 A;  1O3T A;  3S0M A;  3N9P A;  4P9G A;  1YFX A;  2IC1 A;  4Y26 A;  1JYV A;  5H9R A;  2EAK A;  2JEN A;  1HKD A;  3EXU A;  4QGL A;  2BNM A;  1LOE A;  1UKR A;  3KVB A;  3K4A A;  4XUO A;  1D4M 3;  5A1F A;  2PQQ A;  4CP9 B;  3O1S A;  5FZ4 A;  1HRV 2;  2RV9 A;  1HB2 A;  3H3Z A;  4N53 A;  4B4R A;  2JG9 B;  1PO1 3;  4N53 C;  2DV9 A;  4XFF A;  1PX3 A;  3KGL A;  4R9A A;  5FLJ A;  1ULD A;  3VN4 A;  4UBG A;  2WO3 A;  4ZON A;  2WII B;  2UU8 A;  2EAA A;  4FP3 A;  1YQC A;  2W91 A;  2YFU A;  2YBS A;  1DQ4 A;  4M01 A;  4XZP A;  1I5P A;  5AVA A;  1IPS A;  1VBD 3;  2O8Q A;  3CJX A;  4H3W A;  4Q26 A;  3LPG A;  1NA1 B;  2MHF A;  4HKL A;  1QH6 A;  1E5R A;  3DYP A;  5C3O A;  1JZ4 A;  4MGK E;  5BNN B;  2AGS A;  5IJR A;  2B8M A;  2V72 A;  3NV4 A;  2H0V A;  3T09 A;  1VMF A;  2JIJ A;  4LKS A;  3VBH B;  2A5Z A;  1UX6 A;  2C0Z A;  1RIT A;  1UZW A;  2XKP A;  3E5U A;  4NHM A;  5FYY A;  5J96 B;  3WHU A;  4RQP B;  3GBF A;  3LAG A;  2VU9 A;  4QQL A;  5CU1 A;  1O3S A;  3TNQ A;  1UYZ A;  1ZBE 2;  4O61 A;  5L7O B;  3ON7 A;  4ZZ8 A;  5FWJ A;  1EUT A;  2ID4 A;  3KQR A;  5JXG A;  1OOP B;  2HWE 3;  4NHL A;  4XF1 A;  3UKV A;  2R30 A;  3PUI A;  5CFC B;  4IE6 A;  1M06 G;  1MS4 A;  2E63 A;  3SC7 X;  3DKW A;  2V09 A;  4N9I A;  3WV6 A;  5I8Y A;  4HON A;  1N3P A;  1HQN A;  4PBP A;  1DZR A;  4I09 A;  2LUW A;  3PIJ A;  4LA2 A;  4NHY A;  5BV6 A;  2ARB A;  2K2S A;  2XUM A;  3UKT A;  1XNK A;  3HQX A;  1VE0 A;  4KU8 A;  1CN1 A;  5JZG A;  2ZAC A;  5C3Q A;  2XHN A;  5FLI A;  2OT7 A;  5JZG C;  2WSV A;  4FQZ A;  5GLV A;  3VKL A;  4LBK A;  4LBM A;  4IND A;  2W68 A;  3IMN A;  1IGO A;  4TWT A;  2WZP P;  2VCB A;  2D93 A;  4NR1 A;  4Q1R A;  3RYR A;  1IHM A;  1OSG A;  3PLQ A;  4CU7 A;  1X9T A;  2WZ8 A;  4NOT A;  3FWE A;  4ONU A;  2H6C A;  4CDX A;  3MUZ 1;  1GZC A;  1TMF 1;  4IE4 A;  3ALQ A;  5E88 A;  5JOZ A;  4COZ A;  3LOI A;  1QJX 2;  4HXC A;  4XIO A;  3ZXD A;  2ENR A;  4AVV A;  1GBG A;  1SCR A;  4BLJ A;  3RSJ A;  4KGG A;  4Q0P A;  1ST8 A;  5ANQ A;  1LOF C;  1QOS A;  2Y6F A;  1GSL A;  3ECQ A;  2CGN A;  3UET A;  3RWK X;  4EJR A;  4YLZ A;  5FUI A;  5IAV A;  1CZS A;  3JB8 A;  3LA2 A;  4BIS A;  4WM7 A;  5CFD B;  1Q3E A;  2JJ6 A;  4XAC A;  1SG3 A;  4PI2 A;  3OCP A;  1QJY 1;  1AR9 2;  2ZMN A;  3CU7 A;  5HCF A;  3ZYJ B;  3FZ3 A;  2JDK A;  2QQK A;  5A80 A;  4AHX A;  4GXL A;  1PIV 1;  2R07 1;  3U07 A;  2ZGP A;  2XPJ A;  4H14 A;  4HK8 A;  1ODN A;  1LU1 A;  2PAE A;  3CLP A;  3J9S A;  1FPN 3;  1X82 A;  1F5F A;  3S57 A;  2HWF 1;  4IGQ A;  4KU7 A;  5T52 A;  4S2D A;  4ASL A;  2V73 A;  1JUI A;  1XRU A;  4QXH A;  3RYP A;  2VQT A;  3OPT A;  1CIW A;  1SLB A;  2ZX1 A;  3B02 A;  1H1A A;  2A3X A;  3MYX A;  1RB8 G;  2RJL A;  2OYZ A;  1PGL 2;  5IFP A;  5B4X A;  3VDC A;  4RR3 A;  1GNY A;  2A6W A;  2RR1 1;  2CDO A;  2ZAH A;  3WSO A;  3MLK A;  2VNG A;  4UFM A;  4AFD A;  1NCQ C;  4YW6 A;  1YFU A;  2DUQ A;  2WKK A;  1C57 A;  1V9U 1;  4YGC A;  1D2Q A;  1WMD A;  2OW4 A;  4X6R B;  3B9I A;  2FDG A;  4QXC A;  3PUS A;  3M3O A;  4Q8K A;  3L9J T;  4GZ9 A;  1IPK A;  4QGM A;  2PN5 A;  5JUV A;  4MG2 A;  3I54 A;  4OMC A;  2BW8 A;  2JE8 A;  5C8W A;  1C5H A;  4E4Z A;  1AR7 2;  4PI0 A;  4Y22 B;  5CKQ A;  4BIF A;  5AC9 3;  2GU9 A;  3HR9 A;  5L19 A;  5F5C A;  3VD7 A;  2R06 1;  5A6Y A;  4XF0 A;  3NNM A;  2IWG B;  3FLR A;  1VBB 2;  1FMD 2;  4YW5 A;  4QQ2 A;  5F3C A;  1RVF 1;  5DZF A;  4EZH A;  3RJ2 X;  2QQP A;  2ETE A;  4AOC A;  4LHS A;  2QQM A;  4FPF A;  1MZ6 A;  1QF3 A;  3TB0 A;  3OGV A;  3UT0 A;  1JU4 A;  3C2U A;  4QM9 A;  4C0B A;  5F5Q A;  3Q8B A;  2CV6 A;  1K12 A;  3BYW A;  5F7U A;  1CAX A;  2CHH A;  5I8S A;  4COY A;  1KFU L;  1P8J A;  3CO2 A;  5DPN A;  1CQ9 A;  1NYW A;  1POV 1;  3WEZ A;  1EPW A;  5FR3 A;  4N43 B;  3K4D A;  2C4X A;  5A6X A;  4H2A A;  1ZRD A;  5GZD A;  3K46 A;  3POY A;  2PLV 1;  1R1A 1;  4WM8 B;  2JB8 A;  2HYX A;  4LHN A;  4XFB A;  5IYY A;  2ZKL A;  3HN3 A;  5FK8 A;  5C8C A;  3QLQ A;  2ATF A;  3VDD A;  3WDX A;  1CD3 G;  1PK6 B;  2XVG A;  3I2D A;  4RA0 A;  4D7Y A;  5A3N A;  5C8C C;  3RDI