2RJ5A

B-specific alpha-1,3-galactosyltransferase g176r s235g mutant (aabb) +udp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
284
structure length
282
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title ABO(H) blood group A and B glycosyltransferases recognize substrate via specific conformational changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 282
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2007-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2rj5A00
3PNNA 3Q7UA 4M4KA 4KC1A 1S4NA 2RIZA 3V0NA 1HM8A 4KNRA 2JCLA 1TZFA 1OQMB 4HO9A 4KC2A 2WE9A 1FXOA 1WT2A 1R7UA 1WSZA 1VZTA 2OI6A 1H4EA 1K4VA 1H5SB 3USRA 1JVGA 1H7QA 1VZUA 4Y7FA 2Y6PA 4EEOA 1G8OA 5FV9A 2VS4A 4Y7GA 4EEAA 3I0DA 5J49A 2PGVA 4KXOA 5CMFX 1FWYA 2Y4KA 1OMZA 3POLA 4ASJA 1NQIB 5C8RA 4HO4A 1INJA 1HM9A 1TW1A 3DJ4A 3OH3A 1VICA 3ZLLA 4Y62A 1FOAA 1R82A 1ZJ1A 4FRPA 1PZYB 2WGZA 2OEGA 1LZ0A 4NANA 3E25A 4FREA 1VGZA 3K8EA 1QGQA 4JISA 5CQMX 3V0LA 4KNXA 3KIAA 3Q4SA 1O23B 1WT0A 1LVWA 4MNDA 2WVLA 3FWWA 1NWGB 1H4DA 5AJOA 2PA4A 3V90A 2D7IA 2YC3A 1H7HA 2OEFA 1NF5B 3PKQA 2VS5A 2O1FA 1JYLA 4MYBA 4Y63A 1MP5A 4FCUA 1KWSA 3TQDA 4EEMA 1S4PA 2OI5A 1FR8A 3SXDA 4DECA 4IRPA 2RJ7A 5C4CA 1PZTA 2A8WA 2WVMA 4Y6NA 2FY7A 3CKVA 1FXJA 5C48A 4ZDQA 5C4BA 4B5BA 5C4FA 1VGUA 4K6RA 4Y7VA 1O0RA 2YCMA 4CJBA 1O7QA 1QGSA 5CMJA 1FO8A 2FFUA 3V0PA 1H3MA 5C38A 5L6VA 2XWMA 4P02A 3OKRA 1H5SA 4M28A 4ARWA 1MP4A 5C36A 4B42A 1H5SD 2VFZA 4G87A 2VSIA 1G93A 4Y6UA 3R2WA 4XWIA 4CJCA 3IOHA 2ZU7A 1JVDA 2I7BA 2Y7AA 2VSHA 5C3DA 3OC9A 2E3DA 4EE5A 1V84A 1H5SC 3ZGFA 3I0JA 3QVBA 2WVKA 2QH5A 4C2SA 4AC3A 5HS2A 2AE7A 2P73A 5C1LA 4FRHA 3K8DA 1LL0A 4HOCA 1V82A 5FU0A 1GQ9A 1TW5A 3JTJA 1R80A 1WT1A 1HJJA 2APCA 3CKNA 1OMXA 3SXEA 2ZU9A 3LW6A 5AJNA 4LW3A 4D48A 1ZDGA 1Z90A 2O1HA 3D8VA 4BQHA 4KT7A 3V8YA 1VM8A 2RJ9A 1E5KA 1G3LA 1NHEB 3CKQA 3OH0A 1GQCA 4YS8A 1YROB 1ZIZA 1LZIA 4HG6A 1ZJPA 2RJ6A 2RITA 4KPXA 4FRDA 1GA8A 4KPZA 2V0HA 1LL2A 3OH4A 2D0JA 3I0HA 3SPTA 1NKHB 1H5TB 4JD0A 1TVYA 3D5NA 1W57A 4Y7UA 3U2VA 1VZXA 2VXMA 3BCVA 3F1YA 4EEGA 5IFYA 1ZDFA 2QKXA 4KC4A 4D0TA 2XWLA 4FRAA 2D7RA 2FYCB 1IIMA 1HJLA 3OGZA 3N9WA 1ZI3A 4HCQA 5IDSA 1WT3A 1GX0A 2YQCA 3U0YA 4NAIA 2W0WA 4EE3A 2I5EA 4FRQA 3U0XA 5C4EA 2BO7A 2P72A 4CVHA 1SS9A 3SX3A 4FQWA 1WVCA 1G97A 1ZI5A 1MP3A 4Y9XA 4G3QA 3I0FA 1R7YA 4P00A 3SXCA 1FZWA 4B2WA 3BRKX 5BXCA 4AYLA 3OAMA 1FGXA 3O3PA 2YC5A 5CQNX 2YQHA 2QGIA 1YP4A 3CU0A 4R7PA 1YP2A 2MZBA 3RMWA 3V0OA 1H5RB 1G23A 3SXBA 4G3PA 3ZGGA 5EIYA 2AECA 2FYBA 4IRQA 1FO9A 5CMHA 1LL3A 5L6SA 3D98A 2RJ5A 1LZJA 4NALA 4G3SA 4HO0A 5FTSA 1R7TA 1JV1A 3SX5A 2RJ8A 3T7NA 5C1HA 5CMGX 2XMEA 4FRBA 4CJ8A 1H7LA 1H5TA 3USQA 1ZCVA 1VPAA 2WAWA 4FRMA 1JYKA 4B3UA 1ZJ2A 1FG5N 2BO4A 2Y4MA 1ZCYA 1W77A 5C3AA 3U2WA 1G9RA 3I0GA 4M2AA 1S4OA 3V91A 1XHBA 1ZJ3A 2V0JA 4FRLA 4KQLA 2AM4A 5FYEA 2VS3A 1ON8A 2W0VA 5FTVA 1QG8A 4HO6A 4B4BA 5CQPA 1INIA 1ZCTA 4DDZA 3TZTA 1IINA 2NXVA 4D11A 2DPWA 2FYDB 2AM5A 2X5ZA 2Z86A 1H7FA 4LW6A 3U2UA 1HM0A 1QWJA 3R3IA 3T7OA 5JQQA 4B4GA 1FR9A 3U2XA 4GBPA 3FOQA 2RJ0A 1EYRA 4L41C 5CQLX 5CQOA 4B2XA 2X5SA 4UEGA 2ZU8A 1GWVA 5C4DA 1G95A 1H5RA 2CU2A 5C1GA 2FFVA 3I0KA 5CMIA 3RSBA 3IOIA 3SX8A 5DDVA 5FUHA 3EE5A 4EVWA 5I1FA 2Y4JA 2JCOA 1G1LA 1ZJ0A 3I0CA 5C47A 1FGGA 1GX4A 2V0IA 2YQJA 1ZHJA 2RJ4A 1LZ7A 3NGWA 3PKPA 4J18A 4HO8A 2JCKA 5EJZA 1EZIA 3U2TA 1XZ6A 5C3BA 2WEEA 1VGWA 4D0ZA 3I0LA 4HO3A 3OH2A 2A8UA 4BMAA 4Y7TA 2RIYA 4AYJA 3I0EA 4M2BA 1H7TA 2AM3A 2O1GA 1O7OA 1FRWA 1HV9A 2UX8A 2BO6A 3RMVA 1VGTA 4ECMA 2YESA 2AH9A 2OI7A 3IOJA 1G2VA 