2RJ2A

Crystal structure of the sugar recognizing scf ubiquitin ligase at 1.7 resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
185
structure length
185
Chain Sequence
GSHMFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDGNVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution
rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords F-box only protein 2
total genus 39
structure length 185
sequence length 185
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2rj2A00
3I2JA 2WZ8A 5IFPA 2BZDA 1US2A 2VCBA 3WSOA 3NJXA 3FL7A 4JHZA 4Z2AA 1W8NA 2VQTA 3E1F1 2VMDA 1D7PM 1IQDC 3WF0A 2J22A 5DN2A 3BGAA 2VOTA 4W50A 4OMCA 1GU3A 2VMFA 4D0QA 2B4KA 1XNAA 1O8SA 2W1SA 2W1QA 2QQMA 1F4HA 2W87A 2QBXA 4CU6A 1W99A 1TG7A 1KEXA 2ORZA 4BK5A 1UY3A 3CZJA 4GWIA 2XHNA 1W8OA 1DLCA 1NKGA 2Y8KA 1SDDB 3VD3A 4E8DA 4JKLA 2Y6HA 2W46A 3MBWA 5FUIA 4A44A 3SKJE 2WAOA 1GMMA 1NX9A 3FHAA 4CUCA 4MOAA 2XONA 1PX3A 2VZQA 5JXHA 3I2KA 5LA0A 1JZ2A 4ZXEA 4OYUA 2EIBA 5C7GA 5A1AA 2VM9A 2BGPA 3C8XA 1K3IA 4DXRA 4DXSA 4XUQA 2BBAA 3K4AA 2QQKA 2VZ1A 1OT5A 1CZTA 1CIYA 4A3ZA 3VDCA 2XQXA 3MUZ1 3C7HA 1UYZA 5JMOA 5JXGA 1JZ4A 3C7FA 4KMQA 3FHQA 1OF3A 3WNMA 1JZ3A 3EYPA 3HPNA 5CYYA 3ABZA 2W94A 1T2XA 4XUNA 1DP0A 1SG3A 3GGLA 1CX1A 4QX2A 5DQ0A 3LE0A 2C26A 3WNNA 2J1VA 2WAAA 4P02B 2RV9A 3ZM8A 2VZSA 4ARXA 5EJZB 2E26A 2J1UA 3UETA 3WF4A 3T2PA 2E33A 3CIHA 3CMGA 3IB3A 4BK4A 1K12A 1LNSA 2QQIA 3IAQA 3ECQA 4HG6B 3THCA 1L7RA 4M4PA 1UYXA 1OH4A 2C4XA 2VO5A 4P00B 3K46A 3W5MA 4AAXA 4XUTA 1XNTA 2ZEXA 4IUGA 5DPNA 1K42A 4CU8A 1OF4A 2ZEWA 3P1IA 2W1WA 1GOFA 3OG2A 3OGRA 4GZ9A 1JHJA 3WNOA 2V4VA 1WKYA 2LS6A 3OEBA 3OBAA 2VZ3A 2L9LA 3HN3A 5LA2A 4DUWA 5I0DA 3NJVA 2WO2A 5LA1A 5C70A 1UZ0A 2WDBA 2KD7A 1J83A 3WF2A 3WQBA 2CDPA 2J1SA 3SEEA 1UXZA 1JYWA 3I97A 4XUOA 1XC6A 2YG0A 5IYYA 4XUPA 4ZZ5A 1GOHA 4KWUA 5B4XA 4CU9A 3LEIA 3WF3A 1CZVA 1W9WA 1H6YA 2EICA 4MO3M 2XOMA 1JI6A 4LHSA 3MV11 5F7UA 2X05A 2J1TA 3P6BA 3C7GA 2VZUA 3IAPA 1CZSA 1NUKA 2W9XA 3JXSA 2LW8A 1KGYA 3I2IA 1YQ2A 3A7QA 5C71A 4QB1A 1UY2A 2QQOA 3GXUA 3T08A 4E8CA 3C7EA 2Y6JA 1RYYA 2YFZA 3T2QA 2VZRA 5HXMA 1DYOA 2J7MA 4DUXA 2ID4A 4UAPA 4KI5M 2DDUA 2W95A 4P5YA 3GM8A 1PMHX 4XZUG 4YPJA 4JKKA 2W47A 4DEQA 5EIYB 3U37A 4DEVA 2W92A 3FN9A 1JZ8A 3LEKA 2J1AA 2Y6KA 1OD3A 1W0NA 1HN1A 1GUIA 3ETPA 2VCCA 1PMJX 4LQRA 2J1RA 3HNYM 3VD9A 3UESA 3VD4A 4A45A 2Y6GA 5DMYA 2HYXA 2CDOA 2Y64A 2VQUA 2J1EA 3T0DA 1US3A 3OEAA 4ZY9A 2VCAA 3DECA 5LCWL 5EJ1B 4A6OA 1W9TA 2WN2A 5G05L 3MO4A 4W8JA 4QAWA 3HJRA 2W1UA 2VZTA 3NRUA 2ZEZA 2Y6LA 3PUHA 4MADA 2QQLA 4PF1A 4RN5A 4ZZ8A 2WABA 2WO1A 5HPOA 1BHGA 1O59A 3D3AA 4AG4A 4LKSA 3A23A 4QX0A 1XPWA 2E32A 4M4RA 4CUAA 1J84A 2EIEA 2BGOA 2W5FA 4PT6A 4QB2A 1I5PA 3WF1A 2VJXA 4QDQA 1GQPA 3I3BA 2VL4A 1WCQA 5IJRA 2B9VA 1PX4A 4CU7A 4OMDA 1UY0A 3CKHA 4BXSV 2VMCA 1UXXX 3OGSA 2WZEA 2DCJA 4PQQA 4BDVB 2ZXQA 5IFTA 3MUY1 1W9SA 3T0AA 2Z4FA 1UYYA 3OB8A 3IDAA 4TTGA 1UMIA 3T2OA 1UWWA 4W4ZA 3IIIA 4UOJA 4ET7A 1JZ5A 3K75B 3I2FA 4TXWA 3DYMA 1O8PA 3I2HA 4FI9A 4D8MA 3K4DA 3WEZA 4JX0A 3T0BA 4XVHA 3I3EA 2E31A 1SHWB 3CDZB 2VZVA 1JU4A 3CQOA 3LQCA 1JZ6A 1R64A 2YC4A 3J7HA 2JD9A 2JKXA 1ULOA 3ACHA 2WQ8A 1P8JA 2WN3A 2V72A 4QDRA 2QQJA 4ARYA 3WNPA 1K45A 5J1XA 2VC9A 3HEIA 3SKVA 1JYVA 3W5NA 4A4AA 3LPFA 4OZOA 4DXTA 2HLEA 3UNPA 1UX7A 2VR4A 2R7EB 3WNLA 3OGVA 4MGSA 2ZEYA 1NAEA 2X09A 5JXIA 5B4NA 2PQSA 4CVUA 2BERA 5JR2A 4L0PA 2V5DA 2WYSA 3T09A 3VD7A 3VDBA 4MGQA 4A41A 2YC2A 2RJ2A 3A22A 3EB7A 4LPLA 5IHRA 3VDAA 1JYNA 3PUIA 2WBKA 2JDAA 3A21A 2QQNA 2VTFA 2VMEA 3K4ZA 3I3DA 3I2GA 3GDBA 3WNKA 3K77A 5G04L 3AC0A 2RVAA 1H6XA 2X10A 2DCKA 4JKMA 3ACFA 2WO3A 1EUUA 2W91A 3VD5A 2ORXA 1F4AA 2WUHA 1L7QA 1EUTA 1JU3A 1TVGA 1ULPA 3THDA 3DYOA 4P08A 5CZKA 5JXJA 4BJ0A 4UI9L 3ACIA 3BN6A 2OKXA 4OUEA 4QB6A 4QX3A 4DUVA 3C7OA 1GNYA 2YB7A 2C9KA 3DYPA 1MPXA 4A42A 5JUVA 1UY1A 1JZ7A 1JYXA 4RYDA 4XURA 3ACGA 4CUBA 2VZOA 1UMHA 2YFUA 4QDSA 1GOGA 2VZPA 3HNMA 3NQHA 3HOBA 3SEPA 3MV01 1UY4A 3LEGA 4QX1A 3CZUA 3LPGA 3F2ZA 3HNBM 2W3JA 2JE8A 2EIDA 3NNGA 4QPWA 4GWJA
chains in the Genus database with same CATH superfamily
2SBAA 4PQ9A 3I2JA 5IFPA 4H2AA 4Q4X1 1BMV2 3JCIA 3AM2A 5H9SA 4Y1YA 1W2AX 2NYYA 1O5LA 1GSLA 5FZMA 2GMEA 3VBFC 2OZ6A 4FPJA 1TEIA 2R49A 5FZLA 4YVSC 1DQ1A 4BWOA 1IQDC 2JKBA 3ZFFA 3RZGA 4LBLA 4W50A 1GU3A 1RUJ1 4NPLA 2BV4A 2VMFA 3J7LA 2B4KA 1XNAA 1O8SA 2W1SA 1W06A 4FAHA 2PLV3 2YYOA 3HQXA 1YNAA 1AX0A 4IE5A 4CCCA 2NMOA 3VDDA 1N1VA 4CCDA 4JQRA 2CL2A 5FZIA 3GZEA 1OMIA 3CF6E 1N3QA 5LATA 1W8TA 2W68A 4XEZA 3U11A 1DLCA 4QKFA 3S57A 2JEMA 4OHYA 5A33A 2JG9A 2PMWB 1SDDB 5JI9A 3MEPA 2G1MA 4I3GA 2Y6HA 2NP0A 2W46A 2VBDA 5C6CA 4C0HA 1MQTC 4A44A 3H8OA 3NV3A 1MZ6A 3ZFFC 2WAOA 1S0EA 2D3PA 4ZONA 5F3CA 1DDLA 2ZZJA 1PX3A 3RWNA 3J7NA 2JDPA 1ZZ7A 4XABA 4ZU5A 3VKLA 3VKFC 1OUSA 1JZ2A 3ILRA 1LENA 1JYTA 4LK7A 4OYUA 1HJGA 2E53A 3MIDA 3KGZA 3VGIA 4CCKA 5J98B 2VM9A 3C8XA 3BTAA 5J3UA 2GMMA 4DXRA 1APNA 1IG0A 5HCFA 1FAYA 1MQTB 1S0JA 4WVVA 4MGIE 4YRDA 2FDKA 3RGBA 4NMIA 2G9GA 2VTXJ 4MSVA 1CIYA 4Q29A 1XRUA 1DIWA 2JDZA 2RS53 2Q8CA 2OPKA 4Q4V1 5FZ4A 4RL7A 1UYZA 4UF0A 5JCTA 3GHMA 5APAA 2EF6A 5JMOA 1O3TA 1JZ4A 1AYN2 4EQVA 1ASJ3 4QPGA 3GZTB 4NAMA 4N9IA 5FJKA 1ZBA1 4G4FA 3ABZA 3UGFA 5L36A 1RL3A 2VBPA 1DHKB 1W6OA 2CU5A 2XLAA 1V6LA 1LOEA 1CX1A 4U2AA 2BW8A 2ZHLA 4QX2A 4FOYA 3J9SA 2UU8A 1QOOA 2C26A 3HT1A 1PGW2 1WCKA 2J1VA 1XYOA 4FCAA 4XETA 3TBDA 2FDIA 5HXVA 2ZAHA 4AI8A 2VCMA 4YYOA 4ARXA 4GALA 5EJZB 1WLDA 3TWIA 2WR9A 5I93A 3JQXA 4CCOA 4XJ9A 3ZLIA 1X7NA 2NLRA 3HBZA 4LA2A 3S6PA 3WF4A 3RZKA 2ZX1A 4HVQA 5FZEA 3W58A 5FMCA 5T55A 3ZX7A 1BEV2 2W08A 1ZBE3 4AI3A 1IKQA 2RR13 2VG9A 3ASIA 4NRPA 1A3KA 4RD7A 4LBKA 3OBRA 4AQTA 3NAPB 3ZSKA 1RUH2 2CWSA 4P00B 2ZMKA 2VUDA 1O7FA 4NIIA 4P5HA 2P3YA 1KDMA 2ZEXA 1RGSA 4LUKA 3V0BA 1OF4A 2PLV1 1GZWA 4JDMA 4QX5A 2RJKA 5IK7A 3JBG2 5ERLA 1QH6A 2YU1A 3TNQA 2ZGSA 3OGRA 1DGRN 4GZ9A 4XJAA 4OI1A 5J36A 2XWJB 1W6NA 1A34A 1VBA2 4COUA 1JHJA 3ON7A 1WLWA 4J6GA 3NNLA 1WKYA 1ZA4A 1RMU2 3K48A 1HXS1 1D0GA 3N36A 1RUD2 2IXIA 3OEBA 2VZ3A 4L99A 5F3GA 4C1XA 1ZRCA 2EAKA 2GNMA 1BK1A 1D2SA 1NA1B 1S2EA 5LA2A 4E9KA 4D7SA 1WW4A 2A6VA 4YG3A 5LEKA 1CQ9A 1V6JA 4HKLA 2WDBA 5C70A 5EV7A 1K5MB 5LBBA 1J83A 1LOFC 4NIDA 2YDEA 3AXDA 4I3PA 2FCUA 2Q4SA 2LROA 3WF2A 2XBO1 4IL7A 1FYUA 3TEXA 1G9DA 1COV3 4F7ZA 1O3SA 2DVAA 1FNYA 3SEEA 2HWD2 3K51A 4S2HA 4MYEA 1HB2A 1XU1A 1DQ2A 4Y3OA 2CTVA 4XUOA 5FUNA 1XC6A 3Q8FA 5IVJA 2C6SA 3VBUB 3ZMOA 3TEWA 2D5HA 5FZ3A 1DQ4A 2FDGA 2UURA 1RUI1 2V73A 5C3OA 1UKGA 5JVVA 2DBIA 4AVBA 2BBVA 3JD73 4GB32 1WCUA 2YPDA 1UU4A 2I07B 4YGCA 3FWEA 5B4XA 4DB5A 4CU9A 1ND2B 4Q4V2 5FK7A 3V0AA 1W9YA 1UZZA 2ILMA 4CPBA 2ZGPA 3TNPB 2I45A 4RS5B 3CBNA 2RS52 2D6PA 4Q8LA 3KMHA 2TBVA 3AP9A 3HQUA 2JDHA 5T5LA 5ACA2 1PZ8A 5C8CB 1MS8A 1ALYA 3B5LB 5ANQA 1ASJ2 3S7EA 4BH9A 1ULEA 2IC1A 4NIGA 3P6BA 2D6KA 1RVF3 4C0BA 2ZGMA 1QJX1 3AMMA 1R1ZA 2AR6A 5LK5A 5AC92 1GP6A 1DZRA 5A6YA 1NUKA 5FXZA 3KWVA 2LW8A 4FOWA 3AVSA 5L9RA 3ZOIA 4CCMA 1KGYA 4Y5SA 4G3YC 5DUWA 4JDNA 1V6OA 1H1AA 1R1A3 1YQ2A 3IKWA 1UY2A 2DU0A 2R072 2WA4A 4SBVA 2YPJA 3SXWA 4CDQA 4AI2A 3VZNA 5FK8A 2G19A 1AR92 2VNGA 2Y6JA 3ES1A 1YIFA 2LALA 2W2IA 1LR5A 1B35A 1W8ZA 2D5FA 3H42B 3LAGA 4N53C 4XFIA 3WT3A 5KXDA 4QKDA 1NCQA 4IE6A 2GN3A 3LF7A 3T2QA 2HWB2 4JC1A 4L9BA 5IVCA 1ZZBA 4AW7A 4TN7A 4UAPA 3TN91 3WP4A 2JWPA 1ND2A 1CESA 1VBE1 2PTMA 1ODNA 2HH9A 1UMZA 2ZMLA 4QPYA 1IS3A 2VXRA 3CNAA 4MUVA 4P9XA 4M3CB 4YPJA 4JKKA 5BNNA 5FP7A 3WDTA 1D4M1 4N53B 3GJAA 3ZXFA 4GA9A 5I0RA 5A6XA 4KU8A 1DFQA 5LA9A 3V64A 3LEKA 3BTZA 4RFT0 2CGOA 4YNIA 1SLCA 2UWBA 1PNFA 1PO11 5FZCA 3T1MA 1ODMA 5A3UA 1MS3A 2D98A 5F37A 2H6CA 1QEXA 3S0MA 2CY6A 4FPGA 3SHRA 1HN1A 2ZHKA 3ETPA 1XJAA 1VE0A 4D7YA 4XQDA 1VLNA 1GR3A 2J1RA 3FFZA 2OYZA 2WFF2 1RHI3 2R073 3HNYM 3VD9A 4YW1A 3D6EA 1DYKA 5DMYA 2HYXA 1ZYBA 2RM21 3FHIB 5FZ7A 5FXVA 2Y64A 3C2UA 5LWBA 2VQUA 5JOYA 1V6NA 5F5IA 3T0DA 4IEZA 3KVBA 3OEAA 2CWMA 2R32A 1NCQB 1SMVA 4CYDA 1Q3EA 3VKMA 1UOBA 4COYA 1ST8A 5LY1A 3D0SA 3TN93 4PLOA 3ZN6B 3AMPA 4FBFA 2TEPA 4Y24A 2WN2A 1CAWA 1WGPA 5BV6A 4DIQA 2RR12 1ZX5A 3O0XA 4EV0A 4D94A 2VZTA 1UPSA 2RS31 4EE2A 5J37A 2WC2A 2WJSA 2ZEZA 3NNJA 1C1LA 1C57A 2YHJA 5FMDA 4MADA 4QWNA 1XOYA 3RI8A 2PAMA 4PF1A 1UPIA 4ZZ8A 1SLIA 3IPVB 2WABA 3VBHB 4CP9B 2D43A 3VBRB 4AG4A 2DUPA 4LKSA 5KXCA 4E4ZA 1GQHA 4M4RA 4LBJA 2EIEA 4XOGA 4P9IA 2DV9A 3USSA 3BTXA 2O0OA 3KV4A 3DL3A 3MW2A 2X5IA 2K2SA 4CXYA 4PBOA 5FYMA 1WCQA 4Q4Y3 2DVGA 1RVF1 4DMIA 1HX6A 2ZTNA 4A7KA 1V00A 1N47A 3CKHA 2VMCA 1HQLA 3OGSA 1QDCA 2DCJA 2RHPA 4E2GA 4PQQA 3EJKA 3AFKA 4LBMA 2FCTA 2GC3A 5IFTA 1QHDA 1CAUA 5KBFA 4XW3A 5C4WB 4FFIA 5C9AB 3T2OA 1OC1A 3IWZA 1R083 2RJLA 3Q8CA 4OHZA 3IIIA 3JD71 5E8AA 3WDYA 2R1DA 3ZR5A 4UOJA 1AXKA 3OTFA 1RUC2 4F3JA 4B4PA 1JZ5A 4H7LA 4TXWA 1YWKA 3VBFA 3TYJA 5A3NA 4XIOA 3MLKA 5LEJA 3THPA 5A3TA 4Q1PA 1ULDA 2JG9B 1O4ZA 1VBD1 1COV1 1H1MA 2F4PA 4OUMA 4PBPA 4AVCA 2XBO3 4XCAA 3WEZA 4UFJA 1QJY2 5DAQA 2WNVA 5K7PA 1W04A 2BNOA 1GANA 1MVEA 1W6QA 3CQOA 5FLHA 5AFEA 3LQCA 1JZ6A 2X5IB 2H0BA 3M3EA 4X6RB 4A2UA 2YC4A 5FY0A 3J7HA 1RHI1 3VBSB 1VRH2 2CSGA 5C3QA 1YQCA 2Q1FA 3VDDC 2WQ8A 5D8AC 3DCQA 1FOD2 2P6CA 5FYBA 5C3RA 1W28A 1LU2A 2DYCA 3W21A 3WNPA 4IV3A 1K45A 1W90A 4LTAA 2Z5WA 4ES9A 2VC9A 1JYVA 3W5NA 5IT6A 4FOVA 4LJHA 1O3RA 5KHIA 1QH7A 2VY0A 4N43C 1PVC3 3OYWB 3J8F1 3UKTA 4ASKA 5ISLA 1YHFA 5B2GB 4OUSA 3UNPA 1IPJA 2VR4A 1SLTA 2R7EB 1W6OB 1X9PA 3WQ7A 2A6ZA 4LOSA 3U4XA 1FT9A 2A75A 1HQNA 1F2NA 3L2YA 2ARBA 1RIRA 3BYWA 2XJQA 2DTWA 4OHVA 3BPZA 1X50A 1NAEA 4ASLA 3S7IA 3H7JA 1NCRC 2BFUL 4JGZC 4LR4A 5CKQA 4CDWA 5T5JA 2EIGA 2P4EA 1FPN1 3FUQA 4UFLA 3THTA 3OY8B 4CVUA 1AJOA 1C8M1 2BERA 4RGAA 2XMLA 5L19A 2V5DA 3N7MA 2CGNA 5LBCA 3T09A 5J48A 3VDBA 4A41A 4IEOA 5DAPA 2YC2A 2JG8A 5FP9A 5FP4A 3RJRA 3A22A 5FLJA 3EB7A 1GWKA 3VDAA 2HWF1 4CZSA 4E2SA 4JGYA 2G4IA 1ND2C 2A3YA 2PHTA 1JH5A 2QQUA 1JUHA 2JDAA 3A21A 1V6MA 1O4YA 1AX1A 1SZBA 4M00A 5EQUA 3I3DA 2NQYA 3GDBA 1BLZA 2FCVA 5G04L 4Q1RA 1U12A 3AC0A 5JIUA 5FPLA 1H6XA 2DCKA 3AKRA 3M8LA 2AYHA 2K9ZA 3WZ1A 5FZKA 2Q8DA 3VHNA 1OQDA 4AVAA 4LT5A 3GCXA 1WA6X 4CDXC 5FR3A 1RXGA 1KS4A 4YG0A 3EQEA 5F6LB 2C9AA 2WUHA 1UKRA 1JU3A 1UIKA 3LWCA 5FPXA 2A1XA 4NRQA 4KBZA 5LB6A 3DYOA 3THDA 4WM7B 3AP4A 4NO4A 4BJ0A 2E63A 4DOUA 1KD7A 2BWAA 1H1IA 3BN6A 4FP3A 2OKXA 2B5HA 5BPXA 1SBEA 4QX3A 2YU2A 1GNYA 5FYVA 3HQRA 3TN92 1RUF1 1UY1A 1RUI2 1VP6A 3GCWA 4JGYC 5F6KA 4CEWA 4RYDA 1JZ7A 4K3UA 2IXJA 2ZABA 1GBGA 2VQAA 3RZJA 1UMHA 4S2FA 5JOZA 1GOGA 3L2HA 3SEPA 1UY4A 1M4WA 1ULFA 3LEGA 1ACCA 5CA6A 4FPFA 3VBRA 5T5OA 3MLLA 5DZGA 