A;  4LOR A;  1H8T B;  1OHF A;  4CDQ B;  3ACI A;  1XYO A;  2VMG A;  5FZC A;  1QDO A;  2BGC A;  4HOO A;  4BXS V;  2X05 A;  1C1L A;  1K5M A;  1HXS 1;  1UAI A;  1V6J A;  4OUM A;  1Z7S 3;  4UW4 A;  4CUA A;  1K5M C;  2VEC A;  3AKT A;  1UMZ A;  4P9L A;  4OMD A;  3VD9 A;  3KV5 A;  3NNL A;  1Z78 A;  4GMP 3;  1Q8Q A;  3ABZ A;  2RMU 1;  3WDY A;  3BAL A;  3NV1 A;  4AK3 A;  4FPC A;  2VE1 A;  4OZO A;  3U75 A;  3WNO A;  2WN2 A;  1C1F A;  1RL3 A;  4CEY C;  1VBA 1;  1URX A;  3S5A A;  4FPJ A;  2PHR A;  5I8T A;  2DWR A;  1H8V A;  2CGO A;  1HW5 A;  4BPZ A;  1RUF 1;  2BUK A;  1FX5 A;  1RUI 1;  1ZA7 A;  4LLO A;  4AW7 A;  3S5Q A;  5LRS A;  1A8D A;  3WY6 A;  1WCQ A;  4Q4Y 3;  4NVP A;  4XXA A;  3ZMO A;  1QJE A;  3QCW A;  5CIS A;  1BVV A;  3A0N A;  3HN1 A;  3WCR A;  1ENS A;  2AH2 A;  1G86 A;  2JDA A;  1H1M A;  1LHV A;  2PHL A;  3LEM A;  3BKZ A;  5BNO A;  1CZT A;  4CEW C;  3N9O A;  1SPP B;  4FTB A;  4CU6 A;  2WNU B;  4Y20 B;  5LRR A;  1AJO A;  1E5I A;  4UAP A;  5LK5 A;  3NL1 A;  1LHU A;  2I45 A;  5J3U A;  2B42 B;  2HWC 2;  2AR6 A;  1N1T A;  4YW4 A;  3DN7 A;  1S2B A;  3H1W A;  2TBV A;  4CCD A;  2BEO A;  2P4E A;  3BU7 A;  5EJZ B;  3ZKY A;  1A78 A;  5L36 A;  2ZMK A;  4ZY9 A;  5H9S A;  3V65 A;  4Q1P A;  4XUQ A;  2VUJ A;  2W9X A;  5JSR A;  5M0T A;  4A7Y A;  2WFF 1;  4YVS A;  4YGD A;  5C5U A;  1BYH A;  1TMF 2;  2B9V A;  3OBZ A;  1YHF A;  4YVS C;  3WOG A;  5BNQ A;  1IOA A;  1N1Y A;  2WAB A;  3HNB M;  4GAL A;  4RHV 3;  4Q4X 2;  5FZG A;  1O8P A;  1RHI 2;  3LA3 A;  2VUA A;  3GZA A;  5IVC A;  1VBE 3;  4LNV A;  5HBA A;  2X10 A;  3C7E A;  2FZ1 A;  4XW3 A;  2B7Y A;  2CWM A;  5EV7 A;  3RGB A;  2A1X A;  4LBQ B;  1EAH 1;  1XNC A;  3HT2 A;  2RE9 A;  1QQP 1;  2D6N A;  4JRA A;  1VB4 A;  2VZO A;  4NRQ A;  5CG9 A;  1E5S A;  5F32 A;  5CVR A;  2PHX A;  3GJA A;  4Y1X A;  1FOD 1;  5C3P A;  3JXS A;  2X29 A;  1JMU B;  1YEW A;  5FPZ A;  4JDO A;  1J59 A;  5IAX A;  4QDS A;  3WIN E;  3AZZ A;  1AR8 2;  2JE7 A;  4UT5 A;  3AMP A;  2VZS A;  4CXW A;  2BZD A;  5F3G A;  3A21 A;  2Y38 A;  2RS3 1;  5KR7 A;  2VOW A;  2OPK A;  2ARC A;  4FFG A;  4IV3 C;  1COV 3;  4UF0 B;  5EYY A;  3U78 A;  3TYJ A;  2D6O X;  4HET A;  5FYS A;  4XPV A;  2XB6 C;  4AI3 A;  4YG6 A;  3OSD A;  2QQW A;  3ETP A;  1ENQ A;  4RGA A;  5T5O A;  2RDN A;  1X8E A;  4OHY A;  4AF9 A;  4H7L A;  5LAS A;  3ZFG B;  4JGZ B;  3M7A A;  1OMI A;  4LO7 A;  3ACG A;  1ZZ9 A;  1NXD 1;  1F9K A;  1VB2 A;  2DYC A;  2WZR 1;  4YZ2 A;  1F2N A;  3A22 A;  4EWA A;  1JYI A;  5E8A A;  5E6H A;  1MS3 A;  1O4T A;  1V9U 2;  1MEC 1;  4CUC A;  3R0R A;  4AFC A;  5KHJ A;  5FYC A;  1BBT 2;  5K8S A;  2HLE A;  3MID A;  1XJA A;  3LFM A;  2R04 1;  1FXZ A;  5EXO A;  1SFY A;  3SKV A;  1RUH 1;  5CIR A;  2VTF A;  4HN1 A;  3N9L A;  3WNP A;  2JDN A;  1R09 2;  2XKO A;  4IET A;  2HWB 1;  4M4R A;  4CDU A;  1W03 A;  4QWN A;  3WF1 A;  3BTY A;  3PJQ A;  1V70 A;  1MQT B;  1W6O B;  2W95 A;  4FPE A;  4K40 A;  3DL3 A;  5DXD A;  5FIX A;  4AED B;  3L2H A;  3WXP A;  5A7W B;  2D43 A;  5BNP B;  2WNV A;  3UKN A;  4D3W A;  2XWB B;  4A44 A;  5FZA A;  3WF3 A;  1JI6 A;  3KF5 A;  1Q8V A;  1WKY A;  2O1Q A;  2QTW B;  5FY5 A;  3MV1 1;  5JXH A;  1W6P A;  3CKH A;  4E8D A;  1OXC A;  4UFL A;  4P08 A;  4BM8 A;  1H2M A;  4BOW A;  4PBO A;  2QQL A;  1SLA A;  1XE8 A;  4CCO A;  2W92 A;  2WWJ A;  5JSO A;  2RS1 1;  4C1W A;  1LOA A;  1BCX A;  2PLV 2;  1HRI 3;  2W1W A;  2EA7 A;  3DPR B;  3HT1 A;  1GQP A;  1S0F A;  2A6Z A;  4QX8 A;  5GLZ A;  2JG8 A;  1DQ5 A;  1QXJ A;  2WO7 A;  4XIL A;  5A3P A;  2HBU A;  2PHU A;  2J7M A;  3CF6 E;  3BOW A;  5FUN A;  2JG8 C;  3N7L A;  2WS9 1;  3GAL A;  5C70 A;  3I2I A;  1YXW A;  3POE A;  4PLO A;  1VAM A;  3TRS B;  5GZE A;  3D8C A;  3FFQ A;  1AYN 3;  1U12 A;  4QXB A;  4XJ9 A;  3O1T A;  3O0W A;  3AC0 A;  3WQ1 A;  4MLO A;  1ONA A;  4AVS A;  3KQ4 B;  5LY1 A;  4NIG A;  2Y6J A;  2F4P A;  2WUH A;  2WQ4 A;  2Q8D A;  4WZF A;  2Y6G A;  1HB4 A;  1UY1 A;  1AR6 1;  1RUD 2;  1PGS A;  2VMF A;  4Z07 A;  3WR0 A;  4E4H A;  2ORX A;  1AXY A;  4BQW A;  1OQ1 A;  4FXK B;  3IDC