2RIXA 2XMHA 3ZF8A 2JCJA 1H4CA 4HO2A 1W55A 2ICXA 2RJ1A 3DK5A 2X65A 1JV3A 5EJ1A 1VH3A 4AAWA 1G0RA 4FCEA 2BO8A 2VXLA 1ZI4A 3GUEA 1ZCUA 3CGXA 4KRVA 3SXGA 3OH1A 1I52A 2PX7A 3V0QA 5AJPA 1R7XA 3SXAA 3V0MA 2Z87A 4HO5A 2VD4A 1V83A 4FROA 3DUVA 2ICYA 4ASYA 3HL3A 4EE4A 1H7GA 1GWWA 4B4MA 2Q4JA 3JUJA 1YP3A 1ZJOA 2FYAA 3I0IX 4E1KA 2E8BA 3ZLKA 5DDTA 1R81A 2GGQA 3E26A 3CKOA 3JUKA 2AESA 3Q80A 1MC3A 2V0KA 2PGYA 5C49A 1ON6A 2AGDA 2XWNA 1R7VA 1VH1A 1ZI1A 3CKJA 4DE7A 2YQSA 2X60A 3SX7A 2V0LA 3F1CA 5FU8A 4NAKA 5IDTA 2P6WA 3T7MA 1H7EA 2I5KA 1NMMB 4Y64A 3ST8A 4D11C 2GGOA 2Y4LA 3V8ZA
chains in the Genus database with same CATH superfamily
3PNNA 3Q7UA 4M4KA 4KC1A 4FIYA 1S4NA 2RIZA 3V0NA 1HM8A 4KNRA 2JCLA 1TZFA 1OQMB 4HO9A 4KC2A 2VK9A 1FXOA 2WE9A 1WT2A 1R7UA 1WSZA 1VZTA 2OI6A 1H4EA 1K4VA 1H5SB 3USRA 1JVGA 1H7QA 1VZUA 4Y7FA 2Y6PA 4EEOA 1G8OA 5FV9A 2VS4A 4Y7GA 4EEAA 3I0DA 5J49A 2PGVA 4KXOA 5CMFX 1FWYA 2Y4KA 1OMZA 3POLA 4ASJA 1NQIB 5C8RA 4HO4A 1INJA 1HM9A 1TW1A 3DJ4A 3OH3A 1VICA 3ZLLA 4Y62A 1FOAA 1R82A 1ZJ1A 4FRPA 4Q7CA 1PZYB 2WGZA 2OEGA 1LZ0A 4NANA 3E25A 4FREA 1VGZA 3K8EA 1QGQA 4JISA 5CQMX 3V0LA 4KNXA 3KIAA 3Q4SA 1O23B 1WT0A 1LVWA 4MNDA 2WVLA 3FWWA 1NWGB 1H4DA 5AJOA 2PA4A 3V90A 2D7IA 2YC3A 1H7HA 2OEFA 1NF5B 3PKQA 2VS5A 2O1FA 1JYLA 4MYBA 4Y63A 1MP5A 4FCUA 1KWSA 3TQDA 4EEMA 5D91A 1S4PA 2OI5A 1FR8A 3SXDA 4DECA 4IRPA 2RJ7A 5C4CA 1PZTA 2A8WA 2WVMA 4Y6NA 2FY7A 3CKVA 1FXJA 5C48A 4ZDQA 5C4BA 4B5BA 5C4FA 1VGUA 4K6RA 4Y7VA 1O0RA 2YCMA 4CJBA 1O7QA 1QGSA 5CMJA 1FO8A 2FFUA 3V0PA 1H3MA 5C38A 5L6VA 2XWMA 4P02A 3OKRA 1H5SA 4M28A 4ARWA 1MP4A 5C36A 4B42A 1H5SD 2VFZA 4G87A 2VSIA 1G93A 4Y6UA 3R2WA 4XWIA 4CJCA 3IOHA 2ZU7A 1JVDA 2I7BA 2Y7AA 2VSHA 5C3DA 3OC9A 2E3DA 4EE5A 1V84A 1H5SC 3ZGFA 3I0JA 3QVBA 2WVKA 2QH5A 4C2SA 4AC3A 5HS2A 2AE7A 2P73A 5C1LA 4FRHA 3K8DA 1LL0A 4HOCA 1V82A 5FU0A 1GQ9A 1TW5A 3JTJA 1R80A 1WT1A 1HJJA 2APCA 3CKNA 1OMXA 3SXEA 2ZU9A 3LW6A 5AJNA 4LW3A 4D48A 1ZDGA 1Z90A 2O1HA 3D8VA 4BQHA 4KT7A 3V8YA 1VM8A 2RJ9A 1E5KA 1G3LA 1NHEB 3CKQA 3OH0A 1GQCA 4YS8A 1YROB 1ZIZA 1LZIA 4HG6A 1ZJPA 2RJ6A 2RITA 4KPXA 4FRDA 1GA8A 4KPZA 2V0HA 1LL2A 3OH4A 2D0JA 3I0HA 3SPTA 1NKHB 1H5TB 4JD0A 1TVYA 3D5NA 1W57A 4Y7UA 3U2VA 1VZXA 2VXMA 3BCVA 3F1YA 4EEGA 5IFYA 1ZDFA 2QKXA 4KC4A 4D0TA 2XWLA 4FRAA 2D7RA 2FYCB 1IIMA 1HJLA 3OGZA 3N9WA 1ZI3A 4HCQA 5IDSA 1WT3A 1GX0A 2YQCA 3U0YA 4NAIA 2W0WA 4EE3A 2I5EA 4FRQA 3U0XA 5C4EA 2BO7A 2P72A 4CVHA 1SS9A 3SX3A 4FQWA 1WVCA 1G97A 1ZI5A 1MP3A 4Y9XA 4G3QA 3I0FA 1R7YA 4P00A 3SXCA 1FZWA 4B2WA 3BRKX 5BXCA 4AYLA 3OAMA 1FGXA 3O3PA 2YC5A 5CQNX 2YQHA 2QGIA 1YP4A 3CU0A 4R7PA 1YP2A 2MZBA 3RMWA 3V0OA 1H5RB 1G23A 3SXBA 4G3PA 3ZGGA 5EIYA 2AECA 2FYBA 4IRQA 1FO9A 5CMHA 1LL3A 5L6SA 3D98A 2RJ5A 1LZJA 2J0BA 4NALA 4G3SA 4HO0A 5FTSA 1R7TA 1JV1A 3SX5A 2RJ8A 3T7NA 5C1HA 5CMGX 2XMEA 4FRBA 4CJ8A 1H7LA 1H5TA 3USQA 1ZCVA 1VPAA 2WAWA 4FRMA 1JYKA 4B3UA 1ZJ2A 1FG5N 2BO4A 2Y4MA 1ZCYA 1W77A 5C3AA 3U2WA 1G9RA 3I0GA 4M2AA 1S4OA 3V91A 1XHBA 1ZJ3A 2V0JA 4FRLA 4KQLA 2AM4A 5FYEA 2VS3A 1ON8A 2W0VA 5FTVA 1QG8A 4HO6A 4B4BA 5CQPA 1INIA 1ZCTA 4DDZA 3TZTA 1IINA 2NXVA 4D11A 2DPWA 2FYDB 2AM5A 2X5ZA 2Z86A 1H7FA 4LW6A 3U2UA 1HM0A 1QWJA 3R3IA 4FIXA 3T7OA 5JQQA 4B4GA 1FR9A 4O6MA 3U2XA 4GBPA 3FOQA 2RJ0A 1EYRA 4L41C 5CQLX 5CQOA 4B2XA 2X5SA 4UEGA 2ZU8A 1GWVA 5C4DA 1G95A 1H5RA 2CU2A 5C1GA 2FFVA 3I0KA 5CMIA 3RSBA 3IOIA 3SX8A 5DDVA 5FUHA 3EE5A 4EVWA 5I1FA 2Y4JA 2JCOA 4O6NA 1G1LA 1ZJ0A 3I0CA 5C47A 1FGGA 1GX4A 2V0IA 2YQJA 1ZHJA 2RJ4A 1LZ7A 3NGWA 3PKPA 4J18A 4HO8A 2JCKA 5EJZA 1EZIA 3U2TA 1XZ6A 5C3BA 