3U75A 3DF0A 3F2ZA 4FPCA 2LRPA 3RYKA 3W9AA 2EIDA 3LFMA 3ZXEA 1ONAA 4BQYA 3I3MA 2IWGB 4DPNA 5I0TA 1J1TA 4J1XA 1PZ7A 2ZKNA 4R52A 1UIJA 3ORJA 4DFSA 1QNYA 5IAXA 1RUJ3 2TNFA 2YXSA 3FL7A 2QDNA 1W8NA 5SV8A 3E1F1 5CFCA 3BTYA 1HB1A 3NWKA 4RS5A 2VMDA 1D7PM 1SCSA 4K9SA 4XJWA 1XNKA 1VBA1 2DU1A 1ZBA3 3WDVA 1DLLA 3ITQA 2QQMA 4BMBA 1D2QA 4CP0A 5E89A 4AFBA 2FZ2A 4CU6A 1W99A 1UD1A 4XIKA 4MGYE 1TG7A 4K1YA 4Q2FA 2EXKA 3DPRC 2B45X 1QJU2 1CJDA 1WWYA 2XG3A 2ORZA 3M3QA 4BK5A 1F15A 2RS51 3EBRA 1WD3A 2XHNA 4GWIA 3POEA 1DF0A 2XJVA 2UYBA 1HJFA 1GWMA 2XJSA 4BIFA 1B35C 3B02A 4Y4RA 1AUYA 1W8OA 1BEV3 3E6CC 2RS32 1NKGA 4PIZA 1GWLA 3GNEA 2Y8KA 3PHMA 4QGNA 2MEV2 4JKLA 4BQXA 1AF9A 4LKEA 4P9WA 5FUIA 1CD3G 2P37A 2YGMA 2WSVA 3SKJE 4IEVA 1HV0A 5FPZA 1LKNA 4N7IA 4PHZA 1BYHA 3VZOA 4YWAA 1A8DA 5BYNA 4D7TA 2WLQA 1G6NA 1PK6B 2AUYA 2Q1MA 2ZAAA 2Q8EA 4CTEA 5EYYA 2C1FA 4ZXEA 1LOGA 1OQ1A 3ROUA 4CUGA 4I02A 3MIGA 1JODA 1K5JA 1Q8PA 1X8MA 1F5FA 1MEC1 2BGPA 3LOIA 3FBYA 5DZEA 1PO21 1BVP1 5L9BA 3ZSEA 2QQKA 2A6XA 2VZ1A 4IQPA 4LE4A 5H9PA 3PMEA 4RR3C 3SCHA 3ZXLA 1CZTA 1ASJ1 2R0HA 4N53A 4A3ZA 3MUZ1 4B4RA 3WV6A 5GLUA 5JXGA 2HJIA 4M0NA 1OKOA 4GH4A 4B7KA 2HWF2 3ZYGA 1QDOA 1VB2A 4YG6A 1MR5A 2ZX2A 4KMQA 2OUJA 4LKDA 2D3RA 4IXLA 3AXEA 4XFBA 5CYYA 1LHUA 3O1RA 2CV6A 1PVC2 2FBEA 2W94A 5GALA 2JDYA 2WNOA 2DBNA 1PIV2 4GJZA 4HFSA 3GGLA 2J42A 3B3QE 4XILA 3SH3A 3GJBA 1SEFA 4MX3A 4E4HA 1EY2A 2Y0OA 4MGKE 4EZ4A 1UF2C 2WQ4A 3WNNA 1YYNA 4AR2A 4IEXA 2NN8A 4L11A 2RV9A 2GNDA 4XDPA 2CHHA 2J1UA 1S1AA 4Y1VA 2B46X 1PIV3 3UETA 2Y38A 2E33A 3CIHA 3T4HB 3CMGA 2IFWA 1BXHA 1C8M2 3IB3A 4PDWA 4BK4A 2Q0AA 3M3IA 2JECA 3IAQA 3LGRA 4HG6B 1CAXB 1L7RA 3QBQA 5EWSA 4RGGA 1XNDA 3SH4A 4URAA 3N4MA 3U07A 1RJ8A 3MF6A 3R05A 1BBT3 3O0VA 1NLQA 3W5MA 3UK9A 5CBLA 4AAXA 4BCUA 1Y3TA 2GNBA 5K0UA 1XNTA 5DPNA 1QXRA 1WMFA 4BQ4A 4EWEA 5L7OB 1UZVA 4CU8A 3NVCA 4QQOA 3P1IA 2DURA 1H8TB 2JB4A 2VULA 2FDJA 3KT4A 3WUCA 4V2WA 4FFGA 4QXBA 4B29A 4XFHA 2R043 1BJQA 2ZGQA 4FPOB 4WM7C 2ADDA 5FPAA 4DNYA 4I0WB 4HMZA 2V4VA 2LS6A 1HRV3 1WMEA 2CAUA 1XSQA 4HLTA 1AYN1 5KC6A 5JZGA 3PIJA 1W05A 1OFSA 4N8MA 3RSJA 5L7OC 2L9LA 1OSGA 3AMQA 3UT0A 4HSJA 4TWTA 5F2WA 1EP0A 1H8TC 2EXHA 1UZ0A 2QQPA 3PLQA 4CEWB 1AR91 1XE0A 4IE0A 1WBLA 4YVSA 3HR9A 3M3CA 3G6JB 5CKMA 4BU2A 4AQ2A 4P14A 2ZX4A 4UW6A 2J1SA 5CU1A 1ZM1A 1GKBA 4GMP1 1JYWA 3I97A 1MS4A 2C5DA 3O1PA 4JV4A 4WVMB 2ZS6B 2YG0A 4PIYA 5IYYA 3LA3A 1SPPA 5DAWA 4HONA 5FZGA 4ZZ5A 4AEDA 1QJX2 4BYYA 4A3XA 1RUOA 4LITA 4PLNA 4KWUA 3WDUA 3KCYA 1IS6A 5DDJ2 1GP4A 2GAUA 3J7MA 3QCWA 1ZNPA 1NCQC 2ARAA 3ZPYA 5BNOB 3ZIXA 1NCRA 4JGZA 4XMIA 3WF3A 1W9WA 2GU9A 4IEYA 1LHWA 3O1SA 4FTEA 4XMAA 4JQTA 1H6YA 2XUEA 1XYNA 2X29A 4UFIA 4I0AA 3SC7X 1XE8A 4XPVA 1BQPA 4IV1C 5EHDA 2QUOA 3MV11 1GV9A 3TRSB 3C7GA 1J1LA 1KFXL 2E9QA 1JXNA 2VGDA 3N9PA 4Q4X2 2XHKA 1BMV1 4QHZA 5FPVA 1CZSA 2VMGA 3U10A 1Q5OA 5GZGA 4ASMB 2HWC1 5A3PA 5KXEA 4EWAA 4XJUA 5FY9A 4KBBA 4YGEA 1VRBA 2BJSA 1LHOA 5BNQA 4OI2A 1GQGA 3ME2A 4XFFA 3RFRA 2VVFA 3UJOA 3B9CA 3ZFGC 4K7JA 1ND3B 1QQP3 2KXLA 1UOGA 4JGYB 3T08A 1AL23 3C7EA 3WCSA 1VMHA 2X8KA 5D2AA 2YFZA 5FZ1A 4INDA 4AAPA 4ATFA 2DCZA 1O6UA 2KR2A 4NAOA 2ID4A 1NLRA 4QQHA 2WFF1 3IMNA 4DUXA 1GLHA 3B93A 1ZBE2 1S2KA 4GKXA 5FWEA 3WG3A 4NUBA 3GM8A 3Q8BA 1C5HA 2OQ7A 1PMHX 1W39A 1O3QA 1OH3A 3DV8A 2MEV1 2W47A 3CJIC 2C0ZA 4DS0A 1DQ5A 5F32A 5IVEA 1RINA 4PDWC 3CEWA 4GH4B 4FAGA 3F95A 4UWDA 5DAXA 1ENXA 3PIGA 2Y6KA 2XR4A 1J3RA 5FAXA 5F5AA 1CN1A 5T50A 4AI1A 2R1BA 5JR7B 4UW4A 4FTBA 2WA3A 4YVWB 1YJLA 1AYM1 4Q0VA 5C7GA 3TEZA 2Z69A 3QLQA 5IW0A 3NSTA 3UESA 3KZ4C 4MGZE 2A3XA 3N35A 4A45A 4C8DA 1TNFA 4AYUA 4HL0A 1X8EA 1IPSA 4F83A 1OLME 1GZCA 2XWBB 3OF1A 4HVRA 3VHOA 4CDUC 2VMHA 3MIHA 2J1EA 4KG8A 2P3JA 5CEHA 1B35B 4RGKA 3H1YA 1Q56A 5JMCA 2XGXA 3LZZA 4HKWA 1O5UA 1UZYA 2VXJA 3I3QA 1YFWA 2A73B 2VCAA 3KQRA 1ZRFA 4E27A 3LEMA 3J26N 1N1SA 5IATA 1OUXA 1VBB3 2JD4A 3KCCA 2WYFA 1D4VB 4K8RB 4XFAA 3U78A 4AHWA 1COV2 1X33A 4FPKA 3MO4A 4QAWA 2AGSA 5HV4A 1KJRA 2IVIB 2XJTA 4N43B 3LSDA 1ENRA 4XTMA 2UY9A 3B69A 5KC5A 4E2QA 4QX7A 5A6QA 1QOSA 1W6MB 2VOVA 1YUDA 5DDJ3 1S0IA 1URXA 3NV4A 3PTYA 5HPOA 2EXIA 3MICA 3D3AA 3HMYA 4LBQA 1OA4A 1OKQA 4QX0A 4LO4B 1XPWA 2E32A 2W52A 3K3OA 4CUAA 1J84A 3POIA 4NWVA 2BGOA 4ZHNA 3UGGA 2BP6A 3FLPA 4QB2A 1QWRA 1X9TA 5BNNC 3PTRB 2VJXA 4IW3A 3PUAA 5L73A 4FFFA 2PA7A 4PCRA 1CGPA 5FY5A 2B9VA 4CCEA 5BXXA 4OMDA 4QD2A 5LY2A 5HBAA 1HIXA 1UXXX 4LHKA 1W9FA 3BCWA 3RYPA 4AVVA 3OCPA 3SCFA 3WP3A 3GZAA 5CFCB 2BGCA 4BDVB 4LIUA 2BYVE 5E88A 4YZ1A 1C4RA 5HV0A 1UOJA 1UYYA 3DN7A 1LEMA 1ZZ8A 1U5XA 3IDAA 4TTGA 2VW0A 3D8CA 4Q5OA 3ILFA 5F1RA 1UWWA 5FIXA 1MZFA 2ARXA 3LIGA 4HZFA 4UW5A 4W4ZA 4B1LA 2VNRA 3I7DA 4YW7A 3WOGA 4Y20A 4AE2A 4XTPA 3KT1A 3K75B 3I2FA 4R9DA 4C1WA 2EALA 3DYMA 3JZVA 4Y26A 1O8PA 1LOBA 3MGUA 2GH8A 1OHFA 3I2HA 4B1MA 4MZUA 5T5PA 3BOPA 1YJKA 2JDMA 2WL1A 2R0FA 1OXCA 5FREA 3IPVA 3VBHA 5FP8A 5J09A 1QU0A 2HWB3 3R4UA 1M06G 1A8MA 1VPHA 2VQ0A 2W0XA 4CE8A 1SHWB 2VZVA 5JLVA 3ZO0B 4LULA 1MS5A 3EXUA 5LBFA 3KCXA 3PVBB 5FZ0A 1PGL1 3RYRA 3BU7A 1ZBA2 4ISQA 3IN9A 1FMD3 1TME1 1ULOA 4AHXA 1WW7A 4KWLA 4YW6A 1O91A 4QDRA 2QQJA 3HD8B 4EROA 5CB7A 1YFUA 3J4UH 1QJZA 5JWPA 3NJYA 4QM8A 1KFUL 4JVAA 4AXOA 4B3NA 1PNGA 1R1A1 2D6OX 2YROA 5FXWA 4EN6B 2AC1A 3OUIA 5T52A 5J1XA 1E5IA 2R042 3X29B 2B7YA 1WUVA 4NE9A 5CG9A 5K0UC 3NL1A 3RMYA 4A4AA 1CAVB 3M2MA 3LPFA 3SCGA 2QVSB 3CU7A 4QKBA 3V56A 1ND3C 4BE3A 3UJQA 1JHNA 1LECA 1UX7A 1H9PA 3VBHC 2Y33A 1UX6A 4GULA 1RUF2 3D0JA 3POBA 4AHYA 4DQAA 3NAPA 4A6SA 3OGVA 4CDUA 2WS91 5GZDA 1RUH1 2ZGNA 1VRH1 2ZEYA 2AEYA 4HOOA 2PHDA 1H2NA 2QQWA 5K0UB 3H8UA 1QJU3 2BU9A 1J59A 3ZSMA 4TYSA 5L7OA 2QFEA 5B4NA 1S55A 2D6MA 3DGTA 2F4LA 4CRQA 3U0ZA 4DO0A 5A3LA 5A7QA 1RUG1 4L0PA 1JUIA 2XLFA 5DG1A 2WYSA 4ZU4A 3ALQA 3VBUC 3RZHA 3H8RA 3VD7A 4MGQA 2V09A 1F31A 2UYAA 2RJ2A 4QPIC 4LPLA 2OPWA 4QU2A 3VZMA 1VBC3 4LBNA 1JYNA 3OUJA 5J96B 2NPIA 1FNZA 3MIEA 2R041 1JOJA 1RXFA 2WBKA 2O8QA 1AR61 3OGJA 4Q4W1 2QQNA 3GALA 1NQDA 1SDWA 1WMDA 4WZCA 5AC93 4JTNA 1AR71 4UT5A 4QMAA 4YVWC 1FXZA 3SLIA 3N7KA 5F3IA 3BKZA 3MF9A 2WNVC 5FLIA 1UOFA 3JB8A 1K5MA 4JKMA 4OZXA 3QH7A 3S5QA 2WO3A 2W91A 2ZMNA 5T54A 1WA4A 4X8NA 3OYWA 2WZR3 3NV1A 3WP5A 3Q9OA 2ZPXA 3QD6A 4HBNA 3LFIA 1JS9A 1PK6C 3O12A 4ONUA 3V0BB 2B42B 2FMDA 2CYFA 3H3LA 4ZXKA 2WZPP 3R0RA 4EZHA 1R091 4P08A 4QGLA 4EWDA 4WVMA 2DFCA 5FZHA 2W39A 3WQ0A 4IGPA 1H30A 1SPPB 3WQ1A 2MNGA 3ACIA 2IZWA 2FDHA 4LEJA 5FYYA 1HLCA 2P1BA 4AEDB 5K4LA 1QJY1 2YB7A 3I2OA 3CJXA 3IMMA 1MPXA 5A80A 3T1LA 3OY8A 3Q8EA 4CCLA 4XURA 1JBCA 3ETQA 4XDOA 1UQXA 1MS9A 3BI3A 5JSRA 1LU1A 2VZOA 5FYTA 4QDSA 2BTVC 3HNMA 3NQHA 2A6YA 3CL1A 1V6IA 4O9GA 3I8TA 5FKCA 3WR0A 5JPNB 4LBQB 4QX1A 4H55A 4RHV2 4WVWA 5F9TA 1W8HA 4QQPA 5C8CA 3CZUA 3SISA 4NHXA 2OUHA 5HCHA 3LPGA 4NIHA 3HNBM 2W3JA 3AP6A 4HK8A 3WG2A 2JE8A 3OBTA 4FPHA 4OVEA 1OPOA 4LUMA 5FZDA 4QHOA 2RMU2 3AKTA 4RR3A 4CCNA 4A7YA 1IKPA 4LMFA 2BZDA 5FZAA 3IDCB 3RI9A 2EXJA 1CAUB 1MZEA 1RHI2 1US2A 2GDFA 1UW8A 2VOXA 5FY8A 1E5SA 3NJXA 3UV9A 3WSOA 4BXFA 5IWFA 1T6BX 3H3ZA 4JHZA 5IK8A 3K2OA 1Z7S1 2R063 4O7XA 2ZZQA 4W6XA 1TE1B 3WF0A 3ZKYA 2VOTA 5FYIA 2PLV2 4AFMA 2XUMA 2B9UA 4D0QA 4YZ4A 1DGRA 3OD0A 3S5AA 1WLCA 2W1QA 1F4HA 2W87A 4XYXA 4FTSA 4XQ4A 1TME2 4DY3A 4GWNA 3FZ3A 1EPWA 1W03A 2QQVA 1KEXA 1UY3A 1HKDA 2D6NA 1I6XA 1STMA 3RNSA 4XACA 3WG1A 3H9AA 2VE1A 1LOCA 2YBSA 3ELNA 2VVEA 3SITA 4QPGC 1VJ2A 5A3WA 5F39A 4Z07A 2XPJA 1X36A 1AHSA 3FBMA 4BB3A 3VBSA 2ATFA 4YZ2A 3EO6A 3ZIWA 5JSOA 2E7AA 1NX9A 5C5UA 1RITA 4CUCA 3IBMA 2D93A 4MOAA 4ES8A 5FOJB 1QOTA 4FPLA 1FV3A 3NKGA 2ZX0A 4CDQB 3KF3A 3O7OA 2R30A 4L8QA 3I2KA 5CG8A 4K21A 4ZU7A 2ZJCA 2YBPA 1EAH1 5A7WB 2EIBA 4Q26A 4QT6A 1Z7S3 2R061 1SLLA 2BVVA 2EVXA 2IXCA 3DXTA 4XF3A 4P9YA 2QDRA 4JRLA 5FBJA 4EJRA 3H7YA 4QGMA 4W6WA 2VPVA 4XUQA 4V2VA 2E51A 3H50A 1AYM2 1CR7A 1U5IA 1RUJ2 3UKVA 3SNMA 1Y9QA 2E7TA 3MW3A 2VU9A 2XQXA 2WNEA 3AMHA 3T3YA 1MS0A 1RTVA 2WZR2 2H6BA 4PI0A 1YIPA 3WHUA 5KXBA 3ZYHA 1HDKA 3C7FA 4OI0A 4R8HA 3FHQA 3WNMA 5E6HA 4DRRA 1EYBA 1UYPA 5FYSA 1JZ3A 2BWCA 3HPNA 1SBDA 3INAA 3I4IA 3LSEA 1T2XA 1AL22 2VMIA 4HN1A 1S0CA 1I9RA 3BVCA 1DP0A 4IGOA 4FXGB 4QHBA 4IESA 3B9IA 3NV2A 5C4WC 4DY5A 3AZWA 2VVDA 5C9AC 4GAZA 2N7GA 3KD4A 5DQ0A 3LE0A 2WQZC 4LA3A 1U5ZA 2WAAA 4Q4X3 4ATEA 2CAVA 3ZM8A 1QJY3 4CP9A 3WXPA 5FZOB 1GZ9A 2WWJA 3GYDA 3MLJA 2P6HA 3DUIA 3PVOA 3VHPA 2CNAA 1Q43A 3GBFA 1K12A 3KS7A 1JYIA 3ZXDA 1RUC1 3ECQA 2ET1A 3THCA 5GZCA 1VRH3 1RUH3 4M4PA 5GKAC 5A7WA 3ZN4A 1HW5A 2A7AA 1POV1 5I91A 4IV1A 2VO5A 2C4XA 2JENA 3AK0A 1KRIA 3WW2A 4AVSA 3K46A 4K8FA 4QXKA 2QKDA 1CPNA 2C24A 3CO2A 3WHTA 4XUTA 2JB8A 4Y1UA 4AFAA 5FQ0A 2HWD1 1REFA 1CVNA 1UU6A 2LTNA 3ZFGB 5A32A 1NA1C 3D4KA 4ZS3A 1CAWB 2ZEWA 3RQ0A 2DF7A 5EFUA 1POQA 2W1WA 1GOFA 1NZCA 2XVGA 4EYUA 4XZPA 4LO7A 1V9U1 3LA7A 2OW4A 3OUHA 5FTTC 2VW2A 4Q0PA 5CKNA 3MFCA 1RC6A 2XQRA 4KU7A 5A7NA 1QF3A 2IUWA 1AXYA 1YC61 2HWE1 3ZDSA 3AMNA 3N9NA 3VUOA 3ZYBA 4Z8BA 4GD4A 1S4CA 4YW4A 2HEVF 1FOD1 4ZKTB 1FMD1 1TME3 2GNTA 2RG4A 4MVTA 4AEDC 3HN3A 4IEUA 4ORFA 5BNPA 1ENQA 1DGWA 1NZIA 5I0DA 4IERA 2P3IA 2WO2A 5LA1A 2KD7A 4AEKA 5ABJC 1CPMA 3ST7A 4BQ2A 2XL7A 3LCPA 4OCTA 1DQ6A 1N3PA 1Z78A 2XLGA 1W2OA 3B94A 1BCXA 1UXZA 4J25A 1TMF3 1AJKA 1VR3A 5A1FA 5TSWA 5C9AA 1H2LA 2BVBA 3CHXA 4FQ4A 4W65A 4LXLA 1HRI1 3AKQA 1NY71 4FPEA 4X6QB 3ATGA 3RS6A 1L7LA 2PHUA 2GC0A 1RUNA 1OI6A 2RMU3 3LEIA 1OLQA 3VBFB 3WW3A 4D69A 1EPZA 1F5JA 3GBWA 4XXAA 1LHVA 1I1EA 1V6KA 4HPKA 2DWRA 4GJYA 1EV12 1RMU1 2A71A 5F3EA 2Y26A 3FMGA 4XAAA 2XOMA 1JI6A 1NXD1 3VN4A 2A6WA 4OULA 5F7UA 1OBNA 3P3PA 5IVVA 3H8XA 2X05A 1LGNA 3WDWA 2XVLA 4KWKA 1LGCA 4OHWA 5M0TA 3G7DA 1KITA 4CDXB 3KV5A 3E5XA 1NXMA 3EMRA 1FV2A 3AYEA 3NNMA 4XJ8A 5FKBA 4FOQA 3I2IA 5E16A 2P34A 2WWUA 2VW1A 3PVNA 2A3WA 1XNBA 3R4SA 3H3UA 5GJ6A 5DDJ1 1HN0A 5C8CC 4Z1VA 2YY1A 4IV3B 4UFMA 1DU3D 3ZFFB 1OOPA 2QQOA 1IS5A 3W20A 4E8CA 5HI0A 2RDNA 3ZVXA 2VH9A 5JZGC 3WD5A 1R081 5F8PA 5JI7A 4SLIA 3TB0A 2FDFA 5AVAA 5F2SA 1DYOA 2J7MA 3MW4A 1G8WA 5A7PA 3AYCA 2GC2A 4QQLA 2DDUA 5GLZA 5A3MA 1JOBA 2PAKA 4CPBD 1VAMA 4RHV3 5HCAA 1NCRB 4JGZB 1QKQA 2O8OA 4Z82A 3VLBB 5FY1A 4Y1XA 4BHPA 4JCKA 4XZUG 4AI9A 2O1QA 2RS11 2PHXA 1YQ6A 4NRMA 4HVOA 2CGPA 5EIYB 3LD8A 4N7UA 2XJUA 1TQ5A 2SLIA 4PF5A 3PMSA 3VKNA 3K3NA 1JZ8A 2LUWA 4R9BA 1PZ9A 4QKNA 2J1AA 5CVRA 1OD3A 1W0NA 1GNZA 3POFA 3WDXA 2MHFA 3KV9A 1LEDA 5D1IA 4BQ5A 1GUIA 3GBGA 1OVPA 1N1TA 2R062 2VD7A 1PMJX 2VCCA 2Y34A 3PU8A 1J3PA 5FCCA 4FSJA 1XYPA 5FJHA 4CXXA 4LK6A 2GSYA 1DBNA 2RS33 3I59A 4GMP0 5IAVA 2Y6GA 4KH9A 2WSUA 4NHKA 2ZHMA 1R082 3IZOA 3QH6A 3GF6A 2RDSA 