B;  1QOO A;  2R0F A;  5JAX A;  4JGY B;  1XSR A;  5F3I A;  4W50 A;  1SFP A;  4BZ4 A;  4A2U A;  4FVV A;  4CCJ A;  5LBC A;  2X5I A;  1C8M 3;  1E57 A;  1S0E A;  1Y43 B;  2QKD A;  3I2K A;  4S2G A;  5HCB A;  5C3S A;  1XC6 A;  2JD4 A;  1NE6 A;  4LHL A;  4PCR A;  4A6O A;  5K7P A;  4AI0 A;  2DUO A;  1W6Q B;  1AJK A;  4U2A A;  3F95 A;  3VKM A;  5ACA 2;  4PHZ A;  4K7J A;  1HN0 A;  4ZXE A;  3E6B A;  2GN7 A;  4NO4 A;  2CL2 A;  3OOX A;  4Y3O A;  3CJI C;  3TEX A;  5FFO C;  1AL2 3;  1UY3 A;  2YPD A;  3NJZ A;  2J1T A;  3H3U A;  4URA A;  2ZEY A;  1JS9 A;  3H7Y A;  4DRV A;  3RZH A;  2ZGQ A;  4K1Y A;  1DQ2 A;  4BQ1 A;  4AVB A;  3LB9 A;  4S2F A;  3MFC A;  2A3W A;  5DAQ A;  3UJO A;  3WZ1 A;  4MGI E;  2NMN A;  2K46 A;  1TNF A;  4W8J A;  4BWO A;  1W8Z A;  2B45 X;  3ZPY A;  1CAU A;  1QOT A;  1TG7 A;  3ZFE C;  2Z4F A;  2PHW A;  1OA2 A;  3LDB A;  4GH4 A;  1N47 A;  5F6L B;  4YM3 A;  5F1R A;  2WLP A;  1VRH 1;  4GH4 C;  4JQT A;  1OUR A;  2Y8K A;  1LOC A;  1OKO A;  1GMM A;  1YQ2 A;  3VZO A;  5FCC A;  1UWW A;  2BNO A;  4BJ0 A;  5IVV A;  3T08 A;  5A3L A;  2A73 B;  2ES3 A;  4DEV A;  2GNM A;  3S7I A;  1OUS A;  3Q9O A;  4L92 A;  2BGP A;  5HV4 A;  3N4M A;  3MIF A;  4C91 A;  2GMP A;  3C7F A;  4W6Y A;  1W2T A;  3NWK A;  5FPL A;  5JIU A;  1HX6 A;  4GB3 1;  4FPY A;  5DAB A;  3ROU A;  5JCT A;  3WT3 A;  1RJ8 A;  2Y33 A;  5D8A A;  1D0G A;  1PVC 3;  3PDQ A;  2OS2 A;  1NY7 2;  3NRU A;  1LOD A;  1O3R A;  1W04 A;  4XUT A;  3EO6 A;  3IMM A;  5KC5 A;  4COU A;  5C4W B;  2PHD A;  4B7K A;  4ET7 A;  4YVW B;  2QE3 A;  1RUJ 3;  1RUC 2;  2XJS A;  3ATG A;  3POB A;  3VDA A;  4DXZ A;  5JR2 A;  3VHO A;  5FZO B;  1I3H A;  1JHJ A;  3NNJ A;  5C71 A;  3MZH A;  4CCL A;  5A70 A;  2RG4 A;  5E1R A;  1HRV 1;  4FBF A;  2P17 A;  4KBB A;  2BER A;  4BQY A;  1KD7 A;  4IE0 A;  2VNV A;  4XCA A;  5SV8 A;  2W1Q A;  1O91 A;  1V00 A;  1N3Q A;  1IKQ A;  2KXL A;  1SLC A;  4XDP A;  4QX0 A;  2L9L A;  1S2K A;  4CDW A;  3LWC A;  5A3U A;  4YWA A;  3KV4 A;  5IK5 A;  1AL0 G;  4LO8 A;  3DCQ A;  4CDW C;  3ZYP A;  2Q1Z B;  5EPA A;  1DQ1 A;  1A8M A;  2B39 A;  5DAW A;  4QPI B;  4LIU A;  1G9F A;  5F9T A;  2ZTN A;  4IDZ A;  1DYP A;  5F5I A;  5HI0 A;  5JI9 A;  1UU4 A;  3UGF A;  2MEV 2;  2WZR 2;  5FJK A;  1CR7 A;  1KJL A;  2KM2 A;  3OYW A;  3VBR A;  3VBR C;  1GZW B;  1QMJ A;  2F4L A;  4RGG A;  4QHB A;  2HWD 2;  2YC0 A;  1RMU 2;  3VZL A;  4GIQ A;  3VD4 A;  3MV0 1;  5T3N A;  4UBH A;  1SBD A;  4YGB A;  2QNK A;  1RUG 2;  5A6Q A;  2GNT A;  1NG0 A;  1Q8P A;  4ASK A;  1CPM A;  5JR7 B;  5A1A A;  1ZBE 1;  2J1A A;  2RM2 3;  3U0Z A;  4NAM A;  3HBK A;  3BUC A;  2GDF A;  1BEV 3;  1WW5 A;  4LKD A;  5DAV A;  1REF A;  4LT5 A;  1WW6 A;  2DTY A;  2VMI A;  1QJZ A;  2GP5 A;  1MS0 A;  2ZHN A;  1GOH A;  1OD5 A;  1H2K A;  2VGD A;  4J6G A;  2WT1 A;  1FV3 A;  4E4S A;  2VVF A;  4HKW A;  4YZ5 A;  2IZW A;  1QNY A;  1WA6 X;  2BQP A;  3TWI A;  3VKF C;  5I93 A;  5JIA A;  5IW0 A;  5JDB A;  1Q8S A;  4HL0 A;  3T4V A;  1ENR A;  1RUE 2;  1W0P A;  2VUD A;  4UYB A;  2ZGU A;  1Q43 A;  3RMY A;  3UYJ A;  5IVB A;  3D0S A;  1YJK A;  2VZP A;  3K3N A;  3UV9 A;  2Z79 A;  1H1I A;  5K0U B;  2BOJ A;  4YW7 A;  4XTP A;  3RRD A;  2C1F A;  2XBO 2;  2D3S A;  2VG9 A;  3N7M A;  4D69 A;  1YQ5 A;  1VLN A;  2ZGM A;  3I4I A;  4GD4 A;  1H2L A;  3ORJ A;  4OI0 A;  1NCR C;  2BU9 A;  3THP A;  1FAY A;  1US2 A;  1W0O A;  4B4Q A;  3RJR A;  2CAV A;  4AHY A;  1JXN A;  2D98 A;  1QXR A;  1ZZ7 A;  1GFF 2;  2VZT A;  2PAM A;  5FXV A;  5J98 B;  4IXL A;  5IFT A;  3RZZ A;  1UYX A;  1YI7 A;  2GAU A;  1K42 A;  3K48 A;  1AR9 1;  5LCW L;  1DGL A;  1EV1 2;  3HQR A;  5FO9 B;  3ZSL A;  3LD8 A;  1Y9Q A;  4MAD A;  2TUN A;  3T4H B;  4D7T A;  2J1S A;  1WGP A;  3LOB A;  1WD4 A;  2H6B A;  4YW2 A;  3WF4 A;  3HAG A;  2VBD A;  2V4A A;  4CDX B;  3HEI A;  1KS5 A;  1NLQ A;  1W8U A;  3PTY A;  2IXC A;  1ASJ 3;  2VOT A;  3ZN6 B;  1ZRE A;  3DUI A;  4GA9 A;  2XML A;  3BPZ A;  2W5F A;  3PVE A;  4D7S A;  3Q8C A;  4QPG A;  5LAT A;  3KD4 A;  2ZX0 A;  1APN A;  2Q30 A;  3GHN A;  4Q8L A;  4OLL A;  1Y3T A;  