2WEEA 1VGWA 4D0ZA 3I0LA 4HO3A 3OH2A 2A8UA 4BMAA 4Y7TA 2RIYA 4AYJA 3I0EA 4M2BA 1H7TA 2AM3A 2O1GA 1O7OA 1FRWA 1HV9A 2UX8A 2BO6A 3RMVA 1VGTA 4ECMA 2YESA 2AH9A 2OI7A 3IOJA 1G2VA 2RIXA 2XMHA 3ZF8A 2JCJA 1H4CA 4HO2A 1W55A 2ICXA 2RJ1A 3DK5A 2X65A 1JV3A 5EJ1A 1VH3A 4AAWA 1G0RA 4FCEA 2BO8A 2VXLA 1ZI4A 3GUEA 1ZCUA 3CGXA 4KRVA 3SXGA 3OH1A 1I52A 2J0AA 2PX7A 3V0QA 5AJPA 1R7XA 3SXAA 3V0MA 2Z87A 4HO5A 2VD4A 1V83A 4FROA 3DUVA 2ICYA 4ASYA 3HL3A 4EE4A 1H7GA 1GWWA 4B4MA 2Q4JA 3JUJA 1YP3A 1ZJOA 2FYAA 3I0IX 4E1KA 2E8BA 3ZLKA 5DDTA 1R81A 2GGQA 3E26A 3CKOA 3JUKA 2AESA 3Q80A 1MC3A 2V0KA 2PGYA 5C49A 1ON6A 2AGDA 4MIXA 2XWNA 1R7VA 1VH1A 1ZI1A 3CKJA 4DE7A 2YQSA 2X60A 3SX7A 2V0LA 3F1CA 5FU8A 4NAKA 5D92A 5IDTA 2C0NA 2P6WA 3T7MA 1H7EA 2I5KA 1NMMB 4Y64A 3ST8A 4D11C 2GGOA 2Y4LA 3V8ZA
chains in the Genus database with same CATH topology
3PNNA 3Q7UA 4M4KA 4KC1A 4FIYA 1S4NA 2RIZA 3V0NA 1HM8A 4KNRA 2JCLA 1TZFA 1OQMB 4HO9A 4KC2A 2VK9A 1FXOA 2WE9A 1WT2A 1R7UA 1WSZA 1VZTA 2OI6A 1H4EA 1K4VA 1H5SB 3USRA 1JVGA 1H7QA 1VZUA 4Y7FA 2Y6PA 4EEOA 1G8OA 5FV9A 2VS4A 4Y7GA 4EEAA 3I0DA 5J49A 2PGVA 4KXOA 5CMFX 1FWYA 2Y4KA 1OMZA 3POLA 4ASJA 1NQIB 5C8RA 4HO4A 1INJA 1HM9A 1TW1A 3DJ4A 3OH3A 1VICA 3ZLLA 4Y62A 1FOAA 1R82A 1ZJ1A 4FRPA 4Q7CA 1PZYB 2WGZA 2OEGA 1LZ0A 4NANA 3E25A 4FREA 1VGZA 3K8EA 1QGQA 4JISA 5CQMX 3V0LA 4KNXA 3KIAA 3Q4SA 1O23B 1WT0A 1LVWA 4MNDA 2WVLA 3FWWA 1NWGB 1H4DA 5AJOA 2PA4A 3V90A 2D7IA 2YC3A 1H7HA 2OEFA 1NF5B 3PKQA 2VS5A 2O1FA 1JYLA 4MYBA 4Y63A 1MP5A 4FCUA 1KWSA 3TQDA 4EEMA 5D91A 1S4PA 2OI5A 1FR8A 3SXDA 4DECA 4IRPA 2RJ7A 5C4CA 1PZTA 2A8WA 2WVMA 4Y6NA 2FY7A 3CKVA 1FXJA 5C48A 4ZDQA 5C4BA 4B5BA 5C4FA 1VGUA 4K6RA 4Y7VA 1O0RA 2YCMA 4CJBA 1O7QA 1QGSA 5CMJA 1FO8A 2FFUA 3V0PA 1H3MA 5C38A 5L6VA 2XWMA 4P02A 3OKRA 1H5SA 4M28A 4ARWA 1MP4A 5C36A 4B42A 1H5SD 2VFZA 4G87A 2VSIA 1G93A 4Y6UA 3R2WA 4XWIA 4CJCA 3IOHA 2ZU7A 1JVDA 2I7BA 2Y7AA 2VSHA 5C3DA 3OC9A 2E3DA 4EE5A 1V84A 1H5SC 3ZGFA 3I0JA 3QVBA 2WVKA 2QH5A 4C2SA 4AC3A 5HS2A 2AE7A 2P73A 5C1LA 4FRHA 3K8DA 1LL0A 4HOCA 1V82A 5FU0A 1GQ9A 1TW5A 3JTJA 1R80A 1WT1A 1HJJA 2APCA 3CKNA 1OMXA 3SXEA 2ZU9A 3LW6A 5AJNA 4LW3A 4D48A 1ZDGA 1Z90A 2O1HA 3D8VA 4BQHA 4KT7A 3V8YA 1VM8A 2RJ9A 1E5KA 1G3LA 1NHEB 3CKQA 3OH0A 1GQCA 4YS8A 1YROB 1ZIZA 1LZIA 4HG6A 1ZJPA 2RJ6A 2RITA 4KPXA 4FRDA 1GA8A 4KPZA 2V0HA 1LL2A 3OH4A 2D0JA 3I0HA 3SPTA 1NKHB 1H5TB 4JD0A 1TVYA 3D5NA 1W57A 4Y7UA 3U2VA 1VZXA 2VXMA 3BCVA 3F1YA 4EEGA 5IFYA 1ZDFA 2QKXA 4KC4A 4D0TA 2XWLA 4FRAA 2D7RA 2FYCB 1IIMA 1HJLA 3OGZA 3N9WA 1ZI3A 4HCQA 5IDSA 1WT3A 1GX0A 2YQCA 3U0YA 4NAIA 2W0WA 4EE3A 2I5EA 4FRQA 3U0XA 5C4EA 2BO7A 2P72A 4CVHA 1SS9A 3SX3A 4FQWA 1WVCA 1G97A 1ZI5A 1MP3A 4Y9XA 4G3QA 3I0FA 1R7YA 4P00A 3SXCA 1FZWA 4B2WA 3BRKX 5BXCA 4AYLA 3OAMA 1FGXA 3O3PA 2YC5A 5CQNX 2YQHA 2QGIA 1YP4A 3CU0A 4R7PA 1YP2A 2MZBA 3RMWA 3V0OA 1H5RB 1G23A 3SXBA 4G3PA 3ZGGA 5EIYA 2AECA 2FYBA 4IRQA 1FO9A 5CMHA 1LL3A 5L6SA 3D98A 2RJ5A 1LZJA 2J0BA 4NALA 4G3SA 4HO0A 5FTSA 1R7TA 1JV1A 3SX5A 2RJ8A 3T7NA 5C1HA 5CMGX 2XMEA 4FRBA 4CJ8A 1H7LA 1H5TA 3USQA 1ZCVA 1VPAA 2WAWA 4FRMA 1JYKA 4B3UA 1ZJ2A 1FG5N 2BO4A 2Y4MA 1ZCYA 1W77A 5C3AA 3U2WA 1G9RA 3I0GA 4M2AA 1S4OA 3V91A 1XHBA 1ZJ3A 2V0JA 4FRLA 4KQLA 2AM4A 5FYEA 2VS3A 1ON8A 2W0VA 5FTVA 1QG8A 4HO6A 4B4BA 5CQPA 1INIA 1ZCTA 4DDZA 3TZTA 1IINA 2NXVA 4D11A 2DPWA 2FYDB 2AM5A 2X5ZA 2Z86A 1H7FA 4LW6A 3U2UA 1HM0A 1QWJA 3R3IA 4FIXA 3T7OA 5JQQA 4B4GA 1FR9A 4O6MA 3U2XA 4GBPA 3FOQA 2RJ0A 1EYRA 4L41C 5CQLX 5CQOA 4B2XA 2X5SA 4UEGA 2ZU8A 1GWVA 5C4DA 1G95A 1H5RA 2CU2A 5C1GA 2FFVA 3I0KA 5CMIA 