3MPBA 4YW3A 4Q27A 2BOIA 3A0NA 3ACLA 4NHMA 2HWB1 2XB6C 4ZY9A 1H2KA 3DECA 1QY4A 1J58A 2I74A 5GM0A 5IK4A 1BKZA 5EJ1B 1IPKA 2RS12 3LIHA 2KA3A 2WIIB 3ZN5A 5JSPA 1C8NA 4NR1A 3RPQA 1AL0G 4CCJA 1CWPA 1ZZCA 5G05L 1LAJA 4D3WA 4IV1B 3HJRA 3D82A 2W1UA 5K8SA 2ZHNA 1H8TA 3NRUA 4CSWA 4Z2WA 2IVJA 2PHRA 3EHKA 3HT2A 3PUHA 1LOFA 5FFOC 3AKSA 3A4UA 1W6PA 2BNNA 4WM8B 5FXXA 5DZFA 2NZ9A 4AGGA 2AREA 1O59A 1V70A 4CEYB 5C5TA 2ZGUA 3AP5A 2P3KA 1NLSA 4KL1A 3ZXJA 3WY6A 1WD4A 1SBFA 3HBKA 2PAEA 1LRHA 3JB4C 3WF1A 1CONA 4WVZA 4RR3B 4QDQA 2F17A 3I3BA 4O65A 1YFXA 1UN1A 5IJRA 1UAIA 4NHYA 1JOPA 3AJZA 1PX4A 1YXWA 2AZ5A 1S0FA 4QXCA 1UY0A 4BXSV 4EN8B 4FXKB 4CEYC 5C33A 2ET7A 4HSLA 5EJ3A 4N9HA 4I01A 1Q8VA 1F35A 3ZYIB 1W9SA 3T0AA 3MZHA 2PELA 1OD5A 5FYZA 2AEZA 2LM3A 1UMIA 4OFGA 3POSA 4JDOA 3SQOA 2WNUB 2JIJA 4N90A 1XNCA 1HRI3 4BLIA 1HB3A 2ZA9A 4ET7A 4Y33A 4CDWC 3SH5A 2ZCWA 2X5IC 4GWMA 4HETA 4W6YA 5I0UA 4CXWA 2KM2A 3AFGA 5JPMB 5AVPA 5FY7A 1UL9A 1E5HA 4AK3A 3GZUC 4LO5B 5F5CA 1FATA 3VDDB 1W6PB 4D8MA 4RHV1 3N9LA 5GLTA 2JE7A 3VBOA 5IVFA 3K4DA 3MIBA 1HRI2 3LDKA 5IK5A 1HB4A 3N9OA 3T0BA 3KF5A 3T2TA 3I3EA 2A70A 2XBO2 3MYXA 3RDIA 5CADA 5T3NA 4AVTA 3HWJA 2YMZA 1IOAA 4XDQA 4NPMA 1XQNA 2JKXA 1AYN3 1C28A 1FOD3 3ACHA 4MXWA 1P8JA 2JG9C 2V72A 3KT7A 1HRV1 1Z7S2 4ARYA 4EN7B 4GXLA 1Y4WA 5FZ6A 4XF1A 1BK0A 4AQSA 4FQZA 4BPZA 4L2NA 1H2MA 5FZOA 1SFNA 5A1LA 2WFPA 3NMBA 2P5BA 3KV6A 1E5RA 3APBA 3RMXA 2RDQA 4KGGA 4OZOA 4DXTA 1Y9GA 4Z92B 2YC0A 1GFF2 1OOPB 2HLEA 3M4FA 1WMXA 4IETA 5FMOS 5FO8B 2ZGOA 5HCBA 1PO12 2WO7A 2OT7A 3USUA 1IHMA 1RMU3 2DVFA 1ZZ6A 2AENA 4COVA 1C3HA 2BPA2 4YZ3A 1LJ7A 3TAYA 4M3CE 5FMBA 3QACA 1RUC3 1AXZA 3UYJA 5BNNB 2X09A 4GIQA 5EP9A 1ULGA 2WT0A 3AJYA 1C1FA 3OGGA 2PQSA 4LNVA 4YM1A 2YGLA 1AL21 3KHCA 3HAGA 5CIRA 3ZR6A 2GP3A 5FUPA 3B01A 3DKWA 3POYA 1RB8G 4R4ZA 5GZFA 4UFHA 5IHRA 4NROA 3PUIA 2UWAA 1PGW1 4YM3A 3UL2A 1LHNA 3E5QA 4HKOA 4QX8A 2HKXA 4XF0A 4YW5A 4YFWA 3JUUA 2B39A 1ENSA 5H9RA 3K77A 3AB0A 1MZ5A 4P9LA 4AI0A 2RVAA 5A32B 1VAKA 4YSFA 2D7FA 1EUUA 3VD5A 3VKOA 1BBT1 1SLAA 1TZOA 3WVJA 1G9BA 4AHZA 1IGOA 2PYTA 2ZACA 3H1MA 4JAAA 1XSRA 3ZKUA 3MPPG 1EUTA 4KWJA 1TVGA 5LRRA 4NHLA 1ZBE1 3O1OA 2Q5TA 3ZYRA 1XBFA 5JXJA 2RMU1 3BOWA 3I2DA 3AP7A 4L92A 1L3JA 5FYHA 4D6SA 4YARA 4O9EA 4HK9A 4UI9L 1V9U3 1Z0HA 1RVF2 4OUEA 4QB6A 2UWCA 1OLRA 3ZYJB 1W6MA 1OVSA 5A7SA 3DYPA 1WCSA 1AR72 4A42A 2O14A 1ZVFA 3BPSA 3UKNA 3WUDA 5JOWA 5JUVA 2HWD3 1JYXA 1TMF1 1LODA 3O0WA 3ACGA 4XHBA 2Y6FA 4CUBA 2F6BA 3ZSLA 1S2BA 4CEYA 1F8VA 1WBFA 5A7OA 3RWKX 5JDBA 1BEV1 4KGQA 1SFYA 3JD72 4GB33 1AR93 3VZKA 2QZ2A 4QU1A 1XB9A 4L97A 3NNGA 5FMOL 3BIWE 2VNOA 4AQ6A 2PXJA 3O1TA 2VECA 1A6CA 2WT2A 4CDXA 4Y22A 2D44A 4GWJA 1LCLA 2QTWB 5FOBB 3FJSA 1G7YA 2XL9A 5A70A 5C3PA 2WZ8A 1NE4A 4JZRA 2OIIA 4QXHA 1W2TA 2OX0A 1XXNA 2VCBA 3URFA 1PO23 2VUJA 1VBA3 4AEMA 2HWE3 2QE3A 1G9FA 3POGA 4NN0A 4Z2AA 1SQ4A 1WZXA 2IXKA 2VQTA 3AKPA 1VMFA 1Y7BA 1UNBA 3B00A 3IT8A 4HPKB 4NOTA 1MACA 1DQ0A 1MQTA 4XBLA 2PQQA 5IVBA 2J22A 5DN2A 1EV13 1R1A2 3BGAA 2OS2A 4OMCA 3KB5A 3ZXGA 4Y4YA 3V0AB 4CP1A 2HEWF 3CJIA 3WINE 5CFDB 1GZTA 4KG0A 2QBXA 2UY8A 1VBB2 1PO22 2WNUA 5JOXA 3NKTA 1SLBA 4S2GA 4MLOA 1WCDJ 3ZYPA 3CZJA 4J1WA 2IXLA 4XFCA 1FPN2 4CDUB 2HBUA 3VZLA 1POV3 5BUVA 1QJFA 1Q8OA 5FO7B 5LBEA 4EN9B 1W0OA 4EN0A 1BVVA 4H3WA 1ZRDA 1H9WA 4XBQA 4U36A 3E6DA 5CFDC 2PHWA 3VD3A 3WP6A 4E8DA 1W2NA 2QCSB 1PIV1 3KQ4B 3MBWA 1GMMA 3FHAA 1GICA 3WG4A 2XONA 2VAUA 4TLGA 2VZQA 5JXHA 5J7MA 4H14A 3VB9A 1ND3A 1S0BA 5LA0A 3WW4A 5DUXA 4MXWB 4MGTA 3LB9A 5A1AA 3AZXA 2QZ3A 4C90A 5KR7A 2JE9A 1K3IA 1PGSA 3AZYA 4DXSA 2BBAA 3K4AA 1GP5A 4IDZA 4LOTA 1OT5A 1AX2A 4URTA 5BNPC 2ZKLA 5LASA 4Y5Z0 3VDCA 1NT0A 2ZOEB 4P9GA 2HBTA 3ZMNA 3C7HA 3CJIB 2JG8C 5CFDA 4KQ7A 1OOPC 1FMD2 4E4SA 2BNMA 4M3CA 2JDNA 5EXOA 1Q8QA 2B8MA 4FFHA 2R16A 1LULA 1OF3A 5D21A 4CP2A 2NMNA 3KGLA 3EYPA 2P17A 1LGBA 3JQWA 1MEC3 4XUNA 1EV11 1DZTA 1TNRA 3FLTA 4LHLA 4LIVA 4QPIA 5EPAA 3USUB 5AC91 1SG3A 4FVVA 1EAH3 1DGWX 5ANNA 2MPFA 5C3SA 2X53S 2V5YA 2WNUC 3P5BA 1OA3A 3AZZA 3ES4A 5CAZA 3I59B 1GYKA 1NA1A 2FZ1A 5LZ6A 2JG8B 1RUF3 4HXCA 3RZZA 1NOVA 4OLLA 4P02B 3ENRA 1H8VA 2VZSA 3RRDA 4COZA 2E26A 4IEQA 3W59A 1C8M3 2A5ZA 3T2PA 4BLJA 2PFWA 5FO9B 1BZWA 3WCRA 3AL6A 1LNSA 4OI4A 2QQIA 4GB31 1WLTA 3OPTA 4Q8KA 1PMIA 4I0BA 2WS93 2HEYF 3FUOA 1KXGA 1UZWA 2E6VA 5FPBA 4RA0A 1UYXA 1POV0 4B4QA 1LTEA 1OH4A 4MH0E 4Q0QA 4WZFA 4XXPA 5GZEA 3U1XA 3U4SA 4QM9A 4DINB 2DUQA 2WT1A 4XF4A 3ZYFA 2JDUA 1OFNA 3RVHA 2XXZA 1ZZ9A 1UCXA 1R092 3L9JT 4IUGA 4K1ZA 4XHXA 2IXHA 3M3OA 3VBSC 1PVC1 1YCIA 1DG6A 2E7QA 2DCTA 1X82A 3PL0A 5A6ZA 1K42A 1VAVA 1YRZA 4TSVA 4AGVA 4YM0A 3MHZA 3OG2A 1QNWA 4MHRA 1KS5A 3POWA 5DABA 3BU0A 1DZQA 3E6BA 1R093 3WNOA 3IM0A 2HWF3 4DXZA 2VTXA 3ZDVA 4K20A 4R9CA 4MXVA 5FBZA 3OBAA 2Q30A 2ETEA 4HANA 2YBKA 1QXPA 2OVUA 4DUWA 3N3HA 1JYCA 4NPRA 1FPN3 4CDQC 3NJVA 1REEA 3M7AA 1VBD2 1VB4A 1F9KA 2D40A 1AR73 4UYBA 2JJ6A 4ITCA 3WQBA 4AZZA 4E4DX 4RSUA 4V1PA 2CDPA 5BNOC 1VBC2 2AACA 2JXAA 3NW4A 3MFAA 2ERFA 1FX5A 2PHLA 1AR81 4WM7A 1PVXA 1YQ5A 3J8F3 5C4WA 4XUPA 4NJ4A 3E5UA 4XQWA 2BQPA 1GOHA 2VOKA 5I8TA 2FD8A 2DTYA 3LDBA 4Y20B 1XU2A 2D97A 1O4TA 1YEWA 1ZA7A 2PHFA 3AYDA 3PDQA 3KHBA 1QXJA 3KLSA 1N1YA 3MDPA 5FWJA 5GLVA 4B7EA 5IUQA 1CZVA 3IDBB 2VOWA 3BB6A 4XC9A 2V4AA 4YM2A 4XCBA 2WZR1 2EICA 4MO3M 4R9AA 4D6RA 4LHSA 4Q4W2 4LO6B 4AOCA 4BZ4A 4XJZA 2WNVB 1ULCA 4DRVA 1AR62 3ZXKA 2J1TA 3DPRB 3R4DB 3D5OA 4GKYA 5FYUA 4YGDA 3WNXA 1W6QB 3OPZA 3ZFEB 5ABJA 3KVAA 2VZUA 3NJZA 4HN0A 1CIWA 3IAPA 4NVPA 4DZGA 1PM4A 1VMJA 2BUKA 2D6LX 2W9XA 3JXSA 4XAEA 4AFCA 4YZ5A 1VBD3 4IE4A 4K6BA 1AR63 1UO9A 4Q4W3 3TOJA 3A7QA 4C91A 5C71A 4QB1A 5K9YA 3OJBA 1VBC1 4UXAA 1RUE3 2D3SA 4FPYA 1QQP2 5LRSA 4GQ7A 1OURA 2GMPA 4ISRA 5FP3A 3GXUA 1E57A 4AF9A 1RUG3 3PUSA 4FT8A 1YI7A 4R4XA 3ZFEC 1JW6A 5BY5A 2BDRA 1CAVA 1CJPA 1RYYA 2K46A 2ZGKA 3PJQA 5FV3A 5L9VA 4H7MA 1QJU1 2ENRA 5E1RA 2VZRA 3C3VA 4GH4C 2VUAA 5HXMA 4XF9A 2OA2A 4KI5M 2ES3A 4P9JA 2JX9A 2W95A 2ZGLA 4JTOA 4P5YA 3JBG3 2OXBA 4LO8A 4YLZA 3OOXA 4BMEA 1DCSA 4LLFA 2RM22 4KNCA 3HVDA 4BQ3A 5A33B 1W8WA 4BA6A 3DKQA 3PVEA 4K40A 2EA7A 4DEQA 4Q4Y1 4CDWB 1RUD1 3FE5A 5LW9A 2HWC2 3U37A 2R071 4JHTA 4ZS2A 1K5MC 2JICA 2W92A 4DEVA 4XE9A 4YFZA 3FN9A 4AEJA 2BRTA 1AYM3 3IIAA 3O14A 3AL5A 1ZREA 5ABJB 2FMYA 5I8YA 2DVBA 1HXS2 1PK6A 2HYKA 5GLWA 1PO13 4M01A 5DUUA 3M1HA 5ACA1 5FPUA 1Y43B 3LOBA 2WRAA 4LQRA 1QMJA 1PHMA 4UBHA 3O1MA 5FY4A 4I30A 3VD4A 4AWDA 1T6GC 3I49A 3DEMA 4PDWB 1YI9A 1G9AA 2CDOA 3KSCA 1RUG2 5DUVA 5F5QA 4AFDA 2VNVA 1AR82 3HIFA 5D8AB 5FDBA 1NYWA 1OQEA 1US3A 3NNFA 4OQ9A 2ZGRA 3H1WA 1V0AA 4QPGB 2Y60A 5FZBA 1G86A 4LHNA 2GN7A 5KHHA 5LCWL 2DFBA 1N3OA 4Y22B 3AX4A 3ZFGA 4A6OA 2ZGTA 1W9TA 1RJ7A 4IE7A 4IEPA 1SACA 1IZ3A 3PNAA 2RM23 4W8JA 3RZLA 4PJYA 2ADEA 2DCYA 3AVRA 1CX4A 3N7LA 4XBNA 4M0HA 2Y6LA 4AL9A 4B8EA 3ZSJA 3CLPA 1WW5A 1Y9MA 3FC0A 2QQLA 1NE6A 3FX3A 3O5SA 4YW2A 4RN5A 5H9QA 5ACA3 3VL8A 2WO1A 1BHGA 1YFYA 3NO8A 3A23A 4LBQD 1QIQA 3AYAA 5CISA 3V65A 4O61A 3BIEA 3Q8AA 4IGQA 2XJPA 3RJ2X 4LORA 4Y5TA 1YO8A 2W5FA 4PT6A 3OBZA 4OHXA 4XFGA 5LK7B 1I5PA 4JRAA 5BNPB 4MV2A 2GC1A 4HT1T 4IV3C 5SV5A 3O1UA 2OZJA 1GQPA 1RUD3 4IEWA 2VL4A 5JIAA 2RDRA 3ZXAC 4CU7A 1YLLA 4I09A 4BOWA 3HN1A 3OD4A 2WZEA 1AZDA 2NM1A 4LLOA 3MIFA 4CEWC 3JBG1 2K0GA 1JTZX 1QGLA 3LA2A 4BQ1A 1ZRRA 5JAXA 1PGL2 2ZXQA 5I8SA 1Q8SA 3MUY1 5D8AA 5EYXA 2EAAA 2XH6A 2DVDA 2Z4FA 2TUNA 3N7JA 3OB8A 3DXUA 4S2DA 4QQ2A 3VV1A 1W2UA 4FO9A 3IDEA 1W3VA 5CNAA 1OPMA 4RQPB 5KHKA 2WWSA 5A3OA 1RUI3 4F8AA 3ILNA 1H4GA 2RE9A 3FLRA 4LE3A 3N9QA 2RS13 1RUE1 5C8WA 5CFCC 2MEV3 1B09A 5KHJA 2OQ6A 3PUQA 4UBGA 1WW6A 2ZX3A 4FI9A 1TMF2 4PIXA 1IQAA 1VBB1 4PI2A 2H0VA 1OLMA 4FP2A 4UFKA 4JX0A 2YUEA 4XVHA 4RQPC 2E31A 3CDZB 3BALA 5FZ8A 3BUCA 1D0HA 2WS92 1JU4A 1G9CA 4OQ8A 1S0GA 1R64A 4BIOA 3JU9A 2VBBA 3RG0A 2JD9A 3O1VA 4UW3A 5I0SA 5FYCA 2G9ZA 1GNHA 3DPRA 5AFBA 4M3CF 2WN3A 1HXS3 4TLFA 3ZFEA 4BQWA 1BBT2 2Z42A 3T30A 1S0DA 4G9SB 4TZDA 1KQRA 1U5YA 2YZ4A 3E97A 3VZJA 4CA9A 1HV1A 4COWA 3LKJA 2XVKA 3VBOC 3HEIA 3SKVA 1IS4A 5BNOA 4Q4Y2 1V9U2 4UF0B 5DAVA 3S30A 5FRAA 4BM8A 1D4M3 3BODA 4RQPA 2WINB 4LKFA 3I54A 4I2OA 1AR83 1IG3A 2IFRA 4WM8C 3P3NA 1LOAA 1RUE2 1JN2P 2BEOA 4QPIB 1MS1A 3VBRC 3KM5A 1HRV2 3WNLA 1VBE3 2FQPA 3PURA 1A78A 2WFF3 1W3XA 2WLPA 4MGSA 4Q0SA 3ZPOA 2JDKA 3VBOB 2PN5A 4Q0UA 3TEYA 2GALA 5IVYA 3VHRA 1KJLA 5JXIA 2QNKA 1W0PA 1SFPA 2VUCA 5KWRA 1I5ZA 3U14A 1REDA 4WBBA 5JR2A 1QQP1 1ZRIA 3J8F2 4AGRA 1J3QA 1AVBA 1HQWA 3WW1A 3AZVA 2BOJA 4GMP3 1OA2A 2XDVA 1SCRA 2XJRA 2HWE2 2VTFA 2VMEA 3K4ZA 5DXDA 2BFUS 2HWC3 2R6QA 3I2GA 1VALA 4MG2A 1XE7A 4RFRB 3NAPC 3WNKA 4RS5C 1KDKA 4NWWA 1MEC2 1QJX3 1CAXA 2P2KA 2QJVA 4YGBA 2Z2SB 2X10A 2JIGA 1EAH2 1GZWB 1YQ8A 1W8UA 2XKOA 1VIWB 3ACFA 4X8PA 3R6SA 1D4M2 3QOPA 2GP5A 1QJEA 2ORXA 1C5IA 2WKKA 5FQ0B 1F4AA 1W6NB 4NIAA 1DGLA 5KHGA 1L7QA 1H0BA 2RR11 1ULPA 1VBE2 4A7ZA 3B7MA 5CZKA 4WV8A 3MI8A 4LBOA 4D6QA 3FFQA 3PU3A 5FZ9A 4N43A 3GHNA 1U0AA 2DUOA 5FZFA 2ARCA 1NQJA 3WLUA 4PLMA 4ZPIA 3PJYA 4DUVA 3C7OA 4WM8A 3T4VA 4BISA 3A0KA 2C9KA 1H4HA 1DYPA 2GH2A 1NY72 2AH2A 4META 2GZWA 2G9FA 2I2SA 4YVWA 3OSDA 2Z79A 1W8FA 4Y1ZA 1FI2A 5JZGB 1LB2A 2Q8OA 3VL9A 2YFUA 2Y0IA 2VZPA 3H0OA 3OPWA 1LESA 1MVQA 1PM7A 1UU5A 3HOBA 3M70A 2YV8A 3MV01 5EZWA 3WX5A 3RZMA 3LDRA 5DG2A 3UGHA 4YVSB 2XKPA 3N9MA 1I3HA 3VBUA 2FHRA 4MHUA 4QPWA 3SMHA 2ZBJA 1JMUB 4Q4V3 3ZN6A 3POJA 2Q1ZB 1NG0A
chains in the Genus database with same CATH topology