4QPG C;  1PGL 1;  4Y4Y A;  1SZB A;  4Q4W 3;  2IXJ A;  4WM7 B;  2P3K A;  5I91 A;  3J8F 2;  3JD7 3;  3K51 A;  3M70 A;  4I0W B;  5DDJ 2;  1LOB A;  3OPW A;  4XJU A;  4QU2 A;  4DXS A;  5IT6 A;  5JWP A;  1LES A;  3IIA A;  4JDM A;  4DUW A;  1CES A;  3WP5 A;  2XQX A;  5FPA A;  3I3E A;  4FCA A;  1VP6 A;  2YRO A;  1LHW A;  1LOG A;  1BK0 A;  3MIH A;  3MPB A;  5L73 A;  4Y4R A;  1LAJ A;  5FZH A;  2LM3 A;  2VZU A;  2PHF A;  4F7Z A;  1O4Z A;  4QKD A;  2NN8 A;  4XF3 A;  4TXW A;  4CRQ A;  1AR7 1;  4AGR A;  2VZR A;  1DBN A;  5A1L A;  2YGL A;  4DIQ A;  2C5D A;  4AHW A;  4YZ4 A;  4UW3 A;  1BLZ A;  1VBB 1;  1B35 A;  1FMD 1;  4DXT A;  5CA6 A;  3VLB B;  5IVE A;  3FLP A;  1B35 C;  1PO2 2;  2GMM A;  4KMQ A;  1R64 A;  3LE0 A;  4RR3 B;  1LJ7 A;  3AX4 A;  1C28 A;  2UYA A;  1NOV A;  4PT6 A;  4Q5O A;  5FY4 A;  2OKX A;  4B4P A;  4DNY A;  5C3R A;  4XOG A;  4YRD A;  4AQS A;  1CAV A;  2WWS A;  1VBC 2;  1OUX A;  5FZE A;  2Q8O A;  3RZJ A;  4DUV A;  1GOG A;  1NX9 A;  1OA4 A;  2CAU A;  2QDN A;  4PF5 A;  1J58 A;  3O14 A;  5FZM A;  5L9B A;  4L97 A;  2A6Y A;  1X9P A;  3VGI A;  1R1Z A;  5AVP A;  3RZG A;  4L11 A;  4Y1Y A;  1AYM 2;  1D7P M;  3R05 A;  1TME 2;  2Q4S A;  4Y1Z A;  1DP0 A;  3N3H A;  3SCF A;  4B1M A;  3B69 A;  4IV1 C;  5FBZ A;  4QB1 A;  2ORZ A;  3IB3 A;  1US3 A;  1V0A A;  4QAW A;  3SQO A;  5H9Q A;  2VQ0 A;  2VQA A;  4G9S B;  5FMD A;  3VBU A;  3BTA A;  4TZD A;  5J36 A;  2ZZQ A;  2ZXQ A;  4DO0 A;  2VW1 A;  4BK5 A;  3VBU C;  2PQS A;  2I74 A;  2JXA A;  2R0H A;  1CIY A;  3WQB A;  3LEK A;  4LBJ A;  1VAV A;  4M4P A;  2YHJ A;  3H3L A;  1YWK A;  4LPL A;  5K9Y A;  3JBG 2;  3BOP A;  3TEZ A;  1XNA A;  4DPN A;  2Y60 A;  1JYN A;  3WW1 A;  1JZ8 A;  1XU1 A;  3GBW A;  1TEI A;  3O1M A;  2BGO A;  1ZM1 A;  1UY0 A;  4AL9 A;  4QQP A;  3VL8 A;  1G9A A;  3UL2 A;  4GKY A;  1GV9 A;  2WQZ C;  4RGK A;  2E32 A;  1U5Z A;  4RS5 A;  1ZRC A;  1UYP A;  3HNM A;  3KV9 A;  1DCS A;  3H0O A;  2OA2 A;  3VDD B;  4RS5 C;  5CNA A;  3T2Q A;  4V2W A;  4GJY A;  4EQV A;  1HJF A;  2G4I A;  4K1Z A;  5BXX A;  2FQP A;  4I30 A;  4ARY A;  4QB2 A;  2W94 A;  3KF3 A;  3OBA A;  3J4U H;  3VKN A;  1SBE A;  4JKM A;  2BBV A;  4JZR A;  4XAA A;  3L2Y A;  3I2J A;  1O6U A;  1U5I A;  4TYS A;  1K5J A;  4H55 A;  1SAC A;  4QDQ A;  4I0B A;  3B94 A;  4GKX A;  2E26 A;  2J22 A;  3CNA A;  2Y26 A;  4XQW A;  3IWZ A;  2HWC 1;  2HEW F;  1VBD 1;  4Q4V 2;  3T1L A;  2ARX A;  3DXU A;  5EP9 A;  3HNY M;  3D5O A;  4KWK A;  4B7E A;  1POQ A;  3VBS A;  1G9C A;  3H50 A;  4XJA A;  4UW5 A;  3MF9 A;  3VBS C;  4YGE A;  1W8W A;  2VZ3 A;  2BFU L;  1SHW B;  1ZZ8 A;  3T3Y A;  3VHR A;  1N1S A;  3KCX A;  5GZG A;  3AJY A;  3IAP A;  1CAW A;  4BQ3 A;  4KG0 A;  2XR4 A;  3D82 A;  1QJY 3;  3NMB A;  4DS0 A;  3V56 A;  4NPL A;  5EIY B;  2NLR A;  3W59 A;  1QGL A;  1J3R A;  1LOF A;  4M3C F;  4Q4X 1;  3CHX A;  1PIV 3;  2R07 3;  1RHI 1;  5BNO B;  3OEA A;  2A6X A;  1PMH X;  1YQ6 A;  4CPB A;  1PZ8 A;  4C90 A;  2JIG A;  4IEZ A;  1J1T A;  1PMJ X;  1BEV 2;  2WLQ A;  4F8A A;  4MXW B;  3BCW A;  5FYV A;  1RUO A;  2DCY A;  1VMJ A;  3OD4 A;  3ZXL A;  4HT1 T;  4HPK B;  1GOF A;  1T2X A;  4PJY A;  3ZR5 A;  1LRH A;  2HWF 3;  4RFT 0;  2PTM A;  1HIX A;  4KL1 A;  4XAE A;  5APA A;  1UZ0 A;  3RMX A;  3TN9 2;  4HVQ A;  2P3J A;  2FBE A;  2RS5 2;  1Y9M A;  5FBJ A;  1QXP A;  1R08 2;  4FFI A;  1QWR A;  2BP6 A;  3IM0 A;  2RR1 3;  4WVM B;  1QHD A;  1AR8 1;  4M3C A;  1DG6 A;  2QQO A;  4J1W A;  4M3C E;  4ES8 A;  2XDV A;  3OTF A;  3USU B;  4FI9 A;  3WG4 A;  3OBR A;  1XQN A;  2VUL A;  5CEH A;  1AZD A;  3PME A;  3LIH A;  1I6X A;  2DBI A;  2F17 A;  4JHT A;  3ZXG A;  5CB7 A;  4DFS A;  3U1X A;  4NID A;  4WZC A;  3LSD A;  1X36 A;  2R06 3;  3ES1 A;  3I8T A;  4KWL A;  1NCQ A;  3UGG A;  1YYN A;  3M3Q A;  2W1U A;  2A7A A;  1OT5 A;  1RVF 3;  1DGR A;  4ZPI A;  4LQR A;  4NAO A;  4CCC A;  2UUR A;  1BBT 1;  3NAP C;  5ABJ C;  2D6K A;  4I3P A;  2R49 A;  1RED A;  2CDP A;  3AL5 A;  4UWD A;  5T5P A;  5C9A B;  2XH6 A;  1YFY A;  1R09 1;  1W3X A;  3PVN A;  5FZ1 A;  4LKE A;  3T30 A;  1POV 3;  