3RSBA 3IOIA 3SX8A 5DDVA 5FUHA 3EE5A 4EVWA 5I1FA 2Y4JA 2JCOA 4O6NA 1G1LA 1ZJ0A 3I0CA 5C47A 1FGGA 1GX4A 2V0IA 2YQJA 1ZHJA 2RJ4A 1LZ7A 3NGWA 3PKPA 4J18A 4HO8A 2JCKA 5EJZA 1EZIA 3U2TA 1XZ6A 5C3BA 2WEEA 1VGWA 4D0ZA 3I0LA 4HO3A 3OH2A 2A8UA 4BMAA 4Y7TA 2RIYA 4AYJA 3I0EA 4M2BA 1H7TA 2AM3A 2O1GA 1O7OA 1FRWA 1HV9A 2UX8A 2BO6A 3RMVA 1VGTA 4ECMA 2YESA 2AH9A 2OI7A 3IOJA 1G2VA 2RIXA 2XMHA 3ZF8A 2JCJA 1H4CA 4HO2A 1W55A 2ICXA 2RJ1A 3DK5A 2X65A 1JV3A 5EJ1A 1VH3A 4AAWA 1G0RA 4FCEA 2BO8A 2VXLA 1ZI4A 3GUEA 1ZCUA 3CGXA 4KRVA 3SXGA 3OH1A 1I52A 2J0AA 2PX7A 3V0QA 5AJPA 1R7XA 3SXAA 3V0MA 2Z87A 4HO5A 2VD4A 1V83A 4FROA 3DUVA 2ICYA 4ASYA 3HL3A 4EE4A 1H7GA 1GWWA 4B4MA 2Q4JA 3JUJA 1YP3A 1ZJOA 2FYAA 3I0IX 4E1KA 2E8BA 3ZLKA 5DDTA 1R81A 2GGQA 3E26A 3CKOA 3JUKA 2AESA 3Q80A 1MC3A 2V0KA 2PGYA 5C49A 1ON6A 2AGDA 4MIXA 2XWNA 1R7VA 1VH1A 1ZI1A 3CKJA 4DE7A 2YQSA 2X60A 3SX7A 2V0LA 3F1CA 5FU8A 4NAKA 5D92A 5IDTA 2C0NA 2P6WA 3T7MA 1H7EA 2I5KA 1NMMB 4Y64A 3ST8A 4D11C 2GGOA 2Y4LA 3V8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNN A;  3Q7U A;  4M4K A;  4KC1 A;  1S4N A;  2RIZ A;  3V0N A;  1HM8 A;  4KNR A;  2JCL A;  1TZF A;  1OQM B;  4HO9 A;  4KC2 A;  2WE9 A;  1FXO A;  1WT2 A;  1R7U A;  1WSZ A;  1VZT A;  2OI6 A;  1H4E A;  1K4V A;  1H5S B;  3USR A;  1JVG A;  1H7Q A;  1VZU A;  4Y7F A;  2Y6P A;  4EEO A;  1G8O A;  5FV9 A;  2VS4 A;  4Y7G A;  4EEA A;  3I0D A;  5J49 A;  2PGV A;  4KXO A;  5CMF X;  1FWY A;  2Y4K A;  1OMZ A;  3POL A;  4ASJ A;  1NQI B;  5C8R A;  4HO4 A;  1INJ A;  1HM9 A;  1TW1 A;  3DJ4 A;  3OH3 A;  1VIC A;  3ZLL A;  4Y62 A;  1FOA A;  1R82 A;  1ZJ1 A;  4FRP A;  1PZY B;  2WGZ A;  2OEG A;  1LZ0 A;  4NAN A;  3E25 A;  4FRE A;  1VGZ A;  3K8E A;  1QGQ A;  4JIS A;  5CQM X;  3V0L A;  4KNX A;  3KIA A;  3Q4S A;  1O23 B;  1WT0 A;  1LVW A;  4MND A;  2WVL A;  3FWW A;  1NWG B;  1H4D A;  5AJO A;  2PA4 A;  3V90 A;  2D7I A;  2YC3 A;  1H7H A;  2OEF A;  1NF5 B;  3PKQ A;  2VS5 A;  2O1F A;  1JYL A;  4MYB A;  4Y63 A;  1MP5 A;  4FCU A;  1KWS A;  3TQD A;  4EEM A;  1S4P A;  2OI5 A;  1FR8 A;  3SXD A;  4DEC A;  4IRP A;  2RJ7 A;  5C4C A;  1PZT A;  2A8W A;  2WVM A;  4Y6N A;  2FY7 A;  3CKV A;  1FXJ A;  5C48 A;  4ZDQ A;  5C4B A;  4B5B A;  5C4F A;  1VGU A;  4K6R A;  4Y7V A;  1O0R A;  2YCM A;  4CJB A;  1O7Q A;  1QGS A;  5CMJ A;  1FO8 A;  2FFU A;  3V0P A;  1H3M A;  5C38 A;  5L6V A;  2XWM A;  4P02 A;  3OKR A;  1H5S A;  4M28 A;  4ARW A;  1MP4 A;  5C36 A;  4B42 A;  1H5S D;  2VFZ A;  4G87 A;  2VSI A;  1G93 A;  4Y6U A;  3R2W A;  4XWI A;  4CJC A;  3IOH A;  2ZU7 A;  1JVD A;  2I7B A;  2Y7A A;  2VSH A;  5C3D A;  3OC9 A;  2E3D A;  4EE5 A;  1V84 A;  1H5S C;  3ZGF A;  3I0J A;  3QVB A;  2WVK A;  2QH5 A;  4C2S A;  4AC3 A;  5HS2 A;  2AE7 A;  2P73 A;  5C1L A;  4FRH A;  3K8D A;  1LL0 A;  4HOC A;  1V82 A;  5FU0 A;  1GQ9 A;  1TW5 A;  3JTJ A;  1R80 A;  1WT1 A;  1HJJ A;  2APC A;  3CKN A;  1OMX A;  3SXE A;  2ZU9 A;  3LW6 A;  5AJN A;  4LW3 A;  4D48 A;  1ZDG A;  1Z90 A;  2O1H A;  3D8V A;  4BQH A;  4KT7 A;  3V8Y A;  1VM8 A;  2RJ9 A;  1E5K A;  1G3L A;  1NHE B;  3CKQ A;  3OH0 A;  1GQC A;  4YS8 A;  1YRO B;  1ZIZ A;  1LZI A;  4HG6 A;  1ZJP A;  2RJ6 A;  2RIT A;  4KPX A;  4FRD A;  1GA8 A;  4KPZ A;  2V0H A;  1LL2 A;  3OH4 A;  2D0J A;  3I0H A;  3SPT A;  1NKH B;  1H5T B;  4JD0 A;  1TVY A;  3D5N A;  1W57 A;  4Y7U A;  3U2V A;  1VZX A;  2VXM A;  3BCV A;  3F1Y A;  4EEG A;  5IFY A;  1ZDF A;  2QKX A;  4KC4 A;  4D0T A;  2XWL A;  4FRA A;  2D7R A;  2FYC B;  1IIM A;  1HJL A;  3OGZ A;  3N9W A;  1ZI3 A;  4HCQ A;  5IDS A;  