3I2JA 2WZ8A 5IFPA 2BZDA 1US2A 2VCBA 3WSOA 3NJXA 3FL7A 4JHZA 4Z2AA 1W8NA 2VQTA 3E1F1 2VMDA 1D7PM 1IQDC 3WF0A 2J22A 5DN2A 3BGAA 2VOTA 4W50A 4OMCA 1GU3A 2VMFA 4D0QA 2B4KA 1XNAA 1O8SA 2W1SA 2W1QA 2QQMA 1F4HA 2W87A 2QBXA 4CU6A 1W99A 1TG7A 1KEXA 2ORZA 4BK5A 1UY3A 3CZJA 4GWIA 2XHNA 1W8OA 1DLCA 1NKGA 2Y8KA 1SDDB 3VD3A 4E8DA 4JKLA 2Y6HA 2W46A 3MBWA 5FUIA 4A44A 3SKJE 2WAOA 1GMMA 1NX9A 3FHAA 4CUCA 4MOAA 2XONA 1PX3A 2VZQA 5JXHA 3I2KA 5LA0A 1JZ2A 4ZXEA 4OYUA 2EIBA 5C7GA 5A1AA 2VM9A 2BGPA 3C8XA 1K3IA 4DXRA 4DXSA 4XUQA 2BBAA 3K4AA 2QQKA 2VZ1A 1OT5A 1CZTA 1CIYA 4A3ZA 3VDCA 2XQXA 3MUZ1 3C7HA 1UYZA 5JMOA 5JXGA 1JZ4A 3C7FA 4KMQA 3FHQA 1OF3A 3WNMA 1JZ3A 3EYPA 3HPNA 5CYYA 3ABZA 2W94A 1T2XA 4XUNA 1DP0A 1SG3A 3GGLA 1CX1A 4QX2A 5DQ0A 3LE0A 2C26A 3WNNA 2J1VA 2WAAA 4P02B 2RV9A 3ZM8A 2VZSA 4ARXA 5EJZB 2E26A 2J1UA 3UETA 3WF4A 3T2PA 2E33A 3CIHA 3CMGA 3IB3A 4BK4A 1K12A 1LNSA 2QQIA 3IAQA 3ECQA 4HG6B 3THCA 1L7RA 4M4PA 1UYXA 1OH4A 2C4XA 2VO5A 4P00B 3K46A 3W5MA 4AAXA 4XUTA 1XNTA 2ZEXA 4IUGA 5DPNA 1K42A 4CU8A 1OF4A 2ZEWA 3P1IA 2W1WA 1GOFA 3OG2A 3OGRA 4GZ9A 1JHJA 3WNOA 2V4VA 1WKYA 2LS6A 3OEBA 3OBAA 2VZ3A 2L9LA 3HN3A 5LA2A 4DUWA 5I0DA 3NJVA 2WO2A 5LA1A 5C70A 1UZ0A 2WDBA 2KD7A 1J83A 3WF2A 3WQBA 2CDPA 2J1SA 3SEEA 1UXZA 1JYWA 3I97A 4XUOA 1XC6A 2YG0A 5IYYA 4XUPA 4ZZ5A 1GOHA 4KWUA 5B4XA 4CU9A 3LEIA 3WF3A 1CZVA 1W9WA 1H6YA 2EICA 4MO3M 2XOMA 1JI6A 4LHSA 3MV11 5F7UA 2X05A 2J1TA 3P6BA 3C7GA 2VZUA 3IAPA 1CZSA 1NUKA 2W9XA 3JXSA 2LW8A 1KGYA 3I2IA 1YQ2A 3A7QA 5C71A 4QB1A 1UY2A 2QQOA 3GXUA 3T08A 4E8CA 3C7EA 2Y6JA 1RYYA 2YFZA 3T2QA 2VZRA 5HXMA 1DYOA 2J7MA 4DUXA 2ID4A 4UAPA 4KI5M 2DDUA 2W95A 4P5YA 3GM8A 1PMHX 4XZUG 4YPJA 4JKKA 2W47A 4DEQA 5EIYB 3U37A 4DEVA 2W92A 3FN9A 1JZ8A 3LEKA 2J1AA 2Y6KA 1OD3A 1W0NA 1HN1A 1GUIA 3ETPA 2VCCA 1PMJX 4LQRA 2J1RA 3HNYM 3VD9A 3UESA 3VD4A 4A45A 2Y6GA 5DMYA 2HYXA 2CDOA 2Y64A 2VQUA 2J1EA 3T0DA 1US3A 3OEAA 4ZY9A 2VCAA 3DECA 5LCWL 5EJ1B 4A6OA 1W9TA 2WN2A 5G05L 3MO4A 4W8JA 4QAWA 3HJRA 2W1UA 2VZTA 3NRUA 2ZEZA 2Y6LA 3PUHA 4MADA 2QQLA 4PF1A 4RN5A 4ZZ8A 2WABA 2WO1A 5HPOA 1BHGA 1O59A 3D3AA 4AG4A 4LKSA 3A23A 4QX0A 1XPWA 2E32A 4M4RA 4CUAA 1J84A 2EIEA 2BGOA 2W5FA 4PT6A 4QB2A 1I5PA 3WF1A 2VJXA 4QDQA 1GQPA 3I3BA 2VL4A 1WCQA 5IJRA 2B9VA 1PX4A 4CU7A 4OMDA 1UY0A 3CKHA 4BXSV 2VMCA 1UXXX 3OGSA 2WZEA 2DCJA 4PQQA 4BDVB 2ZXQA 5IFTA 3MUY1 1W9SA 3T0AA 2Z4FA 1UYYA 3OB8A 3IDAA 4TTGA 1UMIA 3T2OA 1UWWA 4W4ZA 3IIIA 4UOJA 4ET7A 1JZ5A 3K75B 3I2FA 4TXWA 3DYMA 1O8PA 3I2HA 4FI9A 4D8MA 3K4DA 3WEZA 4JX0A 3T0BA 4XVHA 3I3EA 2E31A 1SHWB 3CDZB 2VZVA 1JU4A 3CQOA 3LQCA 1JZ6A 1R64A 2YC4A 3J7HA 2JD9A 2JKXA 1ULOA 3ACHA 2WQ8A 1P8JA 2WN3A 2V72A 4QDRA 2QQJA 4ARYA 3WNPA 1K45A 5J1XA 2VC9A 3HEIA 3SKVA 1JYVA 3W5NA 4A4AA 3LPFA 4OZOA 4DXTA 2HLEA 3UNPA 1UX7A 2VR4A 2R7EB 3WNLA 3OGVA 4MGSA 2ZEYA 1NAEA 2X09A 5JXIA 5B4NA 2PQSA 4CVUA 2BERA 5JR2A 4L0PA 2V5DA 2WYSA 3T09A 3VD7A 3VDBA 4MGQA 4A41A 2YC2A 2RJ2A 3A22A 3EB7A 4LPLA 5IHRA 3VDAA 1JYNA 3PUIA 2WBKA 2JDAA 3A21A 2QQNA 2VTFA 2VMEA 3K4ZA 3I3DA 3I2GA 3GDBA 3WNKA 3K77A 5G04L 3AC0A 2RVAA 1H6XA 2X10A 2DCKA 4JKMA 3ACFA 2WO3A 1EUUA 2W91A 3VD5A 2ORXA 1F4AA 2WUHA 1L7QA 1EUTA 1JU3A 1TVGA 1ULPA 3THDA 3DYOA 4P08A 5CZKA 5JXJA 4BJ0A 4UI9L 3ACIA 3BN6A 2OKXA 4OUEA 4QB6A 4QX3A 4DUVA 3C7OA 1GNYA 2YB7A 2C9KA 3DYPA 1MPXA 4A42A 5JUVA 1UY1A 1JZ7A 1JYXA 4RYDA 4XURA 3ACGA 4CUBA 2VZOA 1UMHA 2YFUA 4QDSA 1GOGA 2VZPA 3HNMA 3NQHA 3HOBA 3SEPA 3MV01 1UY4A 3LEGA 4QX1A 3CZUA 3LPGA 3F2ZA 3HNBM 2W3JA 2JE8A 2EIDA 3NNGA 4QPWA 4GWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I2J A;  2WZ8 A;  5IFP A;  2BZD A;  1US2 A;  2VCB A;  3WSO A;  3NJX A;  3FL7 A;  4JHZ A;  4Z2A A;  1W8N A;  2VQT A;  3E1F 1;  2VMD A;  1D7P M;  1IQD C;  3WF0 A;  2J22 A;  5DN2 A;  3BGA A;  2VOT A;  4W50 A;  4OMC A;  1GU3 A;  2VMF A;  4D0Q A;  2B4K A;  1XNA A;  1O8S A;  2W1S A;  2W1Q A;  2QQM A;  1F4H A;  2W87 A;  2QBX A;  4CU6 A;  1W99 A;  1TG7 A;  1KEX A;  2ORZ A;  4BK5 A;  1UY3 A;  3CZJ A;  4GWI A;  2XHN A;  1W8O A;  1DLC A;  1NKG A;  2Y8K A;  1SDD B;  3VD3 A;  4E8D A;  4JKL A;  2Y6H A;  2W46 A;  3MBW A;  5FUI A;  4A44 A;  3SKJ E;  2WAO A;  1GMM A;  1NX9 A;  3FHA A;  4CUC A;  4MOA A;  2XON A;  1PX3 A;  2VZQ A;  5JXH A;  3I2K A;  5LA0 A;  1JZ2 A;  4ZXE A;  4OYU A;  2EIB A;  5C7G A;  5A1A A;  2VM9 A;  2BGP A;  3C8X A;  1K3I A;  4DXR A;  4DXS A;  4XUQ A;  2BBA A;  3K4A A;  2QQK A;  2VZ1 A;  1OT5 A;  1CZT A;  1CIY A;  4A3Z A;  3VDC A;  2XQX A;  3MUZ 1;  3C7H A;  1UYZ A;  5JMO A;  5JXG A;  1JZ4 A;  3C7F A;  4KMQ A;  3FHQ A;  1OF3 A;  3WNM A;  1JZ3 A;  3EYP A;  3HPN A;  5CYY A;  3ABZ A;  2W94 A;  1T2X A;  4XUN A;  1DP0 A;  1SG3 A;  3GGL A;  1CX1 A;  4QX2 A;  5DQ0 A;  3LE0 A;  2C26 A;  3WNN A;  2J1V A;  2WAA A;  4P02 B;  2RV9 A;  3ZM8 A;  2VZS A;  4ARX A;  5EJZ B;  2E26 A;  2J1U A;  3UET A;  3WF4 A;  3T2P A;  2E33 A;  3CIH A;  3CMG A;  3IB3 A;  4BK4 A;  1K12 A;  1LNS A;  2QQI A;  3IAQ A;  3ECQ A;  4HG6 B;  3THC A;  1L7R A;  4M4P A;  1UYX A;  1OH4 A;  2C4X A;  2VO5 A;  4P00 B;  3K46 A;  3W5M A;  4AAX A;  4XUT A;  1XNT A;  2ZEX A;  4IUG A;  5DPN A;  1K42 A;  4CU8 A;  1OF4 A;  2ZEW A;  3P1I A;  2W1W A;  1GOF A;  3OG2 A;  3OGR A;  4GZ9 A;  1JHJ A;  3WNO A;  2V4V A;  1WKY A;  2LS6 A;  3OEB A;  3OBA A;  2VZ3 A;  2L9L A;  3HN3 A;  5LA2 A;  4DUW A;  5I0D A;  3NJV A;  2WO2 A;  5LA1 A;  5C70 A;  1UZ0 A;  2WDB A;  2KD7 A;  1J83 A;  3WF2 A;  3WQB A;  2CDP A;  2J1S A;  3SEE A;  1UXZ A;  1JYW A;  3I97 A;  4XUO A;  1XC6 A;  2YG0 A;  5IYY A;  4XUP A;  4ZZ5 A;  1GOH A;  4KWU A;  5B4X A;  4CU9 A;  3LEI A;  3WF3 A;  1CZV A;  1W9W A;  1H6Y A;  2EIC A;  4MO3 M;  2XOM A;  1JI6 A;  4LHS A;  3MV1 1;  5F7U A;  2X05 A;  2J1T A;  3P6B A;  3C7G A;  2VZU A;  3IAP A;  1CZS A;  1NUK A;  2W9X A;  3JXS A;  2LW8 A;  1KGY A;  3I2I A;  1YQ2 A;  3A7Q A;  5C71 A;  4QB1 A;  1UY2 A;  2QQO A;  3GXU A;  3T08 A;  4E8C A;  3C7E A;  2Y6J A;  1RYY A;  2YFZ A;  3T2Q A;  2VZR A;  5HXM A;  1DYO A;  2J7M A;  4DUX A;  2ID4 A;  4UAP A;  4KI5 M;  2DDU A;  2W95 A;  4P5Y A;  3GM8 A;  1PMH X;  4XZU G;  4YPJ A;  4JKK A;  2W47 A;  4DEQ A;  5EIY B;  3U37 A;  4DEV A;  2W92 A;  3FN9 A;  1JZ8 A;  3LEK A;  2J1A A;  2Y6K A;  1OD3 A;  1W0N A;  1HN1 A;  1GUI A;  3ETP A;  2VCC A;  1PMJ X;  4LQR A;  2J1R A;  3HNY M;  3VD9 A;  3UES A;  3VD4 A;  4A45 A;  2Y6G A;  5DMY A;  2HYX A;  2CDO A;  2Y64 A;  2VQU A;  2J1E A;  3T0D A;  1US3 A;  3OEA A;  4ZY9 A;  2VCA A;  3DEC A;  5LCW L;  5EJ1 B;  4A6O A;  1W9T A;  2WN2 A;  5G05 L;  3MO4 A;  4W8J A;  4QAW A;  3HJR A;  2W1U A;  2VZT A;  3NRU A;  2ZEZ A;  2Y6L A;  3PUH A;  4MAD A;  2QQL A;  4PF1 A;  4RN5 A;  4ZZ8 A;  2WAB A;  2WO1 A;  5HPO A;  1BHG A;  1O59 A;  3D3A A;  4AG4 A;  4LKS A;  3A23 A;  4QX0 A;  1XPW A;  2E32 A;  4M4R A;  4CUA A;  1J84 A;  2EIE A;  2BGO A;  2W5F A;  4PT6 A;  4QB2 A;  1I5P A;  3WF1 A;  2VJX A;  4QDQ A;  1GQP A;  3I3B A;  2VL4 A;  1WCQ A;  5IJR A;  2B9V A;  1PX4 A;  4CU7 A;  4OMD A;  1UY0 A;  3CKH A;  4BXS V;  2VMC A;  1UXX X;  3OGS A;  2WZE A;  2DCJ A;  4PQQ A;  4BDV B;  2ZXQ A;  5IFT A;  3MUY 1;  1W9S A;  3T0A A;  2Z4F A;  1UYY A;  3OB8 A;  3IDA A;  4TTG A;  1UMI A;  3T2O A;  1UWW A;  4W4Z A;  3III A;  4UOJ A;  4ET7 A;  1JZ5 A;  3K75 B;  3I2F A;  4TXW A;  3DYM A;  1O8P A;  3I2H A;  4FI9 A;  4D8M A;  3K4D A;  3WEZ A;  4JX0 A;  3T0B A;  4XVH A;  3I3E A;  2E31 A;  1SHW B;  3CDZ B;  2VZV A;  1JU4 A;  3CQO A;  3LQC A;  1JZ6 A;  1R64 A;  2YC4 A;  3J7H A;  2JD9 A;  2JKX A;  1ULO A;  3ACH A;  2WQ8 A;  1P8J A;  2WN3 A;  2V72 A;  4QDR A;  2QQJ A;  4ARY A;  3WNP A;  1K45 A;  5J1X A;  2VC9 A;  3HEI A;  3SKV A;  1JYV A;  3W5N A;  4A4A A;  3LPF A;  4OZO A;  4DXT A;  2HLE A;  3UNP A;  1UX7 A;  2VR4 A;  2R7E B;  3WNL A;  3OGV A;  4MGS A;  2ZEY A;  1NAE A;  2X09 A;  5JXI A;  5B4N A;  2PQS A;  4CVU A;  2BER A;  5JR2 A;  4L0P A;  2V5D A;  2WYS A;  3T09 A;  3VD7 A;  3VDB A;  4MGQ A;  4A41 A;  2YC2 A;  2RJ2 A;  3A22 A;  3EB7 A;  4LPL A;  5IHR A;  3VDA A;  1JYN A;  3PUI A;  2WBK A;  2JDA A;  3A21 A;  2QQN A;  2VTF A;  2VME A;  3K4Z A;  3I3D A;  3I2G A;  3GDB A;  3WNK A;  3K77 A;  5G04 L;  3AC0 A;  2RVA A;  1H6X A;  2X10 A;  2DCK A;  4JKM A;  3ACF A;  2WO3 A;  1EUU A;  2W91 A;  3VD5 A;  2ORX A;  1F4A A;  2WUH A;  1L7Q A;  1EUT A;  1JU3 A;  1TVG A;  1ULP A;  3THD A;  3DYO A;  4P08 A;  5CZK A;  5JXJ A;  4BJ0 A;  4UI9 L;  3ACI A;  3BN6 A;  2OKX A;  4OUE A;  4QB6 A;  4QX3 A;  4DUV A;  3C7O A;  1GNY A;  2YB7 A;  2C9K A;  3DYP A;  1MPX A;  4A42 A;  5JUV A;  1UY1 A;  1JZ7 A;  1JYX A;  4RYD A;  4XUR A;  3ACG A;  4CUB A;  2VZO A;  1UMH A;  2YFU A;  4QDS A;  1GOG A;  2VZP A;  3HNM A;  3NQH A;  3HOB A;  3SEP A;  3MV0 1;  1UY4 A;  3LEG A;  4QX1 A;  3CZU A;  3LPG A;  3F2Z A;  3HNB M;  2W3J A;  2JE8 A;  2EID A;  3NNG A;  4QPW A;  4GWJ A; 
#chains in the Genus database with same CATH topology
 2SBA A;  4PQ9 A;  3I2J A;  5IFP A;  4H2A A;  4Q4X 1;  1BMV 2;  3JCI A;  3AM2 A;  5H9S A;  4Y1Y A;  1W2A X;  2NYY A;  1O5L A;  1GSL A;  5FZM A;  2GME A;  3VBF C;  2OZ6 A;  4FPJ A;  1TEI A;  2R49 A;  5FZL A;  4YVS C;  1DQ1 A;  4BWO A;  1IQD C;  2JKB A;  3ZFF A;  3RZG A;  4LBL A;  4W50 A;  1GU3 A;  1RUJ 1;  4NPL A;  2BV4 A;  2VMF A;  3J7L A;  2B4K A;  1XNA A;  1O8S A;  2W1S A;  1W06 A;  4FAH A;  2PLV 3;  2YYO A;  3HQX A;  1YNA A;  1AX0 A;  4IE5 A;  4CCC A;  2NMO A;  3VDD A;  1N1V A;  4CCD A;  4JQR A;  2CL2 A;  5FZI A;  3GZE A;  1OMI A;  3CF6 E;  1N3Q A;  5LAT A;  1W8T A;  2W68 A;  4XEZ A;  3U11 A;  1DLC A;  4QKF A;  3S57 A;  2JEM A;  4OHY A;  5A33 A;  2JG9 A;  2PMW B;  1SDD B;  5JI9 A;  3MEP A;  2G1M A;  4I3G A;  2Y6H A;  2NP0 A;  2W46 A;  2VBD A;  5C6C A;  4C0H A;  1MQT C;  4A44 A;  3H8O A;  3NV3 A;  1MZ6 A;  3ZFF C;  2WAO A;  1S0E A;  2D3P A;  4ZON A;  5F3C A;  1DDL A;  2ZZJ A;  1PX3 A;  3RWN A;  3J7N A;  2JDP A;  1ZZ7 A;  4XAB A;  4ZU5 A;  3VKL A;  3VKF C;  1OUS A;  1JZ2 A;  3ILR A;  1LEN A;  1JYT A;  4LK7 A;  4OYU A;  1HJG A;  2E53 A;  3MID A;  3KGZ A;  3VGI A;  4CCK A;  5J98 B;  2VM9 A;  3C8X A;  3BTA A;  5J3U A;  2GMM A;  4DXR A;  1APN A;  1IG0 A;  5HCF A;  1FAY A;  1MQT B;  1S0J A;  4WVV A;  4MGI E;  4YRD A;  2FDK A;  3RGB A;  4NMI A;  2G9G A;  2VTX J;  4MSV A;  1CIY A;  4Q29 A;  1XRU A;  1DIW A;  2JDZ A;  2RS5 3;  2Q8C A;  2OPK A;  4Q4V 1;  5FZ4 A;  4RL7 A;  1UYZ A;  4UF0 A;  5JCT A;  3GHM A;  5APA A;  2EF6 A;  5JMO A;  1O3T A;  1JZ4 A;  1AYN 2;  4EQV A;  1ASJ 3;  4QPG A;  3GZT B;  4NAM A;  4N9I A;  5FJK A;  1ZBA 1;  4G4F A;  3ABZ A;  3UGF A;  5L36 A;  1RL3 A;  2VBP A;  1DHK B;  1W6O A;  2CU5 A;  2XLA A;  1V6L A;  1LOE A;  1CX1 A;  4U2A A;  2BW8 A;  2ZHL A;  4QX2 A;  4FOY A;  3J9S A;  2UU8 A;  1QOO A;  2C26 A;  3HT1 A;  1PGW 2;  1WCK A;  2J1V A;  1XYO A;  4FCA A;  4XET A;  3TBD A;  2FDI A;  5HXV A;  2ZAH A;  4AI8 A;  2VCM A;  4YYO A;  4ARX A;  4GAL A;  5EJZ B;  1WLD A;  3TWI A;  2WR9 A;  5I93 A;  3JQX A;  4CCO A;  4XJ9 A;  3ZLI A;  1X7N A;  2NLR A;  3HBZ A;  4LA2 A;  3S6P A;  3WF4 A;  3RZK A;  2ZX1 A;  4HVQ A;  5FZE A;  3W58 A;  5FMC A;  5T55 A;  3ZX7 A;  1BEV 2;  2W08 A;  1ZBE 3;  4AI3 A;  1IKQ A;  2RR1 3;  2VG9 A;  3ASI A;  4NRP A;  1A3K A;  4RD7 A;  4LBK A;  3OBR A;  4AQT A;  3NAP B;  3ZSK A;  1RUH 2;  2CWS A;  4P00 B;  2ZMK A;  2VUD A;  1O7F A;  4NII A;  4P5H A;  2P3Y A;  1KDM A;  2ZEX A;  1RGS A;  4LUK A;  3V0B A;  1OF4 A;  2PLV 1;  1GZW A;  4JDM A;  4QX5 A;  2RJK A;  5IK7 A;  3JBG 2;  5ERL A;  1QH6 A;  2YU1 A;  3TNQ A;  2ZGS A;  3OGR A;  1DGR N;  4GZ9 A;  4XJA A;  4OI1 A;  5J36 A;  2XWJ B;  1W6N A;  1A34 A;  1VBA 2;  4COU