1YNA A;  4EN7 B;  4AWD A;  4J25 A;  2WA4 A;  2YV8 A;  3ES4 A;  5FP7 A;  4CA9 A;  3POI A;  1R1A 3;  3S30 A;  4CP0 A;  3TOJ A;  3B3Q E;  4UI9 L;  5FV3 A;  1G9D A;  1QH7 A;  1ULE A;  3CEW A;  2VNO A;  3OGR A;  1J1L A;  5DZE A;  5FZD A;  1KRI A;  4UFH A;  2P1B A;  3H8X A;  1IS6 A;  1HXS 3;  4HAN A;  3WNK A;  1FNZ A;  4AE2 A;  2AEY A;  1TQ5 A;  1UZV A;  2JG9 C;  1Y4W A;  1O7F A;  2WN3 A;  4B29 A;  2ZAB A;  1MZF A;  1PM4 A;  5DMY A;  5I0D A;  3POG A;  3FHA A;  4E2G A;  2RMU 3;  1C4R A;  5CAZ A;  2CNA A;  1J83 A;  3ZYR A;  3P3P A;  4IL7 A;  2J42 A;  1QJU 2;  2P34 A;  4CDU B;  4DRR A;  4XFC A;  3A4U A;  4BLI A;  5T55 A;  5HXV A;  1SBF A;  1VBA 3;  2GH2 A;  2YU1 A;  4MVT A;  1NA1 C;  3TEW A;  5DUU A;  5A32 B;  4ZHN A;  5BNN A;  1FAT A;  3V0A B;  1ND3 B;  3KT7 A;  4AQ2 A;  2WNV B;  2E7A A;  5BNN C;  3FLT A;  1RUI 3;  5FY8 A;  3PUQ A;  3C7G A;  2BV4 A;  4YM1 A;  3BIE A;  2D5H A;  4BH9 A;  4DZG A;  2D3R A;  5C7G A;  2JDM A;  3VBH C;  4FPL A;  1RUD 1;  1W8N A;  1W6P B;  5A6Z A;  3RS6 A;  4CEY A;  4XDQ A;  4RQP C;  4CUB A;  4M0N A;  3B00 A;  2J1U A;  5C6C A;  3D4K A;  4NRP A;  1OLM A;  2P3Y A;  1GP4 A;  3WP3 A;  1OLM E;  3LDR A;  4W4Z A;  3ZOI A;  5L7O A;  5L7O C;  2GH8 A;  1L7R A;  1SQ4 A;  2N7G A;  3PL0 A;  3B7M A;  1OOP A;  4OUS A;  1WLT A;  2CYF A;  2JEM A;  2WQ8 A;  5GM0 A;  1YC6 1;  2D40 A;  2ERF A;  1OOP C;  1D4M 2;  4QX7 A;  1DGR N;  2VMH A;  1Q5O A;  2JG8 B;  4YZ3 A;  3HJR A;  4BQX A;  2ILM A;  4ES9 A;  5CFC C;  3M3E A;  4MGZ E;  4PLN A;  2QQU A;  3FUQ A;  1GKB A;  3M1H A;  4P9X A;  5FY7 A;  3SH3 A;  1BZW A;  3KCY A;  5ACA 1;  2ARA A;  2Y64 A;  4XMA A;  1PO1 2;  4CEW A;  1DQ6 A;  2RDQ A;  3VBO B;  4XQ4 A;  3IN9 A;  1EYB A;  2IXH A;  3PVB B;  1T6B X;  5FP9 A;  3VHN A;  2G1M A;  2WFF 3;  5FY9 A;  1JOP A;  1UY4 A;  2Z42 A;  3PTR B;  3IDB B;  3I7D A;  2ZEX A;  3USS A;  3W5N A;  1S2E A;  3KZ4 C;  2XJP A;  2P5B A;  3AP9 A;  4PIY A;  1UCX A;  1VBD 2;  1L3J A;  2XOM A;  4GWI A;  5D1I A;  4AQ6 A;  1GQH A;  2ZJC A;  3AXE A;  3HBZ A;  3OUH A;  3QBQ A;  1K3I A;  4GMP 1;  3WW3 A;  2WL1 A;  4JQR A;  3ZR6 A;  2X5I B;  3E1F 1;  1EAH 3;  4XXP A;  1XE7 A;  2WO2 A;  1VIW B;  3LIG A;  2VUC A;  2Z69 A;  4X6Q B;  4MV2 A;  4BHP A;  4KNC A;  2QQJ A;  1UX7 A;  3WG3 A;  1FOD 3;  1V6K A;  1DHK B;  1H4H A;  5H9P A;  5BYN A;  2AUY A;  3O0X A;  1UIK A;  3KB5 A;  3PUA A;  2XJR A;  5CAD A;  1WWY A;  2JWP A;  3HMY A;  5IHR A;  3V0B A;  5EFU A;  4N8M A;  2HWE 2;  4AQT A;  4YW3 A;  2RS3 3;  2YU2 A;  2SLI A;  3Q8E A;  4GQ7 A;  3TEY A;  1NY7 1;  1QKQ A;  3NKT A;  2Z2S B;  3NST A;  4Z2A A;  1IS3 A;  1U5X A;  3IPV A;  4LIV A;  2BPA 2;  4S2H A;  1RUC 1;  4AFM A;  1SCS A;  3B5L B;  3ZM8 A;  2VMD A;  4EYU A;  4JTN A;  2WA3 A;  2RHP A;  3FC0 A;  1SEF A;  3BGA A;  2Q5T A;  4UFJ A;  3NW4 A;  1AX0 A;  2GP3 A;  2QQV A;  3C7O A;  3WDV A;  2WIN B;  4COV A;  4IV3 A;  1PHM A;  2WAO A;  3EYP A;  3VD3 A;  3THT A;  3A23 A;  1DIW A;  2VOV A;  3WP6 A;  4TSV A;  3BVC A;  2D3P A;  2R04 3;  2UY9 A;  3DXT A;  5F39 A;  2DFB A;  2JKX A;  1RUH 3;  5JPN B;  1W05 A;  3HD8 B;  4P5H A;  3W5M A;  3LA7 A;  2HWB 3;  1OH3 A;  2QVS B;  3H7J A;  1HQL A;  4Y24 A;  5D8A B;  3E5X A;  4NIA A;  3PNA A;  2MEV 1;  4HLT A;  2EIE A;  2NYY A;  5A3W A;  2PEL A;  5CBL A;  2MNG A;  3POF A;  2IFW A;  4NHK A;  4XJZ A;  4BB3 A;  5J37 A;  2VCC A;  1LED A;  1DLC A;  3TNP B;  4QU1 A;  1W28 A;  2HWD 1;  1RMU 1;  3PU3 A;  4ORF A;  3M8L A;  5LBB A;  3U10 A;  3JCI A;  2Y6H A;  1W9S A;  3AP4 A;  2WBK A;  1RUG 1;  4K3U A;  1H9P A;  1JYT A;  2NMO A;  1XB9 A;  1PMI A;  2RS1 3;  1TVG A;  1UO9 A;  2P2K A;  5FYB A;  4HVR A;  4E8C A;  3NNG A;  1DZQ A;  3OGJ A;  4YYO A;  3ZDS A;  1ZBA 3;  3CMG A;  2WWU A;  1S55 A;  4L8Q A;  1FPN 2;  2WC2 A;  4Y5Z 0;  3VL9 A;  4DEQ A;  4I0A A;  2WS9 3;  2E31 A;  2I07 B;  1GLH A;  2A70 A;  3K75 B;  3NO8 A;  4N43 A;  1YUD A;  4PDW B;  1COV 1;  3T2P A;  3I49 A;  4N43 C;  4XJW A;  2OUJ A;  3SXW A;  3EQE A;  4KQ7 A;  4RD7 A;  5FPV A;  1DYO A;  1QY4 A;  2LTN A;  3OYW B;  4LEJ A;  