1WT3 A;  1GX0 A;  2YQC A;  3U0Y A;  4NAI A;  2W0W A;  4EE3 A;  2I5E A;  4FRQ A;  3U0X A;  5C4E A;  2BO7 A;  2P72 A;  4CVH A;  1SS9 A;  3SX3 A;  4FQW A;  1WVC A;  1G97 A;  1ZI5 A;  1MP3 A;  4Y9X A;  4G3Q A;  3I0F A;  1R7Y A;  4P00 A;  3SXC A;  1FZW A;  4B2W A;  3BRK X;  5BXC A;  4AYL A;  3OAM A;  1FGX A;  3O3P A;  2YC5 A;  5CQN X;  2YQH A;  2QGI A;  1YP4 A;  3CU0 A;  4R7P A;  1YP2 A;  2MZB A;  3RMW A;  3V0O A;  1H5R B;  1G23 A;  3SXB A;  4G3P A;  3ZGG A;  5EIY A;  2AEC A;  2FYB A;  4IRQ A;  1FO9 A;  5CMH A;  1LL3 A;  5L6S A;  3D98 A;  2RJ5 A;  1LZJ A;  4NAL A;  4G3S A;  4HO0 A;  5FTS A;  1R7T A;  1JV1 A;  3SX5 A;  2RJ8 A;  3T7N A;  5C1H A;  5CMG X;  2XME A;  4FRB A;  4CJ8 A;  1H7L A;  1H5T A;  3USQ A;  1ZCV A;  1VPA A;  2WAW A;  4FRM A;  1JYK A;  4B3U A;  1ZJ2 A;  1FG5 N;  2BO4 A;  2Y4M A;  1ZCY A;  1W77 A;  5C3A A;  3U2W A;  1G9R A;  3I0G A;  4M2A A;  1S4O A;  3V91 A;  1XHB A;  1ZJ3 A;  2V0J A;  4FRL A;  4KQL A;  2AM4 A;  5FYE A;  2VS3 A;  1ON8 A;  2W0V A;  5FTV A;  1QG8 A;  4HO6 A;  4B4B A;  5CQP A;  1INI A;  1ZCT A;  4DDZ A;  3TZT A;  1IIN A;  2NXV A;  4D11 A;  2DPW A;  2FYD B;  2AM5 A;  2X5Z A;  2Z86 A;  1H7F A;  4LW6 A;  3U2U A;  1HM0 A;  1QWJ A;  3R3I A;  3T7O A;  5JQQ A;  4B4G A;  1FR9 A;  3U2X A;  4GBP A;  3FOQ A;  2RJ0 A;  1EYR A;  4L41 C;  5CQL X;  5CQO A;  4B2X A;  2X5S A;  4UEG A;  2ZU8 A;  1GWV A;  5C4D A;  1G95 A;  1H5R A;  2CU2 A;  5C1G A;  2FFV A;  3I0K A;  5CMI A;  3RSB A;  3IOI A;  3SX8 A;  5DDV A;  5FUH A;  3EE5 A;  4EVW A;  5I1F A;  2Y4J A;  2JCO A;  1G1L A;  1ZJ0 A;  3I0C A;  5C47 A;  1FGG A;  1GX4 A;  2V0I A;  2YQJ A;  1ZHJ A;  2RJ4 A;  1LZ7 A;  3NGW A;  3PKP A;  4J18 A;  4HO8 A;  2JCK A;  5EJZ A;  1EZI A;  3U2T A;  1XZ6 A;  5C3B A;  2WEE A;  1VGW A;  4D0Z A;  3I0L A;  4HO3 A;  3OH2 A;  2A8U A;  4BMA A;  4Y7T A;  2RIY A;  4AYJ A;  3I0E A;  4M2B A;  1H7T A;  2AM3 A;  2O1G A;  1O7O A;  1FRW A;  1HV9 A;  2UX8 A;  2BO6 A;  3RMV A;  1VGT A;  4ECM A;  2YES A;  2AH9 A;  2OI7 A;  3IOJ A;  1G2V A;  2RIX A;  2XMH A;  3ZF8 A;  2JCJ A;  1H4C A;  4HO2 A;  1W55 A;  2ICX A;  2RJ1 A;  3DK5 A;  2X65 A;  1JV3 A;  5EJ1 A;  1VH3 A;  4AAW A;  1G0R A;  4FCE A;  2BO8 A;  2VXL A;  1ZI4 A;  3GUE A;  1ZCU A;  3CGX A;  4KRV A;  3SXG A;  3OH1 A;  1I52 A;  2PX7 A;  3V0Q A;  5AJP A;  1R7X A;  3SXA A;  3V0M A;  2Z87 A;  4HO5 A;  2VD4 A;  1V83 A;  4FRO A;  3DUV A;  2ICY A;  4ASY A;  3HL3 A;  4EE4 A;  1H7G A;  1GWW A;  4B4M A;  2Q4J A;  3JUJ A;  1YP3 A;  1ZJO A;  2FYA A;  3I0I X;  4E1K A;  2E8B A;  3ZLK A;  5DDT A;  1R81 A;  2GGQ A;  3E26 A;  3CKO A;  3JUK A;  2AES A;  3Q80 A;  1MC3 A;  2V0K A;  2PGY A;  5C49 A;  1ON6 A;  2AGD A;  2XWN A;  1R7V A;  1VH1 A;  1ZI1 A;  3CKJ A;  4DE7 A;  2YQS A;  2X60 A;  3SX7 A;  2V0L A;  3F1C A;  5FU8 A;  4NAK A;  5IDT A;  2P6W A;  3T7M A;  1H7E A;  2I5K A;  1NMM B;  4Y64 A;  3ST8 A;  4D11 C;  2GGO A;  2Y4L A;  3V8Z A; 
#chains in the Genus database with same CATH topology
 3PNN A;  3Q7U A;  4M4K A;  4KC1 A;  4FIY A;  1S4N A;  2RIZ A;  3V0N A;  1HM8 A;  4KNR A;  2JCL A;  1TZF A;  1OQM B;  4HO9 A;  4KC2 A;  2VK9 A;  1FXO A;  2WE9 A;  1WT2 A;  1R7U A;  1WSZ A;  1VZT A;  2OI6 A;  1H4E A;  1K4V A;  1H5S B;  3USR A;  1JVG A;  1H7Q A;  1VZU A;  4Y7F A;  2Y6P A;  4EEO A;  1G8O A;  5FV9 A;  2VS4 A;  4Y7G A;  4EEA A;  3I0D A;  5J49 A;  2PGV A;  4KXO A;  5CMF X;  1FWY A;  2Y4K A;  1OMZ A;  3POL A;  4ASJ A;  1NQI B;  5C8R A;  4HO4 A;  1INJ A;  1HM9 A;  1TW1 A;  3DJ4 A;  3OH3 A;  1VIC A;  3ZLL A;  4Y62 