A;  1JHJ A;  3ON7 A;  1WLW A;  4J6G A;  3NNL A;  1WKY A;  1ZA4 A;  1RMU 2;  3K48 A;  1HXS 1;  1D0G A;  3N36 A;  1RUD 2;  2IXI A;  3OEB A;  2VZ3 A;  4L99 A;  5F3G A;  4C1X A;  1ZRC A;  2EAK A;  2GNM A;  1BK1 A;  1D2S A;  1NA1 B;  1S2E A;  5LA2 A;  4E9K A;  4D7S A;  1WW4 A;  2A6V A;  4YG3 A;  5LEK A;  1CQ9 A;  1V6J A;  4HKL A;  2WDB A;  5C70 A;  5EV7 A;  1K5M B;  5LBB A;  1J83 A;  1LOF C;  4NID A;  2YDE A;  3AXD A;  4I3P A;  2FCU A;  2Q4S A;  2LRO A;  3WF2 A;  2XBO 1;  4IL7 A;  1FYU A;  3TEX A;  1G9D A;  1COV 3;  4F7Z A;  1O3S A;  2DVA A;  1FNY A;  3SEE A;  2HWD 2;  3K51 A;  4S2H A;  4MYE A;  1HB2 A;  1XU1 A;  1DQ2 A;  4Y3O A;  2CTV A;  4XUO A;  5FUN A;  1XC6 A;  3Q8F A;  5IVJ A;  2C6S A;  3VBU B;  3ZMO A;  3TEW A;  2D5H A;  5FZ3 A;  1DQ4 A;  2FDG A;  2UUR A;  1RUI 1;  2V73 A;  5C3O A;  1UKG A;  5JVV A;  2DBI A;  4AVB A;  2BBV A;  3JD7 3;  4GB3 2;  1WCU A;  2YPD A;  1UU4 A;  2I07 B;  4YGC A;  3FWE A;  5B4X A;  4DB5 A;  4CU9 A;  1ND2 B;  4Q4V 2;  5FK7 A;  3V0A A;  1W9Y A;  1UZZ A;  2ILM A;  4CPB A;  2ZGP A;  3TNP B;  2I45 A;  4RS5 B;  3CBN A;  2RS5 2;  2D6P A;  4Q8L A;  3KMH A;  2TBV A;  3AP9 A;  3HQU A;  2JDH A;  5T5L A;  5ACA 2;  1PZ8 A;  5C8C B;  1MS8 A;  1ALY A;  3B5L B;  5ANQ A;  1ASJ 2;  3S7E A;  4BH9 A;  1ULE A;  2IC1 A;  4NIG A;  3P6B A;  2D6K A;  1RVF 3;  4C0B A;  2ZGM A;  1QJX 1;  3AMM A;  1R1Z A;  2AR6 A;  5LK5 A;  5AC9 2;  1GP6 A;  1DZR A;  5A6Y A;  1NUK A;  5FXZ A;  3KWV A;  2LW8 A;  4FOW A;  3AVS A;  5L9R A;  3ZOI A;  4CCM A;  1KGY A;  4Y5S A;  4G3Y C;  5DUW A;  4JDN A;  1V6O A;  1H1A A;  1R1A 3;  1YQ2 A;  3IKW A;  1UY2 A;  2DU0 A;  2R07 2;  2WA4 A;  4SBV A;  2YPJ A;  3SXW A;  4CDQ A;  4AI2 A;  3VZN A;  5FK8 A;  2G19 A;  1AR9 2;  2VNG A;  2Y6J A;  3ES1 A;  1YIF A;  2LAL A;  2W2I A;  1LR5 A;  1B35 A;  1W8Z A;  2D5F A;  3H42 B;  3LAG A;  4N53 C;  4XFI A;  3WT3 A;  5KXD A;  4QKD A;  1NCQ A;  4IE6 A;  2GN3 A;  3LF7 A;  3T2Q A;  2HWB 2;  4JC1 A;  4L9B A;  5IVC A;  1ZZB A;  4AW7 A;  4TN7 A;  4UAP A;  3TN9 1;  3WP4 A;  2JWP A;  1ND2 A;  1CES A;  1VBE 1;  2PTM A;  1ODN A;  2HH9 A;  1UMZ A;  2ZML A;  4QPY A;  1IS3 A;  2VXR A;  3CNA A;  4MUV A;  4P9X A;  4M3C B;  4YPJ A;  4JKK A;  5BNN A;  5FP7 A;  3WDT A;  1D4M 1;  4N53 B;  3GJA A;  3ZXF A;  4GA9 A;  5I0R A;  5A6X A;  4KU8 A;  1DFQ A;  5LA9 A;  3V64 A;  3LEK A;  3BTZ A;  4RFT 0;  2CGO A;  4YNI A;  1SLC A;  2UWB A;  1PNF A;  1PO1 1;  5FZC A;  3T1M A;  1ODM A;  5A3U A;  1MS3 A;  2D98 A;  5F37 A;  2H6C A;  1QEX A;  3S0M A;  2CY6 A;  4FPG A;  3SHR A;  1HN1 A;  2ZHK A;  3ETP A;  1XJA A;  1VE0 A;  4D7Y A;  4XQD A;  1VLN A;  1GR3 A;  2J1R A;  3FFZ A;  2OYZ A;  2WFF 2;  1RHI 3;  2R07 3;  3HNY M;  3VD9 A;  4YW1 A;  3D6E A;  1DYK A;  5DMY A;  2HYX A;  1ZYB A;  2RM2 1;  3FHI B;  5FZ7 A;  5FXV A;  2Y64 A;  3C2U A;  5LWB A;  2VQU A;  5JOY A;  1V6N A;  5F5I A;  3T0D A;  4IEZ A;  3KVB A;  3OEA A;  2CWM A;  2R32 A;  1NCQ B;  1SMV A;  4CYD A;  1Q3E A;  3VKM A;  1UOB A;  4COY A;  1ST8 A;  5LY1 A;  3D0S A;  3TN9 3;  4PLO A;  3ZN6 B;  3AMP A;  4FBF A;  2TEP A;  4Y24 A;  2WN2 A;  1CAW A;  1WGP A;  5BV6 A;  4DIQ A;  2RR1 2;  1ZX5 A;  3O0X A;  4EV0 A;  4D94 A;  2VZT A;  1UPS A;  2RS3 1;  4EE2 A;  5J37 A;  2WC2 A;  2WJS A;  2ZEZ A;  3NNJ A;  1C1L A;  1C57 A;  2YHJ A;  5FMD A;  4MAD A;  4QWN A;  1XOY A;  3RI8 A;  2PAM A;  4PF1 A;  1UPI A;  4ZZ8 A;  1SLI A;  3IPV B;  2WAB A;  3VBH B;  4CP9 B;  2D43 A;  3VBR B;  4AG4 A;  2DUP A;  4LKS A;  5KXC A;  4E4Z A;  1GQH A;  4M4R A;  4LBJ A;  2EIE A;  4XOG A;  4P9I A;  2DV9 A;  3USS A;  3BTX A;  2O0O A;  3KV4 A;  3DL3 A;  3MW2 A;  2X5I A;  2K2S A;  4CXY A;  4PBO A;  5FYM A;  1WCQ A;  4Q4Y 3;  2DVG A;  1RVF 1;  4DMI A;  1HX6 A;  2ZTN A;  4A7K A;  1V00 A;  1N47 A;  3CKH A;  2VMC A;  1HQL A;  3OGS A;  1QDC A;  2DCJ A;  2RHP A;  4E2G A;  4PQQ A;  3EJK A;  3AFK A;  4LBM A;  2FCT A;  2GC3 A;  5IFT A;  1QHD A;  1CAU A;  5KBF A;  4XW3 A;  5C4W B;  4FFI A;  5C9A B;  3T2O A;  1OC1 A;  3IWZ A;  1R08 3;  2RJL A;  3Q8C A;  4OHZ A;  3III A;  3JD7 1;  5E8A A;  3WDY A;  2R1D A;  3ZR5 A;  4UOJ A;  1AXK A;  3OTF A;  1RUC 2;  4F3J A;  4B4P A;  1JZ5 A;  4H7L A;  4TXW A;  1YWK A;  3VBF A;  3TYJ A;  5A3N A;  4XIO A;  3MLK A;  5LEJ A;  3THP A;  5A3T A;  4Q1P A;  1ULD A;  2JG9 B;  1O4Z A;  1VBD 1;  1COV 1;  1H1M A;  2F4P A;  4OUM A;  4PBP A;  4AVC A;  2XBO 3;  4XCA A;  3WEZ A;  4UFJ A;  1QJY 2;  5DAQ A;  2WNV A;  5K7P A;  1W04 A;  2BNO A;  1GAN A;  1MVE A;  1W6Q A;  3CQO A;  5FLH A;  5AFE A;  3LQC A;  1JZ6 A;  2X5I B;  2H0B A;  3M3E A;  4X6R B;  4A2U A;  2YC4 A;  5FY0 A;  3J7H A;  1RHI 1;  3VBS B;  1VRH 2;  2CSG A;  5C3Q A;  1YQC A;  2Q1F A;  3VDD C;  2WQ8 A;  5D8A C;  3DCQ A;  1FOD 2;  2P6C A;  5FYB A;  5C3R A;  1W28 A;  1LU2 A;  2DYC A;  3W21 A;  3WNP A;  4IV3 A;  1K45 A;  1W90 A;  4LTA A;  2Z5W A;  4ES9 A;  2VC9 A;  1JYV A;  3W5N A;  5IT6 A;  4FOV A;  4LJH A;  1O3R A;  5KHI A;  1QH7 A;  2VY0 A;  4N43 C;  1PVC 3;  3OYW B;  3J8F 1;  3UKT A;  4ASK A;  5ISL A;  1YHF A;  5B2G B;  4OUS A;  3UNP A;  1IPJ A;  2VR4 A;  1SLT A;  2R7E B;  1W6O B;  1X9P A;  3WQ7 A;  2A6Z A;  4LOS A;  3U4X A;  1FT9 A;  2A75 A;  1HQN A;  1F2N A;  3L2Y A;  2ARB A;  1RIR A;  3BYW A;  2XJQ A;  2DTW A;  4OHV A;  3BPZ A;  1X50 A;  1NAE A;  4ASL A;  3S7I A;  3H7J A;  1NCR C;  2BFU L;  4JGZ C;  4LR4 A;  5CKQ A;  4CDW A;  5T5J A;  2EIG A;  2P4E A;  1FPN 1;  3FUQ A;  4UFL A;  3THT A;  3OY8 B;  4CVU A;  1AJO A;  1C8M 1;  2BER A;  4RGA A;  2XML A;  5L19 A;  2V5D A;  3N7M A;  2CGN A;  5LBC A;  3T09 A;  5J48 A;  3VDB A;  4A41 A;  4IEO A;  5DAP A;  2YC2 A;  2JG8 A;  5FP9 A;  5FP4 A;  3RJR A;  3A22 A;  5FLJ A;  3EB7 A;  1GWK A;  3VDA A;  2HWF 1;  4CZS A;  4E2S A;  4JGY A;  2G4I A;  1ND2 C;  2A3Y A;  2PHT A;  1JH5 A;  2QQU A;  1JUH A;  2JDA A;  3A21 A;  1V6M A;  1O4Y A;  1AX1 A;  1SZB A;  4M00 A;  5EQU A;  3I3D A;  2NQY A;  3GDB A;  1BLZ A;  2FCV A;  5G04 L;  4Q1R A;  1U12 A;  3AC0 A;  5JIU A;  5FPL A;  1H6X A;  2DCK A;  3AKR A;  3M8L A;  2AYH A;  2K9Z A;  3WZ1 A;  5FZK A;  2Q8D A;  3VHN A;  1OQD A;  4AVA A;  4LT5 A;  3GCX A;  1WA6 X;  4CDX C;  5FR3 A;  1RXG A;  1KS4 A;  4YG0 A;  3EQE A;  5F6L B;  2C9A A;  2WUH A;  1UKR A;  1JU3 A;  1UIK A;  3LWC A;  5FPX A;  2A1X A;  4NRQ A;  4KBZ A;  5LB6 A;  3DYO A;  3THD A;  4WM7 B;  3AP4 A;  4NO4 A;  4BJ0 A;  2E63 A;  4DOU A;  1KD7 A;  2BWA A;  1H1I A;  3BN6 A;  4FP3 A;  2OKX A;  2B5H A;  5BPX A;  1SBE A;  4QX3 A;  2YU2 A;  1GNY A;  5FYV A;  3HQR A;  3TN9 2;  1RUF 1;  1UY1 A;  1RUI 2;  1VP6 A;  3GCW A;  4JGY C;  5F6K A;  4CEW A;  4RYD A;  1JZ7 A;  4K3U A;  2IXJ A;  2ZAB A;  1GBG A;  2VQA A;  3RZJ A;  1UMH A;  4S2F A;  5JOZ A;  1GOG A;  3L2H A;  3SEP A;  1UY4 A;  1M4W A;  1ULF A;  3LEG A;  1ACC A;  5CA6 A;  4FPF A;  3VBR A;  5T5O A;  3MLL A;  5DZG A;  3U75 A;  3DF0 A;  3F2Z A;  4FPC A;  2LRP A;  3RYK A;  3W9A A;  2EID A;  3LFM A;  3ZXE A;  1ONA A;  4BQY A;  3I3M A;  2IWG B;  4DPN A;  5I0T A;  1J1T A;  4J1X A;  1PZ7 A;  2ZKN A;  4R52 A;  1UIJ A;  3ORJ A;  4DFS A;  1QNY A;  5IAX A;  1RUJ 3;  2TNF A;  2YXS A;  3FL7 A;  2QDN A;  1W8N A;  5SV8 A;  3E1F 1;  5CFC A;  3BTY A;  1HB1 A;  3NWK A;  4RS5 A;  2VMD A;  1D7P M;  1SCS A;  4K9S A;  4XJW A;  1XNK A;  1VBA 1;  2DU1 A;  1ZBA 3;  3WDV A;  1DLL A;  3ITQ A;  2QQM A;  4BMB A;  1D2Q A;  4CP0 A;  5E89 A;  4AFB A;  2FZ2 A;  4CU6 A;  1W99 A;  1UD1 A;  4XIK A;  4MGY E;  1TG7 A;  4K1Y A;  4Q2F A;  2EXK A;  3DPR C;  2B45 X;  1QJU 2;  1CJD A;  1WWY A;  2XG3 A;  2ORZ A;  3M3Q A;  4BK5 A;  1F15 A;  2RS5 1;  3EBR A;  1WD3 A;  2XHN A;  4GWI A;  3POE A;  1DF0 A;  2XJV A;  2UYB A;  1HJF A;  1GWM A;  2XJS A;  4BIF A;  1B35 C;  3B02 A;  4Y4R A;  1AUY A;  1W8O A;  1BEV 3;  3E6C C;  2RS3 2;  1NKG A;  4PIZ A;  1GWL A;  3GNE A;  2Y8K A;  3PHM A;  4QGN A;  2MEV 2;  4JKL A;  4BQX A;  1AF9 A;  4LKE A;  4P9W A;  5FUI A;  1CD3 G;  2P37 A;  2YGM A;  2WSV A;  3SKJ E;  4IEV A;  1HV0 A;  5FPZ A;  1LKN A;  4N7I A;  4PHZ A;  1BYH A;  3VZO A;  4YWA A;  1A8D A;  5BYN A;  4D7T A;  2WLQ A;  1G6N A;  1PK6 B;  2AUY A;  2Q1M A;  2ZAA A;  2Q8E A;  4CTE A;  5EYY A;  2C1F A;  4ZXE A;  1LOG A;  1OQ1 A;  3ROU A;  4CUG A;  4I02 A;  3MIG A;  1JOD A;  1K5J A;  1Q8P A;  1X8M A;  1F5F A;  1MEC 1;  2BGP A;  3LOI A;  3FBY A;  5DZE A;  1PO2 1;  1BVP 1;  5L9B A;  3ZSE A;  2QQK A;  2A6X A;  2VZ1 A;  4IQP A;  4LE4 A;  5H9P A;  3PME A;  4RR3 C;  3SCH A;  3ZXL A;  1CZT A;  1ASJ 1;  2R0H A;  4N53 A;  4A3Z A;  3MUZ 1;  4B4R A;  3WV6 A;  5GLU A;  5JXG A;  2HJI A;  4M0N A;  1OKO A;  4GH4 A;  4B7K A;  2HWF 2;  3ZYG A;  1QDO A;  1VB2 A;  4YG6 A;  1MR5 A;  2ZX2 A;  4KMQ A;  2OUJ A;  4LKD A;  2D3R A;  4IXL A;  3AXE A;  4XFB A;  5CYY A;  1LHU A;  3O1R A;  2CV6 A;  1PVC 2;  2FBE A;  2W94 A;  5GAL A;  2JDY A;  2WNO A;  2DBN A;  1PIV 2;  4GJZ A;  4HFS A;  3GGL A;  2J42 A;  3B3Q E;  4XIL A;  3SH3 A;  3GJB A;  1SEF A;  4MX3 A;  4E4H A;  1EY2 A;  2Y0O A;  4MGK E;  4EZ4 A;  1UF2 C;  2WQ4 A;  3WNN A;  1YYN A;  4AR2 A;  4IEX A;  2NN8 A;  4L11 A;  2RV9 A;  2GND A;  4XDP A;  2CHH A;  2J1U A;  1S1A A;  4Y1V A;  2B46 X;  1PIV 3;  3UET A;  2Y38 A;  2E33 A;  3CIH A;  3T4H B;  3CMG A;  2IFW A;  1BXH A;  1C8M 2;  3IB3 A;  4PDW A;  4BK4 A;  2Q0A A;  3M3I A;  2JEC A;  3IAQ A;  3LGR A;  4HG6 B;  1CAX B;  1L7R A;  3QBQ A;  5EWS A;  4RGG A;  1XND A;  3SH4 A;  4URA A;  3N4M A;  3U07 A;  1RJ8 A;  3MF6 A;  3R05 A;  1BBT 3;  3O0V A;  1NLQ A;  3W5M A;  3UK9 A;  5CBL A;  4AAX A;  4BCU A;  1Y3T A;  2GNB A;  5K0U A;  1XNT A;  5DPN A;  1QXR A;  1WMF A;  4BQ4 A;  4EWE A;  5L7O B;  1UZV A;  4CU8 A;  3NVC A;  4QQO A;  3P1I A;  2DUR A;  1H8T B;  2JB4 A;  2VUL A;  2FDJ A;  3KT4 A;  3WUC A;  4V2W A;  4FFG A;  4QXB A;  4B29 A;  4XFH A;  2R04 3;  1BJQ A;  2ZGQ A;  4FPO B;  4WM7 C;  2ADD A;  5FPA A;  4DNY A;  4I0W B;  4HMZ A;  2V4V A;  2LS6 A;  1HRV 3;  1WME A;  2CAU A;  1XSQ A;  4HLT A;  1AYN 1;  5KC6 A;  5JZG A;  3PIJ A;  1W05 A;  1OFS A;  4N8M A;  3RSJ A;  5L7O C;  2L9L A;  1OSG A;  3AMQ A;  3UT0 A;  4HSJ A;  4TWT A;  5F2W A;  1EP0 A;  1H8T C;  2EXH A;  1UZ0 A;  2QQP A;  3PLQ A;  4CEW B;  1AR9 1;  1XE0 A;  4IE0 A;  1WBL A;  4YVS A;  3HR9 A;  3M3C A;  3G6J B;  5CKM A;  4BU2 A;  4AQ2 A;  4P14 A;  2ZX4 A;  4UW6 A;  2J1S A;  5CU1 A;  1ZM1 A;  1GKB A;  4GMP 1;  1JYW A;  3I97 A;  1MS4 A;  2C5D A;  3O1P A;  4JV4 A;  4WVM B;  2ZS6 B;  2YG0 A;  4PIY A;  5IYY A;  3LA3 A;  