3VBR B;  3WVJ A;  4Q0Q A;  1G6N A;  2VAU A;  1JZ7 A;  3ASI A;  1OPM A;  1ULC A;  4CDQ A;  1H8T A;  4OQ9 A;  3AL6 A;  1U5Y A;  4OI2 A;  2OX0 A;  4DY3 A;  4CDQ C;  1H8T C;  4LBL A;  1AR6 3;  1MS1 A;  5JSP A;  3U14 A;  3U4S A;  2VL4 A;  3LKJ A;  4QKB A;  1RUE 1;  2XLF A;  1Y9G A;  2H0B A;  2CTV A;  1ND2 B;  3OPZ A;  1W9W A;  2G9F A;  1W6N B;  2IXL A;  2LRO A;  1WD3 A;  2VM9 A;  2TNF A;  2B5H A;  1HJG A;  4R9B A;  4V1P A;  4KH9 A;  4DB5 A;  3NV3 A;  1Q56 A;  2XBO 1;  2ZHL A;  4MHU A;  2X09 A;  4JC1 A;  3SKJ E;  5AC9 2;  5IAT A;  3SHR A;  1ULP A;  3OUI A;  3GCW A;  4BME A;  1W2N A;  4P00 B;  2HH9 A;  5C33 A;  4L2N A;  2EXI A;  1F15 A;  2W46 A;  1XND A;  3DEC A;  5JMC A;  1S0B A;  4AHZ A;  1REE A;  5FDB A;  1RYY A;  5GJ6 A;  5LW9 A;  3OEB A;  3EHK A;  1YIF A;  3I3D A;  5FZ8 A;  4JDN A;  1EV1 1;  1OPO A;  2HEY F;  4HK9 A;  2EIG A;  3VB9 A;  5A33 A;  2FMY A;  1OF3 A;  4FSJ A;  3GZU C;  3WP4 A;  3WLU A;  3P1I A;  1MVE A;  5AFE A;  3FUO A;  4CCN A;  2WNU A;  2ZGR A;  4Y20 A;  2EXJ A;  5LY2 A;  3BPS A;  3THC A;  1HRI 1;  3CJI A;  2WNU C;  2ET7 A;  3SCH A;  1DZT A;  1YI9 A;  3J7M A;  1ZZB A;  4GAZ A;  1VRH 3;  4A3X A;  3RZM A;  3WF2 A;  3AZW A;  4FO9 A;  4NWW A;  3POS A;  4AGG A;  2DU0 A;  2YC4 A;  3SCG A;  1UL9 A;  1Z7S 2;  3OJB A;  3EMR A;  3E97 A;  3ZFE A;  4P9W A;  4WVZ A;  1GZT A;  4FPO B;  5BUV A;  4MSV A;  4R9C A;  3MGU A;  1KFX L;  1OLQ A;  4HMZ A;  3J8F 1;  4EN6 B;  3BTX A;  4GB3 3;  3QAC A;  4V2V A;  5DDJ 1;  2FCV A;  4BCU A;  3U37 A;  3VBF B;  1UZZ A;  3RZK A;  1QNW A;  5KXD A;  4BYY A;  4OUL A;  4FOQ A;  3F2Z A;  3H9A A;  2W1S A;  3I59 A;  3V64 A;  4YG0 A;  1UKG A;  1GP5 A;  3ETQ A;  4IEO A;  2C9A A;  4L0P A;  1DU3 D;  2YBK A;  1GWL A;  5LEJ A;  2QJV A;  2GNB A;  1PVX A;  2OQ7 A;  2ZS6 B;  4RSU A;  1NAE A;  1UN1 A;  1HRV 3;  2ZGS A;  3I3Q A;  4KBZ A;  2BNN A;  2AC1 A;  2K9Z A;  2W08 A;  4Q4Y 2;  1AXK A;  1KDM A;  3IZO A;  4NRO A;  4RN5 A;  3PVO A;  2WT0 A;  5EWS A;  1POV 0;  5E16 A;  2HBT A;  1H6X A;  1PO2 1;  2IUW A;  4DMI A;  4XJ8 A;  2E9Q A;  1NQD A;  2R16 A;  4MXV A;  2VVE A;  3RZL A;  3WF0 A;  4UOJ A;  1PNG A;  3RPQ A;  2GC3 A;  3ZFF B;  1XNB A;  4MGS A;  2VC9 A;  1AX1 A;  4OFG A;  2QZ3 A;  2C24 A;  2Q1F A;  1VBC 1;  1WA4 A;  3C8X A;  2WT2 A;  3N9N A;  1LCL A;  5LWB A;  5DAX A;  3ACL A;  1UU5 A;  5DG1 A;  3LEG A;  1LHO A;  4K8F A;  1AYM 1;  1TME 1;  2BVV A;  2G19 A;  3M4F A;  5FYI A;  5JPM B;  4E2S A;  3ZFG C;  4JGZ C;  2EVX A;  2Y0I A;  2RVA A;  4YAR A;  1UMI A;  4COW A;  4CP2 A;  1EY2 A;  4RHV 2;  1MS5 A;  1XU2 A;  2EIB A;  1ZBE 3;  1ZNP A;  2GAL A;  3LDK A;  1VBE 2;  3DV8 A;  1KQR A;  1WLC A;  4NJ4 A;  4DY5 A;  4LOS A;  2VPV A;  3JBG 1;  3W20 A;  5F8P A;  1NKG A;  4XF4 A;  5IVJ A;  1CAV B;  1PVC 1;  3AZV A;  1MQT A;  4Y5T A;  4AED A;  2JB4 A;  4A4A A;  1HQW A;  2E7T A;  5JOX A;  1MQT C;  4AED C;  4N53 B;  5BNP A;  1JH5 A;  5FYH A;  5FMO L;  1JOD A;  1F35 A;  5BNP C;  4C1X A;  2GN3 A;  1F31 A;  1G9B A;  3OF1 A;  1UPI A;  1QJF A;  2FDH A;  4XBL A;  4AI1 A;  4NPR A;  1HB1 A;  4YM2 A;  1GZ9 A;  1UW8 A;  1MZ5 A;  2OPW A;  3HIF A;  2VR4 A;  4OHX A;  2OVU A;  4I01 A;  2R6Q A;  1ZZ6 A;  3MLJ A;  1WLD A;  1COV 2;  4W65 A;  3JQW A;  4HZF A;  5F2S A;  2VO5 A;  3DPR A;  3G6J B;  2VCA A;  1KDK A;  2XUE A;  4EZ4 A;  4E9K A;  5ISL A;  1QJX 3;  2JX9 A;  3DPR C;  4W6X A;  1RIN A;  4KG8 A;  1ULF A;  1UOB A;  4N7U A;  1FNY A;  1V6L A;  4Q4V 1;  2W47 A;  2DU1 A;  5ANN A;  3PIG A;  4EWE A;  3FN9 A;  1WCK A;  5TSW A;  4G3Y C;  3ZXK A;  3ILN A;  2YG0 A;  2ZBJ A;  3OY8 A;  4L99 A;  1H4G A;  4M00 A;  1LTE A;  2JIC A;  4RS5 B;  2XVL A;  5IK4 A;  3M3I A;  3EB7 A;  4YM0 A;  5GZF A;  5KHI A;  5FJH A;  1AR9 3;  2VD7 A;  4LTA A;  4CCK A;  4QX5 A;  4ISQ A;  1EPZ A;  1FT9 A;  2VME A;  1RIR A;  2EAL A;  3KGZ A;  3VZN A;  4JKL A;  4P9I A;  1NCR A;  4O9G A;  4JGY A;  4IEW A;  1A3K A;  3SEP A;  4JGY C;  1HDK A;  3KWV A;  2GND A;  4ISR A;  4IUG A;  1BEV 1;  4AGV A;  1ZX5 A;  2VTX J;  1CPN A;  3ZXA C;  1PGW 2;  1IQA A;  3K2O A;  4UFK