A;  1FOA A;  1R82 A;  1ZJ1 A;  4FRP A;  4Q7C A;  1PZY B;  2WGZ A;  2OEG A;  1LZ0 A;  4NAN A;  3E25 A;  4FRE A;  1VGZ A;  3K8E A;  1QGQ A;  4JIS A;  5CQM X;  3V0L A;  4KNX A;  3KIA A;  3Q4S A;  1O23 B;  1WT0 A;  1LVW A;  4MND A;  2WVL A;  3FWW A;  1NWG B;  1H4D A;  5AJO A;  2PA4 A;  3V90 A;  2D7I A;  2YC3 A;  1H7H A;  2OEF A;  1NF5 B;  3PKQ A;  2VS5 A;  2O1F A;  1JYL A;  4MYB A;  4Y63 A;  1MP5 A;  4FCU A;  1KWS A;  3TQD A;  4EEM A;  5D91 A;  1S4P A;  2OI5 A;  1FR8 A;  3SXD A;  4DEC A;  4IRP A;  2RJ7 A;  5C4C A;  1PZT A;  2A8W A;  2WVM A;  4Y6N A;  2FY7 A;  3CKV A;  1FXJ A;  5C48 A;  4ZDQ A;  5C4B A;  4B5B A;  5C4F A;  1VGU A;  4K6R A;  4Y7V A;  1O0R A;  2YCM A;  4CJB A;  1O7Q A;  1QGS A;  5CMJ A;  1FO8 A;  2FFU A;  3V0P A;  1H3M A;  5C38 A;  5L6V A;  2XWM A;  4P02 A;  3OKR A;  1H5S A;  4M28 A;  4ARW A;  1MP4 A;  5C36 A;  4B42 A;  1H5S D;  2VFZ A;  4G87 A;  2VSI A;  1G93 A;  4Y6U A;  3R2W A;  4XWI A;  4CJC A;  3IOH A;  2ZU7 A;  1JVD A;  2I7B A;  2Y7A A;  2VSH A;  5C3D A;  3OC9 A;  2E3D A;  4EE5 A;  1V84 A;  1H5S C;  3ZGF A;  3I0J A;  3QVB A;  2WVK A;  2QH5 A;  4C2S A;  4AC3 A;  5HS2 A;  2AE7 A;  2P73 A;  5C1L A;  4FRH A;  3K8D A;  1LL0 A;  4HOC A;  1V82 A;  5FU0 A;  1GQ9 A;  1TW5 A;  3JTJ A;  1R80 A;  1WT1 A;  1HJJ A;  2APC A;  3CKN A;  1OMX A;  3SXE A;  2ZU9 A;  3LW6 A;  5AJN A;  4LW3 A;  4D48 A;  1ZDG A;  1Z90 A;  2O1H A;  3D8V A;  4BQH A;  4KT7 A;  3V8Y A;  1VM8 A;  2RJ9 A;  1E5K A;  1G3L A;  1NHE B;  3CKQ A;  3OH0 A;  1GQC A;  4YS8 A;  1YRO B;  1ZIZ A;  1LZI A;  4HG6 A;  1ZJP A;  2RJ6 A;  2RIT A;  4KPX A;  4FRD A;  1GA8 A;  4KPZ A;  2V0H A;  1LL2 A;  3OH4 A;  2D0J A;  3I0H A;  3SPT A;  1NKH B;  1H5T B;  4JD0 A;  1TVY A;  3D5N A;  1W57 A;  4Y7U A;  3U2V A;  1VZX A;  2VXM A;  3BCV A;  3F1Y A;  4EEG A;  5IFY A;  1ZDF A;  2QKX A;  4KC4 A;  4D0T A;  2XWL A;  4FRA A;  2D7R A;  2FYC B;  1IIM A;  1HJL A;  3OGZ A;  3N9W A;  1ZI3 A;  4HCQ A;  5IDS A;  1WT3 A;  1GX0 A;  2YQC A;  3U0Y A;  4NAI A;  2W0W A;  4EE3 A;  2I5E A;  4FRQ A;  3U0X A;  5C4E A;  2BO7 A;  2P72 A;  4CVH A;  1SS9 A;  3SX3 A;  4FQW A;  1WVC A;  1G97 A;  1ZI5 A;  1MP3 A;  4Y9X A;  4G3Q A;  3I0F A;  1R7Y A;  4P00 A;  3SXC A;  1FZW A;  4B2W A;  3BRK X;  5BXC A;  4AYL A;  3OAM A;  1FGX A;  3O3P A;  2YC5 A;  5CQN X;  2YQH A;  2QGI A;  1YP4 A;  3CU0 A;  4R7P A;  1YP2 A;  2MZB A;  3RMW A;  3V0O A;  1H5R B;  1G23 A;  3SXB A;  4G3P A;  3ZGG A;  5EIY A;  2AEC A;  2FYB A;  4IRQ A;  1FO9 A;  5CMH A;  1LL3 A;  5L6S A;  3D98 A;  2RJ5 A;  1LZJ A;  2J0B A;  4NAL A;  4G3S A;  4HO0 A;  5FTS A;  1R7T A;  1JV1 A;  3SX5 A;  2RJ8 A;  3T7N A;  5C1H A;  5CMG X;  2XME A;  4FRB A;  4CJ8 A;  1H7L A;  1H5T A;  3USQ A;  1ZCV A;  1VPA A;  2WAW A;  4FRM A;  1JYK A;  4B3U A;  1ZJ2 A;  1FG5 N;  2BO4 A;  2Y4M A;  1ZCY A;  1W77 A;  5C3A A;  3U2W A;  1G9R A;  3I0G A;  4M2A A;  1S4O A;  3V91 A;  1XHB A;  1ZJ3 A;  2V0J A;  4FRL A;  4KQL A;  2AM4 A;  5FYE A;  2VS3 A;  1ON8 A;  2W0V A;  5FTV A;  1QG8 A;  4HO6 A;  4B4B A;  5CQP A;  1INI A;  1ZCT A;  4DDZ A;  3TZT A;  1IIN A;  2NXV A;  4D11 A;  2DPW A;  2FYD B;  2AM5 A;  2X5Z A;  2Z86 A;  1H7F A;  4LW6 A;  3U2U A;  1HM0 A;  1QWJ A;  3R3I A;  4FIX A;  3T7O A;  5JQQ A;  4B4G A;  1FR9 A;  4O6M A;  3U2X A;  4GBP A;  3FOQ A;  2RJ0 A;  1EYR A;  4L41 C;  5CQL X;  5CQO A;  4B2X A;  2X5S A;  4UEG A;  2ZU8 A;  1GWV A;  5C4D A;  1G95 A;  1H5R A;  2CU2 A;  5C1G A;  2FFV A;  3I0K A;  5CMI A;  3RSB A;  3IOI A;  3SX8 A;  5DDV A;  5FUH A;  3EE5 A;  4EVW A;  