1SPP A;  5DAW A;  4HON A;  5FZG A;  4ZZ5 A;  4AED A;  1QJX 2;  4BYY A;  4A3X A;  1RUO A;  4LIT A;  4PLN A;  4KWU A;  3WDU A;  3KCY A;  1IS6 A;  5DDJ 2;  1GP4 A;  2GAU A;  3J7M A;  3QCW A;  1ZNP A;  1NCQ C;  2ARA A;  3ZPY A;  5BNO B;  3ZIX A;  1NCR A;  4JGZ A;  4XMI A;  3WF3 A;  1W9W A;  2GU9 A;  4IEY A;  1LHW A;  3O1S A;  4FTE A;  4XMA A;  4JQT A;  1H6Y A;  2XUE A;  1XYN A;  2X29 A;  4UFI A;  4I0A A;  3SC7 X;  1XE8 A;  4XPV A;  1BQP A;  4IV1 C;  5EHD A;  2QUO A;  3MV1 1;  1GV9 A;  3TRS B;  3C7G A;  1J1L A;  1KFX L;  2E9Q A;  1JXN A;  2VGD A;  3N9P A;  4Q4X 2;  2XHK A;  1BMV 1;  4QHZ A;  5FPV A;  1CZS A;  2VMG A;  3U10 A;  1Q5O A;  5GZG A;  4ASM B;  2HWC 1;  5A3P A;  5KXE A;  4EWA A;  4XJU A;  5FY9 A;  4KBB A;  4YGE A;  1VRB A;  2BJS A;  1LHO A;  5BNQ A;  4OI2 A;  1GQG A;  3ME2 A;  4XFF A;  3RFR A;  2VVF A;  3UJO A;  3B9C A;  3ZFG C;  4K7J A;  1ND3 B;  1QQP 3;  2KXL A;  1UOG A;  4JGY B;  3T08 A;  1AL2 3;  3C7E A;  3WCS A;  1VMH A;  2X8K A;  5D2A A;  2YFZ A;  5FZ1 A;  4IND A;  4AAP A;  4ATF A;  2DCZ A;  1O6U A;  2KR2 A;  4NAO A;  2ID4 A;  1NLR A;  4QQH A;  2WFF 1;  3IMN A;  4DUX A;  1GLH A;  3B93 A;  1ZBE 2;  1S2K A;  4GKX A;  5FWE A;  3WG3 A;  4NUB A;  3GM8 A;  3Q8B A;  1C5H A;  2OQ7 A;  1PMH X;  1W39 A;  1O3Q A;  1OH3 A;  3DV8 A;  2MEV 1;  2W47 A;  3CJI C;  2C0Z A;  4DS0 A;  1DQ5 A;  5F32 A;  5IVE A;  1RIN A;  4PDW C;  3CEW A;  4GH4 B;  4FAG A;  3F95 A;  4UWD A;  5DAX A;  1ENX A;  3PIG A;  2Y6K A;  2XR4 A;  1J3R A;  5FAX A;  5F5A A;  1CN1 A;  5T50 A;  4AI1 A;  2R1B A;  5JR7 B;  4UW4 A;  4FTB A;  2WA3 A;  4YVW B;  1YJL A;  1AYM 1;  4Q0V A;  5C7G A;  3TEZ A;  2Z69 A;  3QLQ A;  5IW0 A;  3NST A;  3UES A;  3KZ4 C;  4MGZ E;  2A3X A;  3N35 A;  4A45 A;  4C8D A;  1TNF A;  4AYU A;  4HL0 A;  1X8E A;  1IPS A;  4F83 A;  1OLM E;  1GZC A;  2XWB B;  3OF1 A;  4HVR A;  3VHO A;  4CDU C;  2VMH A;  3MIH A;  2J1E A;  4KG8 A;  2P3J A;  5CEH A;  1B35 B;  4RGK A;  3H1Y A;  1Q56 A;  5JMC A;  2XGX A;  3LZZ A;  4HKW A;  1O5U A;  1UZY A;  2VXJ A;  3I3Q A;  1YFW A;  2A73 B;  2VCA A;  3KQR A;  1ZRF A;  4E27 A;  3LEM A;  3J26 N;  1N1S A;  5IAT A;  1OUX A;  1VBB 3;  2JD4 A;  3KCC A;  2WYF A;  1D4V B;  4K8R B;  4XFA A;  3U78 A;  4AHW A;  1COV 2;  1X33 A;  4FPK A;  3MO4 A;  4QAW A;  2AGS A;  5HV4 A;  1KJR A;  2IVI B;  2XJT A;  4N43 B;  3LSD A;  1ENR A;  4XTM A;  2UY9 A;  3B69 A;  5KC5 A;  4E2Q A;  4QX7 A;  5A6Q A;  1QOS A;  1W6M B;  2VOV A;  1YUD A;  5DDJ 3;  1S0I A;  1URX A;  3NV4 A;  3PTY A;  5HPO A;  2EXI A;  3MIC A;  3D3A A;  3HMY A;  4LBQ A;  1OA4 A;  1OKQ A;  4QX0 A;  4LO4 B;  1XPW A;  2E32 A;  2W52 A;  3K3O A;  4CUA A;  1J84 A;  3POI A;  4NWV A;  2BGO A;  4ZHN A;  3UGG A;  2BP6 A;  3FLP A;  4QB2 A;  1QWR A;  1X9T A;  5BNN C;  3PTR B;  2VJX A;  4IW3 A;  3PUA A;  5L73 A;  4FFF A;  2PA7 A;  4PCR A;  1CGP A;  5FY5 A;  2B9V A;  4CCE A;  5BXX A;  4OMD A;  4QD2 A;  5LY2 A;  5HBA A;  1HIX A;  1UXX X;  4LHK A;  1W9F A;  3BCW A;  3RYP A;  4AVV A;  3OCP A;  3SCF A;  3WP3 A;  3GZA A;  5CFC B;  2BGC A;  4BDV B;  4LIU A;  2BYV E;  5E88 A;  4YZ1 A;  1C4R A;  5HV0 A;  1UOJ A;  1UYY A;  3DN7 A;  1LEM A;  1ZZ8 A;  1U5X A;  3IDA A;  4TTG A;  2VW0 A;  3D8C A;  4Q5O A;  3ILF A;  5F1R A;  1UWW A;  5FIX A;  1MZF A;  2ARX A;  3LIG A;  4HZF A;  4UW5 A;  4W4Z A;  4B1L A;  2VNR A;  3I7D A;  4YW7 A;  3WOG A;  4Y20 A;  4AE2 A;  4XTP A;  3KT1 A;  3K75 B;  3I2F A;  4R9D A;  4C1W A;  2EAL A;  3DYM A;  3JZV A;  4Y26 A;  1O8P A;  1LOB A;  3MGU A;  2GH8 A;  1OHF A;  3I2H A;  4B1M A;  4MZU A;  5T5P A;  3BOP A;  1YJK A;  2JDM A;  2WL1 A;  2R0F A;  1OXC A;  5FRE A;  3IPV A;  3VBH A;  5FP8 A;  5J09 A;  1QU0 A;  2HWB 3;  3R4U A;  1M06 G;  1A8M A;  1VPH A;  2VQ0 A;  2W0X A;  4CE8 A;  1SHW B;  2VZV A;  5JLV A;  3ZO0 B;  4LUL A;  1MS5 A;  3EXU A;  5LBF A;  3KCX A;  3PVB B;  5FZ0 A;  1PGL 1;  3RYR A;  3BU7 A;  1ZBA 2;  4ISQ A;  3IN9 A;  1FMD 3;  1TME 1;  1ULO A;  4AHX A;  1WW7 A;  4KWL A;  4YW6 A;  1O91 A;  4QDR A;  2QQJ A;  3HD8 B;  4ERO A;  5CB7 A;  1YFU A;  3J4U H;  1QJZ A;  5JWP A;  3NJY A;  4QM8 A;  1KFU L;  4JVA A;  4AXO A;  4B3N A;  1PNG A;  1R1A 1;  2D6O X;  2YRO A;  5FXW A;  4EN6 B;  2AC1 A;  3OUI A;  5T52 A;  5J1X A;  1E5I A;  2R04 2;  3X29 B;  2B7Y A;  1WUV A;  4NE9 A;  5CG9 A;  5K0U C;  3NL1 A;  3RMY A;  4A4A A;  1CAV B;  3M2M A;  3LPF A;  3SCG A;  2QVS B;  3CU7 A;  4QKB A;  3V56 A;  1ND3 C;  4BE3 A;  3UJQ A;  1JHN A;  1LEC A;  1UX7 A;  1H9P A;  3VBH C;  2Y33 A;  1UX6 A;  4GUL A;  1RUF 2;  3D0J A;  3POB A;  4AHY A;  4DQA A;  3NAP A;  4A6S A;  3OGV A;  4CDU A;  2WS9 1;  5GZD A;  1RUH 1;  2ZGN A;  1VRH 1;  2ZEY A;  2AEY A;  4HOO A;  2PHD A;  1H2N A;  2QQW A;  5K0U B;  3H8U A;  1QJU 3;  2BU9 A;  1J59 A;  3ZSM A;  4TYS A;  5L7O A;  2QFE A;  5B4N A;  1S55 A;  2D6M A;  3DGT A;  2F4L A;  4CRQ A;  3U0Z A;  4DO0 A;  5A3L A;  5A7Q A;  1RUG 1;  4L0P A;  1JUI A;  2XLF A;  5DG1 A;  2WYS A;  4ZU4 A;  3ALQ A;  3VBU C;  3RZH A;  3H8R A;  3VD7 A;  4MGQ A;  2V09 A;  1F31 A;  2UYA A;  2RJ2 A;  4QPI C;  4LPL A;  2OPW A;  4QU2 A;  3VZM A;  1VBC 3;  4LBN A;  1JYN A;  3OUJ A;  5J96 B;  2NPI A;  1FNZ A;  3MIE A;  2R04 1;  1JOJ A;  1RXF A;  2WBK A;  2O8Q A;  1AR6 1;  3OGJ A;  4Q4W 1;  2QQN A;  3GAL A;  1NQD A;  1SDW A;  1WMD A;  4WZC A;  5AC9 3;  4JTN A;  1AR7 1;  4UT5 A;  4QMA A;  4YVW C;  1FXZ A;  3SLI A;  3N7K A;  5F3I A;  3BKZ A;  3MF9 A;  2WNV C;  5FLI A;  1UOF A;  3JB8 A;  1K5M A;  4JKM A;  4OZX A;  3QH7 A;  3S5Q A;  2WO3 A;  2W91 A;  2ZMN A;  5T54 A;  1WA4 A;  4X8N A;  3OYW A;  2WZR 3;  3NV1 A;  3WP5 A;  3Q9O A;  2ZPX A;  3QD6 A;  4HBN A;  3LFI A;  1JS9 A;  1PK6 C;  3O12 A;  4ONU A;  3V0B B;  2B42 B;  2FMD A;  2CYF A;  3H3L A;  4ZXK A;  2WZP P;  3R0R A;  4EZH A;  1R09 1;  4P08 A;  4QGL A;  4EWD A;  4WVM A;  2DFC A;  5FZH A;  2W39 A;  3WQ0 A;  4IGP A;  1H30 A;  1SPP B;  3WQ1 A;  2MNG A;  3ACI A;  2IZW A;  2FDH A;  4LEJ A;  5FYY A;  1HLC A;  2P1B A;  4AED B;  5K4L A;  1QJY 1;  2YB7 A;  3I2O A;  3CJX A;  3IMM A;  1MPX A;  5A80 A;  3T1L A;  3OY8 A;  3Q8E A;  4CCL A;  4XUR A;  1JBC A;  3ETQ A;  4XDO A;  1UQX A;  1MS9 A;  3BI3 A;  5JSR A;  1LU1 A;  2VZO A;  5FYT A;  4QDS A;  2BTV C;  3HNM A;  3NQH A;  2A6Y A;  3CL1 A;  1V6I A;  4O9G A;  3I8T A;  5FKC A;  3WR0 A;  5JPN B;  4LBQ B;  4QX1 A;  4H55 A;  4RHV 2;  4WVW A;  5F9T A;  1W8H A;  4QQP A;  5C8C A;  3CZU A;  3SIS A;  4NHX A;  2OUH A;  5HCH A;  3LPG A;  4NIH A;  3HNB M;  2W3J A;  3AP6 A;  4HK8 A;  3WG2 A;  2JE8 A;  3OBT A;  4FPH A;  4OVE A;  1OPO A;  4LUM A;  5FZD A;  4QHO A;  2RMU 2;  3AKT A;  4RR3 A;  4CCN A;  4A7Y A;  1IKP A;  4LMF A;  2BZD A;  5FZA A;  3IDC B;  3RI9 A;  2EXJ A;  1CAU B;  1MZE A;  1RHI 2;  1US2 A;  2GDF A;  1UW8 A;  2VOX A;  5FY8 A;  1E5S A;  3NJX A;  3UV9 A;  3WSO A;  4BXF A;  5IWF A;  1T6B X;  3H3Z A;  4JHZ A;  5IK8 A;  3K2O A;  1Z7S 1;  2R06 3;  4O7X A;  2ZZQ A;  4W6X A;  1TE1 B;  3WF0 A;  3ZKY A;  2VOT A;  5FYI A;  2PLV 2;  4AFM A;  2XUM A;  2B9U A;  4D0Q A;  4YZ4 A;  1DGR A;  3OD0 A;  3S5A A;  1WLC A;  2W1Q A;  1F4H A;  2W87 A;  4XYX A;  4FTS A;  4XQ4 A;  1TME 2;  4DY3 A;  4GWN A;  3FZ3 A;  1EPW A;  1W03 A;  2QQV A;  1KEX A;  1UY3 A;  1HKD A;  2D6N A;  1I6X A;  1STM A;  3RNS A;  4XAC A;  3WG1 A;  3H9A A;  2VE1 A;  1LOC A;  2YBS A;  3ELN A;  2VVE A;  3SIT A;  4QPG C;  1VJ2 A;  5A3W A;  5F39 A;  4Z07 A;  2XPJ A;  1X36 A;  1AHS A;  3FBM A;  4BB3 A;  3VBS A;  2ATF A;  4YZ2 A;  3EO6 A;  3ZIW A;  5JSO A;  2E7A A;  1NX9 A;  5C5U A;  1RIT A;  4CUC A;  3IBM A;  2D93 A;  4MOA A;  4ES8 A;  5FOJ B;  1QOT A;  4FPL A;  1FV3 A;  3NKG A;  2ZX0 A;  4CDQ B;  3KF3 A;  3O7O A;  2R30 A;  4L8Q A;  3I2K A;  5CG8 A;  4K21 A;  4ZU7 A;  2ZJC A;  2YBP A;  1EAH 1;  5A7W B;  2EIB A;  4Q26 A;  4QT6 A;  1Z7S 3;  2R06 1;  1SLL A;  2BVV A;  2EVX A;  2IXC A;  3DXT A;  4XF3 A;  4P9Y A;  2QDR A;  4JRL A;  5FBJ A;  4EJR A;  3H7Y A;  4QGM A;  4W6W A;  2VPV A;  4XUQ A;  4V2V A;  2E51 A;  3H50 A;  1AYM 2;  1CR7 A;  1U5I A;  1RUJ 2;  3UKV A;  3SNM A;  1Y9Q A;  2E7T A;  3MW3 A;  2VU9 A;  2XQX A;  2WNE A;  3AMH A;  3T3Y A;  1MS0 A;  1RTV A;  2WZR 2;  2H6B A;  4PI0 A;  1YIP A;  3WHU A;  5KXB A;  3ZYH A;  1HDK A;  3C7F A;  4OI0 A;  4R8H A;  3FHQ A;  3WNM A;  5E6H A;  4DRR A;  1EYB A;  1UYP A;  5FYS A;  1JZ3 A;  2BWC A;  3HPN A;  1SBD A;  3INA A;  3I4I A;  3LSE A;  1T2X A;  1AL2 2;  2VMI A;  4HN1 A;  1S0C A;  1I9R A;  3BVC A;  1DP0 A;  4IGO A;  4FXG B;  4QHB A;  4IES A;  3B9I A;  3NV2 A;  5C4W C;  4DY5 A;  3AZW A;  2VVD A;  5C9A C;  4GAZ A;  2N7G A;  3KD4 A;  5DQ0 A;  3LE0 A;  2WQZ C;  4LA3 A;  1U5Z A;  2WAA A;  4Q4X 3;  4ATE A;  2CAV A;  3ZM8 A;  1QJY 3;  4CP9 A;  3WXP A;  5FZO B;  1GZ9 A;  2WWJ A;  3GYD A;  3MLJ A;  2P6H A;  3DUI A;  3PVO A;  3VHP A;  2CNA A;  1Q43 A;  3GBF A;  1K12 A;  3KS7 A;  1JYI A;  3ZXD A;  1RUC 1;  3ECQ A;  2ET1 A;  3THC A;  5GZC A;  1VRH 3;  1RUH 3;  4M4P A;  5GKA C;  5A7W A;  3ZN4 A;  1HW5 A;  2A7A A;  1POV 1;  5I91 A;  4IV1 A;  2VO5 A;  2C4X A;  2JEN A;  3AK0 A;  1KRI A;  3WW2 A;  4AVS A;  3K46 A;  4K8F A;  4QXK A;  2QKD A;  1CPN A;  2C24 A;  3CO2 A;  3WHT A;  4XUT A;  2JB8 A;  4Y1U A;  4AFA A;  5FQ0 A;  2HWD 1;  1REF A;  1CVN A;  1UU6 A;  2LTN A;  3ZFG B;  5A32 A;  1NA1 C;  3D4K A;  4ZS3 A;  1CAW B;  2ZEW A;  3RQ0 A;  2DF7 A;  5EFU A;  1POQ A;  2W1W A;  1GOF A;  1NZC A;  2XVG A;  4EYU A;  4XZP A;  4LO7 A;  1V9U 1;  3LA7 A;  2OW4 A;  3OUH A;  5FTT C;  2VW2 A;  4Q0P A;  5CKN A;  3MFC A;  1RC6 A;  2XQR A;  4KU7 A;  5A7N A;  1QF3 A;  2IUW A;  1AXY A;  1YC6 1;  2HWE 1;  3ZDS A;  3AMN A;  3N9N A;  3VUO A;  3ZYB A;  4Z8B A;  4GD4 A;  1S4C A;  4YW4 A;  2HEV F;  1FOD 1;  4ZKT B;  1FMD 1;  1TME 3;  2GNT A;  2RG4 A;  4MVT A;  4AED C;  3HN3 A;  4IEU A;  4ORF A;  5BNP A;  1ENQ A;  1DGW A;  1NZI A;  5I0D A;  4IER A;  2P3I A;  2WO2 A;  5LA1 A;  2KD7 A;  4AEK A;  5ABJ C;  1CPM A;  3ST7 A;  4BQ2 A;  2XL7 A;  3LCP A;  4OCT A;  1DQ6 A;  1N3P A;  1Z78 A;  2XLG A;  1W2O A;  3B94 A;  1BCX A;  1UXZ A;  4J25 A;  1TMF 3;  1AJK A;  1VR3 A;  5A1F A;  5TSW A;  5C9A A;  1H2L A;  2BVB A;  3CHX A;  4FQ4 A;  4W65 A;  4LXL A;  1HRI 1;  3AKQ A;  1NY7 1;  4FPE A;  4X6Q B;  3ATG A;  3RS6 A;  1L7L A;  2PHU A;  2GC0 A;  1RUN A;  1OI6 A;  2RMU 3;  3LEI A;  1OLQ A;  3VBF B;  3WW3 A;  4D69 A;  1EPZ A;  1F5J A;  3GBW A;  4XXA A;  1LHV A;  1I1E A;  1V6K A;  4HPK A;  2DWR A;  4GJY A;  1EV1 2;  1RMU 1;  2A71 