A;  2D5F A;  1ZBA 2;  3PJY A;  1OC1 A;  2J1E A;  5JOW A;  5JZG B;  4FTS A;  3GGL A;  1CWP A;  1W9F A;  1LGC A;  3AMN A;  1JOB A;  3KVA A;  2LAL A;  1S4C A;  3WW2 A;  1H30 A;  2RDS A;  2V5Y A;  1ACC A;  2VH9 A;  3TN9 1;  2EF6 A;  2ZEW A;  3OG2 A;  2VXJ A;  2RS5 1;  2JDZ A;  3ZN4 A;  4QHZ A;  1R08 1;  2E6V A;  2QQI A;  3NQH A;  2VQU A;  4QM8 A;  4QX1 A;  1BXH A;  5FZK A;  1HRI 2;  2YC2 A;  1CAW B;  2P3I A;  1HB3 A;  1W6M A;  2AAC A;  1VPH A;  3AP6 A;  2G9Z A;  1VR3 A;  1BMV 2;  1FI2 A;  1OVS A;  1NXM A;  2QFE A;  4FFF A;  4IGP A;  3MBW A;  3M2M A;  1FV2 A;  1JZ2 A;  1JOJ A;  3AB0 A;  3K3O A;  3B9C A;  1AYN 2;  2CSG A;  4IEU A;  5IUQ A;  1OVP A;  2ZA9 A;  2DCJ A;  1FYU A;  4FQ4 A;  4XUP A;  1B09 A;  2LS6 A;  4YPJ A;  1WME A;  3JUU A;  3Q8A A;  1AR7 3;  4YW1 A;  4BQ5 A;  3ILR A;  2XJT A;  4P14 A;  3SIS A;  4F3J A;  2DUP A;  2JDH A;  4XIK A;  4CXX A;  1VBB 3;  3W9A A;  1FMD 3;  4J1X A;  3H8R A;  4LUL A;  3S7E A;  3AP7 A;  5FAX A;  3GNE A;  4AXO A;  3HWJ A;  2DVB A;  3VV1 A;  4BE3 A;  4Y1V A;  3W21 A;  1LR5 A;  4XAB A;  3LCP A;  5FKC A;  4QX3 A;  4NRM A;  3ZMN A;  1W06 A;  3H1M A;  3PMS A;  3MDP A;  4PF1 A;  4M3C B;  2DUR A;  1MZE A;  3GXU A;  1NE4 A;  1LB2 A;  1C8M 2;  2BTV C;  4A3Z A;  3MIE A;  3AFK A;  3O1U A;  4HBN A;  3MW2 A;  3MUY 1;  5LA2 A;  1ZVF A;  5C4W A;  4K8R B;  4QDR A;  1IS5 A;  4URT A;  1DLL A;  4PIX A;  5C4W C;  2Q8C A;  1PZ7 A;  2DBN A;  4YVW C;  1UU6 A;  1ASJ 1;  3MW3 A;  1AL2 2;  4O9E A;  3AXD A;  4LIT A;  2CGP A;  2ARE A;  2D6M A;  3POJ A;  2TEP A;  4LK7 A;  1XE0 A;  3U11 A;  1DF0 A;  2WNE A;  1WW7 A;  1NCQ B;  1UQX A;  4I3G A;  3ZLI A;  3MIB A;  4WVW A;  2R1B A;  4YNI A;  2ZGN A;  3AMQ A;  3UK9 A;  1IS4 A;  4MH0 E;  1XYP A;  5G04 L;  3KLS A;  3GF6 A;  2YFZ A;  4G4F A;  2VZ1 A;  3R6S A;  2X53 S;  5KHK A;  4IEY A;  4UFI A;  3WUD A;  1F8V A;  1VAL A;  3ACH A;  3N35 A;  1QJU 1;  3POW A;  4NE9 A;  4DUX A;  3O1O A;  4QPI C;  4IV1 A;  5JXI A;  4LUK A;  2QDR A;  1L7Q A;  2HYK A;  3INA A;  2ZHM A;  1OBN A;  2P6C A;  2PHT A;  3SH4 A;  4MUV A;  5EZW A;  4LMF A;  5T5J A;  4CU8 A;  1GZW A;  2A75 A;  4E4D X;  4MGY E;  1M4W A;  4N7I A;  1W2O A;  1NT0 A;  3WHT A;  2Y0O A;  4QD2 A;  3GJB A;  4A6S A;  3RI9 A;  3OGG A;  1JTZ X;  5FMB A;  5FO7 B;  1CAX B;  5DUX A;  1MPX A;  1XPW A;  1PVC 2;  2XLA A;  3HPN A;  5BPX A;  4QGN A;  3SLI A;  4BQ2 A;  5FQ0 A;  5LA1 A;  2BFU S;  4QXK A;  3MFA A;  3AVS A;  4YFZ A;  2FD8 A;  5DAP A;  2ZCW A;  5LBE A;  4Y5S A;  4KI5 M;  3WG2 A;  2FHR A;  4FP2 A;  4XFG A;  2BBA A;  5JI7 A;  1RUJ 2;  4A41 A;  5C8C B;  1D4M 1;  2VVD A;  2HWC 3;  2A71 A;  2ZGL A;  3I2G A;  4AI9 A;  3PU8 A;  3AKQ A;  4JRL A;  1K5M B;  4AI2 A;  4CYD A;  1PO1 1;  4AEM A;  3T0D A;  3DYO A;  1UF2 C;  5FPX A; 
#chains in the Genus database with same CATH homology
 4W4Z A;  4D8M A;  2LW8 A;  4AAX A;  3I2I A;  5C70 A;  1L7R A;  2WQ8 A;  3P6B A;  2WO1 A;  3AC0 A;  3CDZ B;  2Y6J A;  3HJR A;  2WUH A;  2Y6G A;  1UY1 A;  5DQ0 A;  2QQN A;  2VMF A;  2Y64 A;  1JZ5 A;  2ORX A;  3T0A A;  1KEX A;  5B4N A;  3MO4 A;  4ZZ5 A;  4HG6 B;  1UY4 A;  4W50 A;  2JD9 A;  2ZEX A;  3W5N A;  3I2K A;  3IAQ A;  1XC6 A;  2XOM A;  4GWI A;  3BN6 A;  3WNM A;  4A6O A;  2R7E B;  2VZQ A;  4BK4 A;  1K3I A;  4CU9 A;  2E33 A;  4ZXE A;  3E1F 1;  3C7H A;  1UY3 A;  5HXM A;  2WO2 A;  4GWJ A;  2J1T A;  2ZEY A;  2QQJ A;  1UX7 A;  1ULO A;  1JYX A;  4W8J A;  1GU3 A;  3K4Z A;  1W0N A;  2VZV A;  4AG4 A;  1PX4 A;  1TG7 A;  5IHR A;  4OYU A;  2Z4F A;  3VD5 A;  4A45 A;  1CZV A;  3CZU A;  4D0Q A;  2Y8K A;  3T0B A;  1GMM A;  1UY2 A;  1YQ2 A;  2J1V A;  2EIC A;  1UWW A;  4BJ0 A;  3T08 A;  3T2O A;  3ZM8 A;  4DEV A;  2VMD A;  2BGP A;  1GUI A;  2C9K A;  3C7F A;  3BGA A;  3C7O A;  2WAO A;  3EYP A;  3VD3 A;  3A23 A;  2VJX A;  3FHQ A;  3NRU A;  2KD7 A;  2V4V A;  4XUT A;  3THD A;  2JKX A;  2WDB A;  4XUR A;  4ET7 A;  5JR2 A;  3VDA A;  3W5M A;  4A42 A;  1JHJ A;  5C71 A;  3WNL A;  2BER A;  2EIE A;  3IDA A;  3SEE A;  5CYY A;  4XUN A;  2W1Q A;  2VCC A;  1DLC A;  4MGQ A;  4QX0 