5I1F A;  2Y4J A;  2JCO A;  4O6N A;  1G1L A;  1ZJ0 A;  3I0C A;  5C47 A;  1FGG A;  1GX4 A;  2V0I A;  2YQJ A;  1ZHJ A;  2RJ4 A;  1LZ7 A;  3NGW A;  3PKP A;  4J18 A;  4HO8 A;  2JCK A;  5EJZ A;  1EZI A;  3U2T A;  1XZ6 A;  5C3B A;  2WEE A;  1VGW A;  4D0Z A;  3I0L A;  4HO3 A;  3OH2 A;  2A8U A;  4BMA A;  4Y7T A;  2RIY A;  4AYJ A;  3I0E A;  4M2B A;  1H7T A;  2AM3 A;  2O1G A;  1O7O A;  1FRW A;  1HV9 A;  2UX8 A;  2BO6 A;  3RMV A;  1VGT A;  4ECM A;  2YES A;  2AH9 A;  2OI7 A;  3IOJ A;  1G2V A;  2RIX A;  2XMH A;  3ZF8 A;  2JCJ A;  1H4C A;  4HO2 A;  1W55 A;  2ICX A;  2RJ1 A;  3DK5 A;  2X65 A;  1JV3 A;  5EJ1 A;  1VH3 A;  4AAW A;  1G0R A;  4FCE A;  2BO8 A;  2VXL A;  1ZI4 A;  3GUE A;  1ZCU A;  3CGX A;  4KRV A;  3SXG A;  3OH1 A;  1I52 A;  2J0A A;  2PX7 A;  3V0Q A;  5AJP A;  1R7X A;  3SXA A;  3V0M A;  2Z87 A;  4HO5 A;  2VD4 A;  1V83 A;  4FRO A;  3DUV A;  2ICY A;  4ASY A;  3HL3 A;  4EE4 A;  1H7G A;  1GWW A;  4B4M A;  2Q4J A;  3JUJ A;  1YP3 A;  1ZJO A;  2FYA A;  3I0I X;  4E1K A;  2E8B A;  3ZLK A;  5DDT A;  1R81 A;  2GGQ A;  3E26 A;  3CKO A;  3JUK A;  2AES A;  3Q80 A;  1MC3 A;  2V0K A;  2PGY A;  5C49 A;  1ON6 A;  2AGD A;  4MIX A;  2XWN A;  1R7V A;  1VH1 A;  1ZI1 A;  3CKJ A;  4DE7 A;  2YQS A;  2X60 A;  3SX7 A;  2V0L A;  3F1C A;  5FU8 A;  4NAK A;  5D92 A;  5IDT A;  2C0N A;  2P6W A;  3T7M A;  1H7E A;  2I5K A;  1NMM B;  4Y64 A;  3ST8 A;  4D11 C;  2GGO A;  2Y4L A;  3V8Z A; 
#chains in the Genus database with same CATH homology
 3PNN A;  3Q7U A;  4M4K A;  4KC1 A;  4FIY A;  1S4N A;  2RIZ A;  3V0N A;  1HM8 A;  4KNR A;  2JCL A;  1TZF A;  1OQM B;  4HO9 A;  4KC2 A;  2VK9 A;  1FXO A;  2WE9 A;  1WT2 A;  1R7U A;  1WSZ A;  1VZT A;  2OI6 A;  1H4E A;  1K4V A;  1H5S B;  3USR A;  1JVG A;  1H7Q A;  1VZU A;  4Y7F A;  2Y6P A;  4EEO A;  1G8O A;  5FV9 A;  2VS4 A;  4Y7G A;  4EEA A;  3I0D A;  5J49 A;  2PGV A;  4KXO A;  5CMF X;  1FWY A;  2Y4K A;  1OMZ A;  3POL A;  4ASJ A;  1NQI B;  5C8R A;  4HO4 A;  1INJ A;  1HM9 A;  1TW1 A;  3DJ4 A;  3OH3 A;  1VIC A;  3ZLL A;  4Y62 A;  1FOA A;  1R82 A;  1ZJ1 A;  4FRP A;  4Q7C A;  1PZY B;  2WGZ A;  2OEG A;  1LZ0 A;  4NAN A;  3E25 A;  4FRE A;  1VGZ A;  3K8E A;  1QGQ A;  4JIS A;  5CQM X;  3V0L A;  4KNX A;  3KIA A;  3Q4S A;  1O23 B;  1WT0 A;  1LVW A;  4MND A;  2WVL A;  3FWW A;  1NWG B;  1H4D A;  5AJO A;  2PA4 A;  3V90 A;  2D7I A;  2YC3 A;  1H7H A;  2OEF A;  1NF5 B;  3PKQ A;  2VS5 A;  2O1F A;  1JYL A;  4MYB A;  4Y63 A;  1MP5 A;  4FCU A;  1KWS A;  3TQD A;  4EEM A;  5D91 A;  1S4P A;  2OI5 A;  1FR8 A;  3SXD A;  4DEC A;  4IRP A;  2RJ7 A;  5C4C A;  1PZT A;  2A8W A;  2WVM A;  4Y6N A;  2FY7 A;  3CKV A;  1FXJ A;  5C48 A;  4ZDQ A;  5C4B A;  4B5B A;  5C4F A;  1VGU A;  4K6R A;  4Y7V A;  1O0R A;  2YCM A;  4CJB A;  1O7Q A;  1QGS A;  5CMJ A;  1FO8 A;  2FFU A;  3V0P A;  1H3M A;  5C38 A;  5L6V A;  2XWM A;  4P02 A;  3OKR A;  1H5S A;  4M28 A;  4ARW A;  1MP4 A;  5C36 A;  4B42 A;  1H5S D;  2VFZ A;  4G87 A;  2VSI A;  1G93 A;  4Y6U A;  3R2W A;  4XWI A;  4CJC A;  3IOH A;  2ZU7 A;  1JVD A;  2I7B A;  2Y7A A;  2VSH A;  5C3D A;  3OC9 A;  2E3D A;  4EE5 A;  1V84 A;  1H5S C;  3ZGF A;  3I0J A;  3QVB A;  2WVK A;  2QH5 A;  4C2S A;  4AC3 A;  5HS2 A;  2AE7 A;  2P73 A;  5C1L A;  4FRH A;  3K8D A;  1LL0 A;  4HOC A;  1V82 A;  5FU0 A;  1GQ9 A;  1TW5 A;  3JTJ A;  1R80 A;  1WT1 A;  1HJJ A;  2APC A;  3CKN A;  1OMX A;  3SXE A;  2ZU9 A;  3LW6 A;  5AJN A;  4LW3 A;  4D48 A;  1ZDG A;  1Z90 A;  2O1H A;  3D8V A;  4BQH A;  4KT7 A;  3V8Y A;  1VM8 A;  2RJ9 A;  1E5K A;  1G3L A;  