A;  5F3E A;  2Y26 A;  3FMG A;  4XAA A;  2XOM A;  1JI6 A;  1NXD 1;  3VN4 A;  2A6W A;  4OUL A;  5F7U A;  1OBN A;  3P3P A;  5IVV A;  3H8X A;  2X05 A;  1LGN A;  3WDW A;  2XVL A;  4KWK A;  1LGC A;  4OHW A;  5M0T A;  3G7D A;  1KIT A;  4CDX B;  3KV5 A;  3E5X A;  1NXM A;  3EMR A;  1FV2 A;  3AYE A;  3NNM A;  4XJ8 A;  5FKB A;  4FOQ A;  3I2I A;  5E16 A;  2P34 A;  2WWU A;  2VW1 A;  3PVN A;  2A3W A;  1XNB A;  3R4S A;  3H3U A;  5GJ6 A;  5DDJ 1;  1HN0 A;  5C8C C;  4Z1V A;  2YY1 A;  4IV3 B;  4UFM A;  1DU3 D;  3ZFF B;  1OOP A;  2QQO A;  1IS5 A;  3W20 A;  4E8C A;  5HI0 A;  2RDN A;  3ZVX A;  2VH9 A;  5JZG C;  3WD5 A;  1R08 1;  5F8P A;  5JI7 A;  4SLI A;  3TB0 A;  2FDF A;  5AVA A;  5F2S A;  1DYO A;  2J7M A;  3MW4 A;  1G8W A;  5A7P A;  3AYC A;  2GC2 A;  4QQL A;  2DDU A;  5GLZ A;  5A3M A;  1JOB A;  2PAK A;  4CPB D;  1VAM A;  4RHV 3;  5HCA A;  1NCR B;  4JGZ B;  1QKQ A;  2O8O A;  4Z82 A;  3VLB B;  5FY1 A;  4Y1X A;  4BHP A;  4JCK A;  4XZU G;  4AI9 A;  2O1Q A;  2RS1 1;  2PHX A;  1YQ6 A;  4NRM A;  4HVO A;  2CGP A;  5EIY B;  3LD8 A;  4N7U A;  2XJU A;  1TQ5 A;  2SLI A;  4PF5 A;  3PMS A;  3VKN A;  3K3N A;  1JZ8 A;  2LUW A;  4R9B A;  1PZ9 A;  4QKN A;  2J1A A;  5CVR A;  1OD3 A;  1W0N A;  1GNZ A;  3POF A;  3WDX A;  2MHF A;  3KV9 A;  1LED A;  5D1I A;  4BQ5 A;  1GUI A;  3GBG A;  1OVP A;  1N1T A;  2R06 2;  2VD7 A;  1PMJ X;  2VCC A;  2Y34 A;  3PU8 A;  1J3P A;  5FCC A;  4FSJ A;  1XYP A;  5FJH A;  4CXX A;  4LK6 A;  2GSY A;  1DBN A;  2RS3 3;  3I59 A;  4GMP 0;  5IAV A;  2Y6G A;  4KH9 A;  2WSU A;  4NHK A;  2ZHM A;  1R08 2;  3IZO A;  3QH6 A;  3GF6 A;  2RDS A;  3MPB A;  4YW3 A;  4Q27 A;  2BOI A;  3A0N A;  3ACL A;  4NHM A;  2HWB 1;  2XB6 C;  4ZY9 A;  1H2K A;  3DEC A;  1QY4 A;  1J58 A;  2I74 A;  5GM0 A;  5IK4 A;  1BKZ A;  5EJ1 B;  1IPK A;  2RS1 2;  3LIH A;  2KA3 A;  2WII B;  3ZN5 A;  5JSP A;  1C8N A;  4NR1 A;  3RPQ A;  1AL0 G;  4CCJ A;  1CWP A;  1ZZC A;  5G05 L;  1LAJ A;  4D3W A;  4IV1 B;  3HJR A;  3D82 A;  2W1U A;  5K8S A;  2ZHN A;  1H8T A;  3NRU A;  4CSW A;  4Z2W A;  2IVJ A;  2PHR A;  3EHK A;  3HT2 A;  3PUH A;  1LOF A;  5FFO C;  3AKS A;  3A4U A;  1W6P A;  2BNN A;  4WM8 B;  5FXX A;  5DZF A;  2NZ9 A;  4AGG A;  2ARE A;  1O59 A;  1V70 A;  4CEY B;  5C5T A;  2ZGU A;  3AP5 A;  2P3K A;  1NLS A;  4KL1 A;  3ZXJ A;  3WY6 A;  1WD4 A;  1SBF A;  3HBK A;  2PAE A;  1LRH A;  3JB4 C;  3WF1 A;  1CON A;  4WVZ A;  4RR3 B;  4QDQ A;  2F17 A;  3I3B A;  4O65 A;  1YFX A;  1UN1 A;  5IJR A;  1UAI A;  4NHY A;  1JOP A;  3AJZ A;  1PX4 A;  1YXW A;  2AZ5 A;  1S0F A;  4QXC A;  1UY0 A;  4BXS V;  4EN8 B;  4FXK B;  4CEY C;  5C33 A;  2ET7 A;  4HSL A;  5EJ3 A;  4N9H A;  4I01 A;  1Q8V A;  1F35 A;  3ZYI B;  1W9S A;  3T0A A;  3MZH A;  2PEL A;  1OD5 A;  5FYZ A;  2AEZ A;  2LM3 A;  1UMI A;  4OFG A;  3POS A;  4JDO A;  3SQO A;  2WNU B;  2JIJ A;  4N90 A;  1XNC A;  1HRI 3;  4BLI A;  1HB3 A;  2ZA9 A;  4ET7 A;  4Y33 A;  4CDW C;  3SH5 A;  2ZCW A;  2X5I C;  4GWM A;  4HET A;  4W6Y A;  5I0U A;  4CXW A;  2KM2 A;  3AFG A;  5JPM B;  5AVP A;  5FY7 A;  1UL9 A;  1E5H A;  4AK3 A;  3GZU C;  4LO5 B;  5F5C A;  1FAT A;  3VDD B;  1W6P B;  4D8M A;  4RHV 1;  3N9L A;  5GLT A;  2JE7 A;  3VBO A;  5IVF A;  3K4D A;  3MIB A;  1HRI 2;  3LDK A;  5IK5 A;  1HB4 A;  3N9O A;  3T0B A;  3KF5 A;  3T2T A;  3I3E A;  2A70 A;  2XBO 2;  3MYX A;  3RDI A;  5CAD A;  5T3N A;  4AVT A;  3HWJ A;  2YMZ A;  1IOA A;  4XDQ A;  4NPM A;  1XQN A;  2JKX A;  1AYN 3;  1C28 A;  1FOD 3;  3ACH A;  4MXW A;  1P8J A;  2JG9 C;  2V72 A;  3KT7 A;  1HRV 1;  1Z7S 2;  4ARY A;  4EN7 B;  4GXL A;  1Y4W A;  5FZ6 A;  4XF1 A;  1BK0 A;  4AQS A;  4FQZ A;  4BPZ A;  4L2N A;  1H2M A;  5FZO A;  1SFN A;  5A1L A;  2WFP A;  3NMB A;  2P5B A;  3KV6 A;  1E5R A;  3APB A;  3RMX A;  2RDQ A;  4KGG A;  4OZO A;  4DXT A;  1Y9G A;  4Z92 B;  2YC0 A;  1GFF 2;  1OOP B;  2HLE A;  3M4F A;  1WMX A;  4IET A;  5FMO S;  5FO8 B;  2ZGO A;  5HCB A;  1PO1 2;  2WO7 A;  2OT7 A;  3USU A;  1IHM A;  1RMU 3;  2DVF A;  1ZZ6 A;  2AEN A;  4COV A;  1C3H A;  2BPA 2;  4YZ3 A;  1LJ7 A;  3TAY A;  4M3C E;  5FMB A;  3QAC A;  1RUC 3;  1AXZ A;  3UYJ A;  5BNN B;  2X09 A;  4GIQ A;  5EP9 A;  1ULG A;  2WT0 A;  3AJY A;  1C1F A;  3OGG A;  2PQS A;  4LNV A;  4YM1 A;  2YGL A;  1AL2 1;  3KHC A;  3HAG A;  5CIR A;  3ZR6 A;  2GP3 A;  5FUP A;  3B01 A;  3DKW A;  3POY A;  1RB8 G;  4R4Z A;  5GZF A;  4UFH A;  5IHR A;  4NRO A;  3PUI A;  2UWA A;  1PGW 1;  4YM3 A;  3UL2 A;  1LHN A;  3E5Q A;  4HKO A;  4QX8 A;  2HKX A;  4XF0 A;  4YW5 A;  4YFW A;  3JUU A;  2B39 A;  1ENS A;  5H9R A;  3K77 A;  3AB0 A;  1MZ5 A;  4P9L A;  4AI0 A;  2RVA A;  5A32 B;  1VAK A;  4YSF A;  2D7F A;  1EUU A;  3VD5 A;  3VKO A;  1BBT 1;  1SLA A;  1TZO A;  3WVJ A;  1G9B A;  4AHZ A;  1IGO A;  2PYT A;  2ZAC A;  3H1M A;  4JAA A;  1XSR A;  3ZKU A;  3MPP G;  1EUT A;  4KWJ A;  1TVG A;  5LRR A;  4NHL A;  1ZBE 1;  3O1O A;  2Q5T A;  3ZYR A;  1XBF A;  5JXJ A;  2RMU 1;  3BOW A;  3I2D A;  3AP7 A;  4L92 A;  1L3J A;  5FYH A;  4D6S A;  4YAR A;  4O9E A;  4HK9 A;  4UI9 L;  1V9U 3;  1Z0H A;  1RVF 2;  4OUE A;  4QB6 A;  2UWC A;  1OLR A;  3ZYJ B;  1W6M A;  1OVS A;  5A7S A;  3DYP A;  1WCS A;  1AR7 2;  4A42 A;  2O14 A;  1ZVF A;  3BPS A;  3UKN A;  3WUD A;  5JOW A;  5JUV A;  2HWD 3;  1JYX A;  1TMF 1;  1LOD A;  3O0W A;  3ACG A;  4XHB A;  2Y6F A;  4CUB A;  2F6B A;  3ZSL A;  1S2B A;  4CEY A;  1F8V A;  1WBF A;  5A7O A;  3RWK X;  5JDB A;  1BEV 1;  4KGQ A;  1SFY A;  3JD7 2;  4GB3 3;  1AR9 3;  3VZK A;  2QZ2 A;  4QU1 A;  1XB9 A;  4L97 A;  3NNG A;  5FMO L;  3BIW E;  2VNO A;  4AQ6 A;  2PXJ A;  3O1T A;  2VEC A;  1A6C A;  2WT2 A;  4CDX A;  4Y22 A;  2D44 A;  4GWJ A;  1LCL A;  2QTW B;  5FOB B;  3FJS A;  1G7Y A;  2XL9 A;  5A70 A;  5C3P A;  2WZ8 A;  1NE4 A;  4JZR A;  2OII A;  4QXH A;  1W2T A;  2OX0 A;  1XXN A;  2VCB A;  3URF A;  1PO2 3;  2VUJ A;  1VBA 3;  4AEM A;  2HWE 3;  2QE3 A;  1G9F A;  3POG A;  4NN0 A;  4Z2A A;  1SQ4 A;  1WZX A;  2IXK A;  2VQT A;  3AKP A;  1VMF A;  1Y7B A;  1UNB A;  3B00 A;  3IT8 A;  4HPK B;  4NOT A;  1MAC A;  1DQ0 A;  1MQT A;  4XBL A;  2PQQ A;  5IVB A;  2J22 A;  5DN2 A;  1EV1 3;  1R1A 2;  3BGA A;  2OS2 A;  4OMC A;  3KB5 A;  3ZXG A;  4Y4Y A;  3V0A B;  4CP1 A;  2HEW F;  3CJI A;  3WIN E;  5CFD B;  1GZT A;  4KG0 A;  2QBX A;  2UY8 A;  1VBB 2;  1PO2 2;  2WNU A;  5JOX A;  3NKT A;  1SLB A;  4S2G A;  4MLO A;  1WCD J;  3ZYP A;  3CZJ A;  4J1W A;  2IXL A;  4XFC A;  1FPN 2;  4CDU B;  2HBU A;  3VZL A;  1POV 3;  5BUV A;  1QJF A;  1Q8O A;  5FO7 B;  5LBE A;  4EN9 B;  1W0O A;  4EN0 A;  1BVV A;  4H3W A;  1ZRD A;  1H9W A;  4XBQ A;  4U36 A;  3E6D A;  5CFD C;  2PHW A;  3VD3 A;  3WP6 A;  4E8D A;  1W2N A;  2QCS B;  1PIV 1;  3KQ4 B;  3MBW A;  1GMM A;  3FHA A;  1GIC A;  3WG4 A;  2XON A;  2VAU A;  4TLG A;  2VZQ A;  5JXH A;  5J7M A;  4H14 A;  3VB9 A;  1ND3 A;  1S0B A;  5LA0 A;  3WW4 A;  5DUX A;  4MXW B;  4MGT A;  3LB9 A;  5A1A A;  3AZX A;  2QZ3 A;  4C90 A;  5KR7 A;  2JE9 A;  1K3I A;  1PGS A;  3AZY A;  4DXS A;  2BBA A;  3K4A A;  1GP5 A;  4IDZ A;  4LOT A;  1OT5 A;  1AX2 A;  4URT A;  5BNP C;  2ZKL A;  5LAS A;  4Y5Z 0;  3VDC A;  1NT0 A;  2ZOE B;  4P9G A;  2HBT A;  3ZMN A;  3C7H A;  3CJI B;  2JG8 C;  5CFD A;  4KQ7 A;  1OOP C;  1FMD 2;  4E4S A;  2BNM A;  4M3C A;  2JDN A;  5EXO A;  1Q8Q A;  2B8M A;  4FFH A;  2R16 A;  1LUL A;  1OF3 A;  5D21 A;  4CP2 A;  2NMN A;  3KGL A;  3EYP A;  2P17 A;  1LGB A;  3JQW A;  1MEC 3;  4XUN A;  1EV1 1;  1DZT A;  1TNR A;  3FLT A;  4LHL A;  4LIV A;  4QPI A;  5EPA A;  3USU B;  5AC9 1;  1SG3 A;  4FVV A;  1EAH 3;  1DGW X;  5ANN A;  2MPF A;  5C3S A;  2X53 S;  2V5Y A;  2WNU C;  3P5B A;  1OA3 A;  3AZZ A;  3ES4 A;  5CAZ A;  3I59 B;  1GYK A;  1NA1 A;  2FZ1 A;  5LZ6 A;  2JG8 B;  1RUF 3;  4HXC A;  3RZZ A;  1NOV A;  4OLL A;  4P02 B;  3ENR A;  1H8V A;  2VZS A;  3RRD A;  4COZ A;  2E26 A;  4IEQ A;  3W59 A;  1C8M 3;  2A5Z A;  3T2P A;  4BLJ A;  2PFW A;  5FO9 B;  1BZW A;  3WCR A;  3AL6 A;  1LNS A;  4OI4 A;  2QQI A;  4GB3 1;  1WLT A;  3OPT A;  4Q8K A;  1PMI A;  4I0B A;  2WS9 3;  2HEY F;  3FUO A;  1KXG A;  1UZW A;  2E6V A;  5FPB A;  4RA0 A;  1UYX A;  1POV 0;  4B4Q A;  1LTE A;  1OH4 A;  4MH0 E;  4Q0Q A;  4WZF A;  4XXP A;  5GZE A;  3U1X A;  3U4S A;  4QM9 A;  4DIN B;  2DUQ A;  2WT1 A;  4XF4 A;  3ZYF A;  2JDU A;  1OFN A;  3RVH A;  2XXZ A;  1ZZ9 A;  1UCX A;  1R09 2;  3L9J T;  4IUG A;  4K1Z A;  4XHX A;  2IXH A;  3M3O A;  3VBS C;  1PVC 1;  1YCI A;  1DG6 A;  2E7Q A;  2DCT A;  1X82 A;  3PL0 A;  5A6Z A;  1K42 A;  1VAV A;  1YRZ A;  4TSV A;  4AGV A;  4YM0 A;  3MHZ A;  3OG2 A;  1QNW A;  4MHR A;  1KS5 A;  3POW A;  5DAB A;  3BU0 A;  1DZQ A;  3E6B A;  1R09 3;  3WNO A;  3IM0 A;  2HWF 3;  4DXZ A;  2VTX A;  3ZDV A;  4K20 A;  4R9C A;  4MXV A;  5FBZ A;  3OBA A;  2Q30 A;  2ETE A;  4HAN A;  2YBK A;  1QXP A;  2OVU A;  4DUW A;  3N3H A;  1JYC A;  4NPR A;  1FPN 3;  4CDQ C;  3NJV A;  1REE A;  3M7A A;  1VBD 2;  1VB4 A;  1F9K A;  2D40 A;  1AR7 3;  4UYB A;  2JJ6 A;  4ITC A;  3WQB A;  4AZZ A;  4E4D X;  4RSU A;  4V1P A;  2CDP A;  5BNO C;  1VBC 2;  2AAC A;  2JXA A;  3NW4 A;  3MFA A;  2ERF A;  1FX5 A;  2PHL A;  1AR8 1;  4WM7 A;  1PVX A;  1YQ5 A;  3J8F 3;  5C4W A;  4XUP A;  4NJ4 A;  3E5U A;  4XQW A;  2BQP A;  1GOH A;  2VOK A;  5I8T A;  2FD8 A;  2DTY A;  3LDB A;  4Y20 B;  1XU2 A;  2D97 A;  1O4T A;  1YEW A;  1ZA7 A;  2PHF A;  3AYD A;  3PDQ A;  3KHB A;  1QXJ A;  3KLS A;  1N1Y A;  3MDP A;  5FWJ A;  5GLV A;  4B7E A;  5IUQ A;  1CZV A;  3IDB B;  2VOW A;  3BB6 A;  4XC9 A;  2V4A A;  4YM2 A;  4XCB A;  2WZR 1;  2EIC A;  4MO3 M;  4R9A A;  4D6R A;  4LHS A;  4Q4W 2;  4LO6 B;  4AOC A;  4BZ4 A;  4XJZ A;  2WNV B;  1ULC A;  4DRV A;  1AR6 2;  3ZXK A;  2J1T A;  3DPR B;  3R4D B;  3D5O A;  4GKY A;  5FYU A;  4YGD A;  3WNX A;  1W6Q B;  3OPZ A;  3ZFE B;  5ABJ A;  3KVA A;  2VZU A;  3NJZ A;  4HN0 A;  1CIW A;  3IAP A;  4NVP A;  4DZG A;  1PM4 A;  1VMJ A;  2BUK A;  2D6L X;  2W9X A;  3JXS A;  4XAE A;  4AFC A;  4YZ5 A;  1VBD 3;  4IE4 A;  4K6B A;  1AR6 3;  1UO9 A;  4Q4W 3;  3TOJ A;  3A7Q A;  4C91 A;  5C71 A;  4QB1 A;  5K9Y A;  3OJB A;  1VBC 1;  4UXA A;  1RUE 3;  2D3S A;  4FPY A;  1QQP 2;  5LRS A;  4GQ7 A;  1OUR A;  2GMP A;  4ISR A;  5FP3 A;  3GXU A;  1E57 A;  4AF9 A;  1RUG 3;  3PUS A;  4FT8 A;  1YI7 A;  4R4X A;  3ZFE C;  1JW6 A;  5BY5 A;  2BDR A;  1CAV A;  1CJP A;  1RYY A;  2K46 A;  2ZGK A;  3PJQ A;  5FV3 A;  5L9V A;  4H7M A;  1QJU 1;  2ENR A;  5E1R A;  2VZR A;  3C3V A;  4GH4 C;  2VUA A;  5HXM A;  4XF9 A;  2OA2 A;  4KI5 M;  