A;  2L9L A;  1JYV A;  3CZJ A;  3LQC A;  3WNN A;  3NJX A;  2Y6H A;  1HN1 A;  1W9S A;  3I2F A;  2QBX A;  2WBK A;  3K4A A;  4XUO A;  4JKK A;  4QPW A;  3OGS A;  1TVG A;  5HPO A;  2RV9 A;  1W8O A;  4E8C A;  3NNG A;  3CMG A;  1PX3 A;  4DEQ A;  2E31 A;  3K75 B;  2J1R A;  2WO3 A;  3T2P A;  3VD4 A;  3MV0 1;  2W91 A;  2YFU A;  1DYO A;  1I5P A;  1JZ3 A;  1JZ7 A;  5A1A A;  2J1A A;  3LPG A;  1F4H A;  3DYP A;  1JZ4 A;  2Y6K A;  2VL4 A;  1UMH A;  5IJR A;  2V72 A;  3OB8 A;  3T09 A;  1W9W A;  4LKS A;  1GOH A;  2VM9 A;  2EID A;  3K77 A;  1KGY A;  1UYZ A;  2X09 A;  5G05 L;  3SKJ E;  4ZZ8 A;  1EUT A;  1ULP A;  2ID4 A;  5JXG A;  4P00 B;  3PUI A;  2W46 A;  3DEC A;  2VZP A;  1RYY A;  3A7Q A;  1OD3 A;  3OEB A;  5JXJ A;  3I3D A;  4QX2 A;  1LNS A;  1OF3 A;  3P1I A;  3UES A;  2XHN A;  3THC A;  1NUK A;  1US2 A;  2VCB A;  2VZT A;  5IFT A;  4CU7 A;  3WF2 A;  2WZ8 A;  1UYX A;  4TTG A;  3MUZ 1;  1K42 A;  2YC4 A;  5LCW L;  3FL7 A;  5LA0 A;  4MAD A;  3I97 A;  2J1S A;  3WF4 A;  3ECQ A;  3CIH A;  3UET A;  3HEI A;  4JHZ A;  5FUI A;  3U37 A;  2VOT A;  1CZS A;  3F2Z A;  2W1S A;  2W5F A;  1SG3 A;  1UXZ A;  4L0P A;  3VDB A;  2QQK A;  1NAE A;  4RN5 A;  4DXS A;  4DUW A;  1H6X A;  2XQX A;  3I3E A;  3WF0 A;  4XVH A;  4UOJ A;  5CZK A;  2VZU A;  3DYM A;  4MGS A;  2VQT A;  2VC9 A;  4MOA A;  4TXW A;  3C8X A;  5IFP A;  5B4X A;  2VZR A;  3ACF A;  3VDC A;  1JZ6 A;  1GNY A;  2CDO A;  3LEG A;  3WSO A;  4DXT A;  3I2H A;  4KMQ A;  1R64 A;  3LE0 A;  2RVA A;  1UMI A;  4GZ9 A;  4PT6 A;  2OKX A;  5JUV A;  1O8S A;  4OMC A;  4ARX A;  2JE8 A;  1JU3 A;  2EIB A;  2ZEZ A;  4DUV A;  2WZE A;  3VD7 A;  1GOG A;  1NX9 A;  1NKG A;  1D7P M;  4PQQ A;  1DP0 A;  3NJV A;  2QQM A;  4LHS A;  4A4A A;  3OGV A;  1JU4 A;  4QB1 A;  2ORZ A;  3IB3 A;  1US3 A;  1K12 A;  4QAW A;  5F7U A;  1SDD B;  1P8J A;  2ZXQ A;  5DPN A;  2W3J A;  4BK5 A;  3WEZ A;  1BHG A;  2PQS A;  2Y6L A;  4OUE A;  1CIY A;  3K4D A;  2C4X A;  3WQB A;  3LEK A;  1F4A A;  3K46 A;  4M4P A;  1O59 A;  2HYX A;  4LPL A;  5IYY A;  2VR4 A;  3HN3 A;  1K45 A;  2DDU A;  2B4K A;  1XNA A;  1JYN A;  4CVU A;  1JZ8 A;  2VO5 A;  3ACI A;  2BGO A;  4RYD A;  1UY0 A;  4BXS V;  2X05 A;  2VCA A;  4CUA A;  2E32 A;  3HNM A;  4OMD A;  3VD9 A;  3T2Q A;  2W47 A;  3ABZ A;  1EUU A;  5DN2 A;  3FN9 A;  2YB7 A;  2YG0 A;  3J7H A;  4OZO A;  4QB2 A;  2W94 A;  3WNO A;  4ARY A;  1UYY A;  1IQD C;  2WYS A;  3CQO A;  2WN2 A;  3OBA A;  4JKM A;  3EB7 A;  3I2J A;  4XZU G;  4KWU A;  4QDQ A;  3III A;  2E26 A;  2J22 A;  2VME A;  5J1X A;  1OH4 A;  4MO3 M;  4JKL A;  1WCQ A;  3HNY M;  3SEP A;  4QB6 A;  4IUG A;  3I3B A;  2JDA A;  2C26 A;  2VZ3 A;  1SHW B;  1CZT A;  2J1E A;  1H6Y A;  3IAP A;  3GGL A;  4CU6 A;  5EJ1 B;  5EIY B;  4UAP A;  2ZEW A;  3OG2 A;  3LEI A;  1UXX X;  2QQI A;  3NQH A;  2V5D A;  3OEA A;  1PMH X;  2VQU A;  4QX1 A;  2YC2 A;  5EJZ B;  1PMJ X;  4ZY9 A;  4XUQ A;  2W9X A;  4P02 B;  1GOF A;  1T2X A;  1JZ2 A;  2B9V A;  3MBW A;  3HNB M;  2WAB A;  1UZ0 A;  2DCJ A;  4XUP A;  2LS6 A;  4YPJ A;  1O8P A;  2W87 A;  2X10 A;  3C7E A;  2QQO A;  4FI9 A;  4JX0 A;  2VMC A;  1CX1 A;  3LPF A;  4QX3 A;  2VZO A;  1JYW A;  4PF1 A;  3GXU A;  3JXS A;  4A3Z A;  1W99 A;  4QDS A;  3MUY 1;  3GDB A;  5LA2 A;  4QDR A;  2VZS A;  2W1U A;  2BZD A;  2WAA A;  1OT5 A;  3A21 A;  4LQR A;  2CDP A;  3ETP A;  1XNT A;  3ACG A;  5G04 L;  3HOB A;  2YFZ A;  2VZ1 A;  3A22 A;  4UI9 L;  3PUH A;  3ACH A;  3OGR A;  4CUC A;  4DUX A;  2RJ2 A;  4P5Y A;  5JXI A;  2HLE A;  1OF4 A;  1L7Q A;  3SKV A;  3WNK A;  2VTF A;  3WNP A;  5JMO A;  4CU8 A;  4M4R A;  1J84 A;  2WN3 A;  3WF1 A;  5DMY A;  2W95 A;  5I0D A;  3GM8 A;  3FHA A;  1W9T A;  1J83 A;  1MPX A;  1XPW A;  3HPN A;  4A44 A;  3WF3 A;  5LA1 A;  1JI6 A;  1WKY A;  3MV1 1;  5JXH A;  4KI5 M;  3CKH A;  4E8D A;  2BBA A;  4A41 A;  3UNP A;  4P08 A;  4Z2A A;  2DCK A;  2QQL A;  2W92 A;  3C7G A;  2XON A;  4BDV B;  3I2G A;  5C7G A;  2W1W A;  3D3A A;  1GQP A;  1W8N A;  4CUB A;  3T0D A;  3DYO A;  2J1U A;  2J7M A;  4DXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...