1NHE B;  3CKQ A;  3OH0 A;  1GQC A;  4YS8 A;  1YRO B;  1ZIZ A;  1LZI A;  4HG6 A;  1ZJP A;  2RJ6 A;  2RIT A;  4KPX A;  4FRD A;  1GA8 A;  4KPZ A;  2V0H A;  1LL2 A;  3OH4 A;  2D0J A;  3I0H A;  3SPT A;  1NKH B;  1H5T B;  4JD0 A;  1TVY A;  3D5N A;  1W57 A;  4Y7U A;  3U2V A;  1VZX A;  2VXM A;  3BCV A;  3F1Y A;  4EEG A;  5IFY A;  1ZDF A;  2QKX A;  4KC4 A;  4D0T A;  2XWL A;  4FRA A;  2D7R A;  2FYC B;  1IIM A;  1HJL A;  3OGZ A;  3N9W A;  1ZI3 A;  4HCQ A;  5IDS A;  1WT3 A;  1GX0 A;  2YQC A;  3U0Y A;  4NAI A;  2W0W A;  4EE3 A;  2I5E A;  4FRQ A;  3U0X A;  5C4E A;  2BO7 A;  2P72 A;  4CVH A;  1SS9 A;  3SX3 A;  4FQW A;  1WVC A;  1G97 A;  1ZI5 A;  1MP3 A;  4Y9X A;  4G3Q A;  3I0F A;  1R7Y A;  4P00 A;  3SXC A;  1FZW A;  4B2W A;  3BRK X;  5BXC A;  4AYL A;  3OAM A;  1FGX A;  3O3P A;  2YC5 A;  5CQN X;  2YQH A;  2QGI A;  1YP4 A;  3CU0 A;  4R7P A;  1YP2 A;  2MZB A;  3RMW A;  3V0O A;  1H5R B;  1G23 A;  3SXB A;  4G3P A;  3ZGG A;  5EIY A;  2AEC A;  2FYB A;  4IRQ A;  1FO9 A;  5CMH A;  1LL3 A;  5L6S A;  3D98 A;  2RJ5 A;  1LZJ A;  2J0B A;  4NAL A;  4G3S A;  4HO0 A;  5FTS A;  1R7T A;  1JV1 A;  3SX5 A;  2RJ8 A;  3T7N A;  5C1H A;  5CMG X;  2XME A;  4FRB A;  4CJ8 A;  1H7L A;  1H5T A;  3USQ A;  1ZCV A;  1VPA A;  2WAW A;  4FRM A;  1JYK A;  4B3U A;  1ZJ2 A;  1FG5 N;  2BO4 A;  2Y4M A;  1ZCY A;  1W77 A;  5C3A A;  3U2W A;  1G9R A;  3I0G A;  4M2A A;  1S4O A;  3V91 A;  1XHB A;  1ZJ3 A;  2V0J A;  4FRL A;  4KQL A;  2AM4 A;  5FYE A;  2VS3 A;  1ON8 A;  2W0V A;  5FTV A;  1QG8 A;  4HO6 A;  4B4B A;  5CQP A;  1INI A;  1ZCT A;  4DDZ A;  3TZT A;  1IIN A;  2NXV A;  4D11 A;  2DPW A;  2FYD B;  2AM5 A;  2X5Z A;  2Z86 A;  1H7F A;  4LW6 A;  3U2U A;  1HM0 A;  1QWJ A;  3R3I A;  4FIX A;  3T7O A;  5JQQ A;  4B4G A;  1FR9 A;  4O6M A;  3U2X A;  4GBP A;  3FOQ A;  2RJ0 A;  1EYR A;  4L41 C;  5CQL X;  5CQO A;  4B2X A;  2X5S A;  4UEG A;  2ZU8 A;  1GWV A;  5C4D A;  1G95 A;  1H5R A;  2CU2 A;  5C1G A;  2FFV A;  3I0K A;  5CMI A;  3RSB A;  3IOI A;  3SX8 A;  5DDV A;  5FUH A;  3EE5 A;  4EVW A;  5I1F A;  2Y4J A;  2JCO A;  4O6N A;  1G1L A;  1ZJ0 A;  3I0C A;  5C47 A;  1FGG A;  1GX4 A;  2V0I A;  2YQJ A;  1ZHJ A;  2RJ4 A;  1LZ7 A;  3NGW A;  3PKP A;  4J18 A;  4HO8 A;  2JCK A;  5EJZ A;  1EZI A;  3U2T A;  1XZ6 A;  5C3B A;  2WEE A;  1VGW A;  4D0Z A;  3I0L A;  4HO3 A;  3OH2 A;  2A8U A;  4BMA A;  4Y7T A;  2RIY A;  4AYJ A;  3I0E A;  4M2B A;  1H7T A;  2AM3 A;  2O1G A;  1O7O A;  1FRW A;  1HV9 A;  2UX8 A;  2BO6 A;  3RMV A;  1VGT A;  4ECM A;  2YES A;  2AH9 A;  2OI7 A;  3IOJ A;  1G2V A;  2RIX A;  2XMH A;  3ZF8 A;  2JCJ A;  1H4C A;  4HO2 A;  1W55 A;  2ICX A;  2RJ1 A;  3DK5 A;  2X65 A;  1JV3 A;  5EJ1 A;  1VH3 A;  4AAW A;  1G0R A;  4FCE A;  2BO8 A;  2VXL A;  1ZI4 A;  3GUE A;  1ZCU A;  3CGX A;  4KRV A;  3SXG A;  3OH1 A;  1I52 A;  2J0A A;  2PX7 A;  3V0Q A;  5AJP A;  1R7X A;  3SXA A;  3V0M A;  2Z87 A;  4HO5 A;  2VD4 A;  1V83 A;  4FRO A;  3DUV A;  2ICY A;  4ASY A;  3HL3 A;  4EE4 A;  1H7G A;  1GWW A;  4B4M A;  2Q4J A;  3JUJ A;  1YP3 A;  1ZJO A;  2FYA A;  3I0I X;  4E1K A;  2E8B A;  3ZLK A;  5DDT A;  1R81 A;  2GGQ A;  3E26 A;  3CKO A;  3JUK A;  2AES A;  3Q80 A;  1MC3 A;  2V0K A;  2PGY A;  5C49 A;  1ON6 A;  2AGD A;  4MIX A;  2XWN A;  1R7V A;  1VH1 A;  1ZI1 A;  3CKJ A;  4DE7 A;  2YQS A;  2X60 A;  3SX7 A;  2V0L A;  3F1C A;  5FU8 A;  4NAK A;  5D92 A;  5IDT A;  2C0N A;  2P6W A;  3T7M A;  1H7E A;  2I5K A;  1NMM B;  4Y64 A;  3ST8 A;  4D11 C;  2GGO A;  2Y4L A;  3V8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...