2ES3 A;  4P9J A;  2JX9 A;  2W95 A;  2ZGL A;  4JTO A;  4P5Y A;  3JBG 3;  2OXB A;  4LO8 A;  4YLZ A;  3OOX A;  4BME A;  1DCS A;  4LLF A;  2RM2 2;  4KNC A;  3HVD A;  4BQ3 A;  5A33 B;  1W8W A;  4BA6 A;  3DKQ A;  3PVE A;  4K40 A;  2EA7 A;  4DEQ A;  4Q4Y 1;  4CDW B;  1RUD 1;  3FE5 A;  5LW9 A;  2HWC 2;  3U37 A;  2R07 1;  4JHT A;  4ZS2 A;  1K5M C;  2JIC A;  2W92 A;  4DEV A;  4XE9 A;  4YFZ A;  3FN9 A;  4AEJ A;  2BRT A;  1AYM 3;  3IIA A;  3O14 A;  3AL5 A;  1ZRE A;  5ABJ B;  2FMY A;  5I8Y A;  2DVB A;  1HXS 2;  1PK6 A;  2HYK A;  5GLW A;  1PO1 3;  4M01 A;  5DUU A;  3M1H A;  5ACA 1;  5FPU A;  1Y43 B;  3LOB A;  2WRA A;  4LQR A;  1QMJ A;  1PHM A;  4UBH A;  3O1M A;  5FY4 A;  4I30 A;  3VD4 A;  4AWD A;  1T6G C;  3I49 A;  3DEM A;  4PDW B;  1YI9 A;  1G9A A;  2CDO A;  3KSC A;  1RUG 2;  5DUV A;  5F5Q A;  4AFD A;  2VNV A;  1AR8 2;  3HIF A;  5D8A B;  5FDB A;  1NYW A;  1OQE A;  1US3 A;  3NNF A;  4OQ9 A;  2ZGR A;  3H1W A;  1V0A A;  4QPG B;  2Y60 A;  5FZB A;  1G86 A;  4LHN A;  2GN7 A;  5KHH A;  5LCW L;  2DFB A;  1N3O A;  4Y22 B;  3AX4 A;  3ZFG A;  4A6O A;  2ZGT A;  1W9T A;  1RJ7 A;  4IE7 A;  4IEP A;  1SAC A;  1IZ3 A;  3PNA A;  2RM2 3;  4W8J A;  3RZL A;  4PJY A;  2ADE A;  2DCY A;  3AVR A;  1CX4 A;  3N7L A;  4XBN A;  4M0H A;  2Y6L A;  4AL9 A;  4B8E A;  3ZSJ A;  3CLP A;  1WW5 A;  1Y9M A;  3FC0 A;  2QQL A;  1NE6 A;  3FX3 A;  3O5S A;  4YW2 A;  4RN5 A;  5H9Q A;  5ACA 3;  3VL8 A;  2WO1 A;  1BHG A;  1YFY A;  3NO8 A;  3A23 A;  4LBQ D;  1QIQ A;  3AYA A;  5CIS A;  3V65 A;  4O61 A;  3BIE A;  3Q8A A;  4IGQ A;  2XJP A;  3RJ2 X;  4LOR A;  4Y5T A;  1YO8 A;  2W5F A;  4PT6 A;  3OBZ A;  4OHX A;  4XFG A;  5LK7 B;  1I5P A;  4JRA A;  5BNP B;  4MV2 A;  2GC1 A;  4HT1 T;  4IV3 C;  5SV5 A;  3O1U A;  2OZJ A;  1GQP A;  1RUD 3;  4IEW A;  2VL4 A;  5JIA A;  2RDR A;  3ZXA C;  4CU7 A;  1YLL A;  4I09 A;  4BOW A;  3HN1 A;  3OD4 A;  2WZE A;  1AZD A;  2NM1 A;  4LLO A;  3MIF A;  4CEW C;  3JBG 1;  2K0G A;  1JTZ X;  1QGL A;  3LA2 A;  4BQ1 A;  1ZRR A;  5JAX A;  1PGL 2;  2ZXQ A;  5I8S A;  1Q8S A;  3MUY 1;  5D8A A;  5EYX A;  2EAA A;  2XH6 A;  2DVD A;  2Z4F A;  2TUN A;  3N7J A;  3OB8 A;  3DXU A;  4S2D A;  4QQ2 A;  3VV1 A;  1W2U A;  4FO9 A;  3IDE A;  1W3V A;  5CNA A;  1OPM A;  4RQP B;  5KHK A;  2WWS A;  5A3O A;  1RUI 3;  4F8A A;  3ILN A;  1H4G A;  2RE9 A;  3FLR A;  4LE3 A;  3N9Q A;  2RS1 3;  1RUE 1;  5C8W A;  5CFC C;  2MEV 3;  1B09 A;  5KHJ A;  2OQ6 A;  3PUQ A;  4UBG A;  1WW6 A;  2ZX3 A;  4FI9 A;  1TMF 2;  4PIX A;  1IQA A;  1VBB 1;  4PI2 A;  2H0V A;  1OLM A;  4FP2 A;  4UFK A;  4JX0 A;  2YUE A;  4XVH A;  4RQP C;  2E31 A;  3CDZ B;  3BAL A;  5FZ8 A;  3BUC A;  1D0H A;  2WS9 2;  1JU4 A;  1G9C A;  4OQ8 A;  1S0G A;  1R64 A;  4BIO A;  3JU9 A;  2VBB A;  3RG0 A;  2JD9 A;  3O1V A;  4UW3 A;  5I0S A;  5FYC A;  2G9Z A;  1GNH A;  3DPR A;  5AFB A;  4M3C F;  2WN3 A;  1HXS 3;  4TLF A;  3ZFE A;  4BQW A;  1BBT 2;  2Z42 A;  3T30 A;  1S0D A;  4G9S B;  4TZD A;  1KQR A;  1U5Y A;  2YZ4 A;  3E97 A;  3VZJ A;  4CA9 A;  1HV1 A;  4COW A;  3LKJ A;  2XVK A;  3VBO C;  3HEI A;  3SKV A;  1IS4 A;  5BNO A;  4Q4Y 2;  1V9U 2;  4UF0 B;  5DAV A;  3S30 A;  5FRA A;  4BM8 A;  1D4M 3;  3BOD A;  4RQP A;  2WIN B;  4LKF A;  3I54 A;  4I2O A;  1AR8 3;  1IG3 A;  2IFR A;  4WM8 C;  3P3N A;  1LOA A;  1RUE 2;  1JN2 P;  2BEO A;  4QPI B;  1MS1 A;  3VBR C;  3KM5 A;  1HRV 2;  3WNL A;  1VBE 3;  2FQP A;  3PUR A;  1A78 A;  2WFF 3;  1W3X A;  2WLP A;  4MGS A;  4Q0S A;  3ZPO A;  2JDK A;  3VBO B;  2PN5 A;  4Q0U A;  3TEY A;  2GAL A;  5IVY A;  3VHR A;  1KJL A;  5JXI A;  2QNK A;  1W0P A;  1SFP A;  2VUC A;  5KWR A;  1I5Z A;  3U14 A;  1RED A;  4WBB A;  5JR2 A;  1QQP 1;  1ZRI A;  3J8F 2;  4AGR A;  1J3Q A;  1AVB A;  1HQW A;  3WW1 A;  3AZV A;  2BOJ A;  4GMP 3;  1OA2 A;  2XDV A;  1SCR A;  2XJR A;  2HWE 2;  2VTF A;  2VME A;  3K4Z A;  5DXD A;  2BFU S;  2HWC 3;  2R6Q A;  3I2G A;  1VAL A;  4MG2 A;  1XE7 A;  4RFR B;  3NAP C;  3WNK A;  4RS5 C;  1KDK A;  4NWW A;  1MEC 2;  1QJX 3;  1CAX A;  2P2K A;  2QJV A;  4YGB A;  2Z2S B;  2X10 A;  2JIG A;  1EAH 2;  1GZW B;  1YQ8 A;  1W8U A;  2XKO A;  1VIW B;  3ACF A;  4X8P A;  3R6S A;  1D4M 2;  3QOP A;  2GP5 A;  1QJE A;  2ORX A;  1C5I A;  2WKK A;  5FQ0 B;  1F4A A;  1W6N B;  4NIA A;  1DGL A;  5KHG A;  1L7Q A;  1H0B A;  2RR1 1;  1ULP A;  1VBE 2;  4A7Z A;  3B7M A;  5CZK A;  4WV8 A;  3MI8 A;  4LBO A;  4D6Q A;  3FFQ A;  3PU3 A;  5FZ9 A;  4N43 A;  3GHN A;  1U0A A;  2DUO A;  5FZF A;  2ARC A;  1NQJ A;  3WLU A;  4PLM A;  4ZPI A;  3PJY A;  4DUV A;  3C7O A;  4WM8 A;  3T4V A;  4BIS A;  3A0K A;  2C9K A;  1H4H A;  1DYP A;  2GH2 A;  1NY7 2;  2AH2 A;  4MET A;  2GZW A;  2G9F A;  2I2S A;  4YVW A;  3OSD A;  2Z79 A;  1W8F A;  4Y1Z A;  1FI2 A;  5JZG B;  1LB2 A;  2Q8O A;  3VL9 A;  2YFU A;  2Y0I A;  2VZP A;  3H0O A;  3OPW A;  1LES A;  1MVQ A;  1PM7 A;  1UU5 A;  3HOB A;  3M70 A;  2YV8 A;  3MV0 1;  5EZW A;  3WX5 A;  3RZM A;  3LDR A;  5DG2 A;  3UGH A;  4YVS B;  2XKP A;  3N9M A;  1I3H A;  3VBU A;  2FHR A;  4MHU A;  4QPW A;  3SMH A;  2ZBJ A;  1JMU B;  4Q4V 3;  3ZN6 A;  3POJ A;  2Q1Z B;  1NG0 A; 
#chains in the Genus database with same CATH homology
 3I2J A;  2WZ8 A;  5IFP A;  2BZD A;  1US2 A;  2VCB A;  3WSO A;  3NJX A;  3FL7 A;  4JHZ A;  4Z2A A;  1W8N A;  2VQT A;  3E1F 1;  2VMD A;  1D7P M;  1IQD C;  3WF0 A;  2J22 A;  5DN2 A;  3BGA A;  2VOT A;  4W50 A;  4OMC A;  1GU3 A;  2VMF A;  4D0Q A;  2B4K A;  1XNA A;  1O8S A;  2W1S A;  2W1Q A;  2QQM A;  1F4H A;  2W87 A;  2QBX A;  4CU6 A;  1W99 A;  1TG7 A;  1KEX A;  2ORZ A;  4BK5 A;  1UY3 A;  3CZJ A;  4GWI A;  2XHN A;  1W8O A;  1DLC A;  1NKG A;  2Y8K A;  1SDD B;  3VD3 A;  4E8D A;  4JKL A;  2Y6H A;  2W46 A;  3MBW A;  5FUI A;  4A44 A;  3SKJ E;  2WAO A;  1GMM A;  1NX9 A;  3FHA A;  4CUC A;  4MOA A;  2XON A;  1PX3 A;  2VZQ A;  5JXH A;  3I2K A;  5LA0 A;  1JZ2 A;  4ZXE A;  4OYU A;  2EIB A;  5C7G A;  5A1A A;  2VM9 A;  2BGP A;  3C8X A;  1K3I A;  4DXR A;  4DXS A;  4XUQ A;  2BBA A;  3K4A A;  2QQK A;  2VZ1 A;  1OT5 A;  1CZT A;  1CIY A;  4A3Z A;  3VDC A;  2XQX A;  3MUZ 1;  3C7H A;  1UYZ A;  5JMO A;  5JXG A;  1JZ4 A;  3C7F A;  4KMQ A;  3FHQ A;  1OF3 A;  3WNM A;  1JZ3 A;  3EYP A;  3HPN A;  5CYY A;  3ABZ A;  2W94 A;  1T2X A;  4XUN A;  1DP0 A;  1SG3 A;  3GGL A;  1CX1 A;  4QX2 A;  5DQ0 A;  3LE0 A;  2C26 A;  3WNN A;  2J1V A;  2WAA A;  4P02 B;  2RV9 A;  3ZM8 A;  2VZS A;  4ARX A;  5EJZ B;  2E26 A;  2J1U A;  3UET A;  3WF4 A;  3T2P A;  2E33 A;  3CIH A;  3CMG A;  3IB3 A;  4BK4 A;  1K12 A;  1LNS A;  2QQI A;  3IAQ A;  3ECQ A;  4HG6 B;  3THC A;  1L7R A;  4M4P A;  1UYX A;  1OH4 A;  2C4X A;  2VO5 A;  4P00 B;  3K46 A;  3W5M A;  4AAX A;  4XUT A;  1XNT A;  2ZEX A;  4IUG A;  5DPN A;  1K42 A;  4CU8 A;  1OF4 A;  2ZEW A;  3P1I A;  2W1W A;  1GOF A;  3OG2 A;  3OGR A;  4GZ9 A;  1JHJ A;  3WNO A;  2V4V A;  1WKY A;  2LS6 A;  3OEB A;  3OBA A;  2VZ3 A;  2L9L A;  3HN3 A;  5LA2 A;  4DUW A;  5I0D A;  3NJV A;  2WO2 A;  5LA1 A;  5C70 A;  1UZ0 A;  2WDB A;  2KD7 A;  1J83 A;  3WF2 A;  3WQB A;  2CDP A;  2J1S A;  3SEE A;  1UXZ A;  1JYW A;  3I97 A;  4XUO A;  1XC6 A;  2YG0 A;  5IYY A;  4XUP A;  4ZZ5 A;  1GOH A;  4KWU A;  5B4X A;  4CU9 A;  3LEI A;  3WF3 A;  1CZV A;  1W9W A;  1H6Y A;  2EIC A;  4MO3 M;  2XOM A;  1JI6 A;  4LHS A;  3MV1 1;  5F7U A;  2X05 A;  2J1T A;  3P6B A;  3C7G A;  2VZU A;  3IAP A;  1CZS A;  1NUK A;  2W9X A;  3JXS A;  2LW8 A;  1KGY A;  3I2I A;  1YQ2 A;  3A7Q A;  5C71 A;  4QB1 A;  1UY2 A;  2QQO A;  3GXU A;  3T08 A;  4E8C A;  3C7E A;  2Y6J A;  1RYY A;  2YFZ A;  3T2Q A;  2VZR A;  5HXM A;  1DYO A;  2J7M A;  4DUX A;  2ID4 A;  4UAP A;  4KI5 M;  2DDU A;  2W95 A;  4P5Y A;  3GM8 A;  1PMH X;  4XZU G;  4YPJ A;  4JKK A;  2W47 A;  4DEQ A;  5EIY B;  3U37 A;  4DEV A;  2W92 A;  3FN9 A;  1JZ8 A;  3LEK A;  2J1A A;  2Y6K A;  1OD3 A;  1W0N A;  1HN1 A;  1GUI A;  3ETP A;  2VCC A;  1PMJ X;  4LQR A;  2J1R A;  3HNY M;  3VD9 A;  3UES A;  3VD4 A;  4A45 A;  2Y6G A;  5DMY A;  2HYX A;  2CDO A;  2Y64 A;  2VQU A;  2J1E A;  3T0D A;  1US3 A;  3OEA A;  4ZY9 A;  2VCA A;  3DEC A;  5LCW L;  5EJ1 B;  4A6O A;  1W9T A;  2WN2 A;  5G05 L;  3MO4 A;  4W8J A;  4QAW A;  3HJR A;  2W1U A;  2VZT A;  3NRU A;  2ZEZ A;  2Y6L A;  3PUH A;  4MAD A;  2QQL A;  4PF1 A;  4RN5 A;  4ZZ8 A;  2WAB A;  2WO1 A;  5HPO A;  1BHG A;  1O59 A;  3D3A A;  4AG4 A;  4LKS A;  3A23 A;  4QX0 A;  1XPW A;  2E32 A;  4M4R A;  4CUA A;  1J84 A;  2EIE A;  2BGO A;  2W5F A;  4PT6 A;  4QB2 A;  1I5P A;  3WF1 A;  2VJX A;  4QDQ A;  1GQP A;  3I3B A;  2VL4 A;  1WCQ A;  5IJR A;  2B9V A;  1PX4 A;  4CU7 A;  4OMD A;  1UY0 A;  3CKH A;  4BXS V;  2VMC A;  1UXX X;  3OGS A;  2WZE A;  2DCJ A;  4PQQ A;  4BDV B;  2ZXQ A;  5IFT A;  3MUY 1;  1W9S A;  3T0A A;  2Z4F A;  1UYY A;  3OB8 A;  3IDA A;  4TTG A;  1UMI A;  3T2O A;  1UWW A;  4W4Z A;  3III A;  4UOJ A;  4ET7 A;  1JZ5 A;  3K75 B;  3I2F A;  4TXW A;  3DYM A;  1O8P A;  3I2H A;  4FI9 A;  4D8M A;  3K4D A;  3WEZ A;  4JX0 A;  3T0B A;  4XVH A;  3I3E A;  2E31 A;  1SHW B;  3CDZ B;  2VZV A;  1JU4 A;  3CQO A;  3LQC A;  1JZ6 A;  1R64 A;  2YC4 A;  3J7H A;  2JD9 A;  2JKX A;  1ULO A;  3ACH A;  2WQ8 A;  1P8J A;  2WN3 A;  2V72 A;  4QDR A;  2QQJ A;  4ARY A;  3WNP A;  1K45 A;  5J1X A;  2VC9 A;  3HEI A;  3SKV A;  1JYV A;  3W5N A;  4A4A A;  3LPF A;  4OZO A;  4DXT A;  2HLE A;  3UNP A;  1UX7 A;  2VR4 A;  2R7E B;  3WNL A;  3OGV A;  4MGS A;  2ZEY A;  1NAE A;  2X09 A;  5JXI A;  5B4N A;  2PQS A;  4CVU A;  2BER A;  5JR2 A;  4L0P A;  2V5D A;  2WYS A;  3T09 A;  3VD7 A;  3VDB A;  4MGQ A;  4A41 A;  2YC2 A;  2RJ2 A;  3A22 A;  3EB7 A;  4LPL A;  5IHR A;  3VDA A;  1JYN A;  3PUI A;  2WBK A;  2JDA A;  3A21 A;  2QQN A;  2VTF A;  2VME A;  3K4Z A;  3I3D A;  3I2G A;  3GDB A;  3WNK A;  3K77 A;  5G04 L;  3AC0 A;  2RVA A;  1H6X A;  2X10 A;  2DCK A;  4JKM A;  3ACF A;  2WO3 A;  1EUU A;  2W91 A;  3VD5 A;  2ORX A;  1F4A A;  2WUH A;  1L7Q A;  1EUT A;  1JU3 A;  1TVG A;  1ULP A;  3THD A;  3DYO A;  4P08 A;  5CZK A;  5JXJ A;  4BJ0 A;  4UI9 L;  3ACI A;  3BN6 A;  2OKX A;  4OUE A;  4QB6 A;  4QX3 A;  4DUV A;  3C7O A;  1GNY A;  2YB7 A;  2C9K A;  3DYP A;  1MPX A;  4A42 A;  5JUV A;  1UY1 A;  1JZ7 A;  1JYX A;  4RYD A;  4XUR A;  3ACG A;  4CUB A;  2VZO A;  1UMH A;  2YFU A;  4QDS A;  1GOG A;  2VZP A;  3HNM A;  3NQH A;  3HOB A;  3SEP A;  3MV0 1;  1UY4 A;  3LEG A;  4QX1 A;  3CZU A;  3LPG A;  3F2Z A;  3HNB M;  2W3J A;  2JE8 A;  2EID A;  3NNG A;  4QPW A;  4GWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...