2RJCA

Crystal structure of l3mbtl1 protein in complex with mes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
313
structure length
313
Chain Sequence
b'WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
molecule tags Transcription
source organism Homo sapiens
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
total genus 79
structure length 313
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjcA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjcA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjcA03
2BKDN 3OMCA 3MP8A 4N4IA 5KE2A 3OY9A 2B8AA 4QW2A 5C0MA 2CKKA 2DIGA 3L2WA 2R5MA 3H8ZA 2XK0A 3OS0A 3OYMA 3OYDA 4C5GA 4BDYA 3S3MA 4IUUA 2RJDA 2RHYA 3LLRA 1OZ3A 3DB4A 4QQGA 3OYKA 4QQDA 2EQMA 4FU6A 4B9WA 5KCHA 2XDPA 3ASKA 3MEAA 3NTKA 3QIIA 4C5IA 4C5HA 2X4YA 3MP1A 4X34A 2LTOA 4A4EA 1WGSA 2RJEA 3DB3A 3H6ZA 2QQSA 2WACA 3OYHA 2R5AA 2M1HA 4PLLA 1WJSA 3S3OA 4ZTJA 2L3RA 2E5QA 3GOXA 2EKOA 2P0KA 4IUTA 4Q5WA 2O4XA 3QBYA 4GY5A 4IURA 4QVZA 2EQUA 3F70A 2MWPA 1N27A 2X35A 3L2VA 1MHNA 3LH0A 2F5KA 5J39A 2E6NA 4B9XA 2VYTA 3MO8A 5J26A 2O4XB 4PLIA 4A4FA 3QJ6A 4BACA 2GFAA 4A4HA 3O8VA 4NS5A 3FC3A 3FLGA 4ZTFA 2X4XA 4EDUA 4RG2A 3OYEA 3L2RA 3Q1JA 1OZ2A 5C6SA 1H3ZA 2IG0A 2R58A 3OYLA 3LGFA 4PL6A 2FHDA 3UWNA 5KCOA 3OS2A 5FRNA 5IN1A 4IKFA 4HCZA 5KH6A 2R57A 1G5VA 2YRVA 2G3RA 2GFUA 1WJQA 2LVMA 2PQWA 4E7LA 5D6XA 2M0OA 4E7JA 3UT1A 2D9TA 3L2UA 5IAYA 4E7KA 2GF7A 2M16A 2RHZA 4IUQA 3PFSA 2NLUA 4N4GA 3PMTA 4E7IA 2LCCA 3E9GA 2EQKA 5CIUA 2L89A 3L2QA 2BUDA 3BDLA 3OYIA 2LDMA 2RHXA 2BIVA 3L42A 2K3XA 3OYBA 3LX7A 4BE2A 2QQRA 3OQ5A 3KUFA 2HQEA 4A4GA 5M9OA 3MEUA 3OYCA 1OYXA 2RI5A 3OYAA 2X4WA 2LRQA 3DLMA 3META 3MP6A 3S6WA 2RI3A 2DIQA 3CEYA 2RHUA 4Z02A 3ZEHA 3PNWC 3E9FA 4FL6A 3OYJA 1KHCA 1WJRA 4IUVA 1SSFA 1RI0A 3M9QA 4CRIA 1XNIA 2HQXA 3EAEA 3QKJA 3MEWA 4L59A 3OA6A 2K3YA 2RJFA 3NTHA 3OB9A 2MWOA 5FROA 3LGLA 3NTIA 4OVAA 3LYIA 4C5EA 3P8HA 3SD4A 3FEOA 3OYGA 4LD6A 5KE3A 3S3NA 2RI2A 2L8DA 3ME9A 4IUPA 3FDRA 3P8DA 4II1A 4BDZA 4BE1A 2RHIA 3OMGA 2EFIA 4QQ6A 4BE0A 4BD3A 2EQJA 3OYNA 5D6WA 3PMIA 3OS1A 1OI1A 5D6YA 2JZ2A 2JTFA 4E7HA 3MEVA 2RO0A 4UC4A 4N4HA 5FRMA 3OYFA 3C4SA 2DAQA 2RJCA
chains in the Genus database with same CATH superfamily
1AWWA 4E7SA 1ACMB 3L2WA 4WF2A 2XK0A 2DMOA 4E6RA 2P84A 3EGXB 1E6HA 3TSZA 3JSCA 3X20B 1M2OA 2CUBA 2DJZA 3JB9H 3JCMf 1GFDA 3ZBDA 1CSKA 4PK4A 1M1KR 5GAMf 4FYWB 3BE3A 2K2VA 5GAN5 4IUTA 5GMKe 3RMQA 3QBYA 4IURA 1W6XA 4XTXA 2JOYA 1VQLQ 4ZGDB 2F5KA 2X4JA 3C0CA 3JCMc 3FLGA 2L3QA 4ZTFA 1PHTA 3GIBA 1Q95G 1VQ4T 1VQ7Q 1SKUB 3QYGB 1QKWA 4RCCA 1WLPB 3UWNA 2QGFB 4BY6B 2D8HA 2ZGWA 1W2BA 3CPWS 4E7LA 2DL8A 5FU6C 4C92F 4C92D 3SWNB 2KT1A 5KYWA 2YLCA 2CSQA 2OTJA 4OMPA 4R0KA 4M77B 4XAXB 2LDMA 1PKTA 2M51A 3KUFA 2MMPA 3MP6A 4KGXB 1D3BB 2BE9B 3CBOA 1QCNA 4BI4A 2DIQA 2KY9A 3ZEHA 1VQKT 1JXOA 4OGCA 1XNIA 1QVGA 2CUDA 1LOJA 3CCMQ 5FROA 4PJNA 3VS1A 2KYBA 3VS3A 4XU0A 3FDRA 1JB0E 5KYUA 1AVZC 5CKEA 4E7HA 2RO0A 2KBTA 3JCMX 2EPDA 4LDVA 3CCSQ 1Y07A 1AD5A 4KBMB 1WXBA 2RM4A 3OYMA 4J9BA 3OYDA 4M7DB 2CP3A 4QQDA 2JTEA 4EMKB 1VQ9A 2XDPA 3A8MB 4BI8B 4C5IA 5CK9A 4L5GA 3PE0A 2HNIA 4AFQC 3RKWA 3H0HA 1Q81C 1M5Q1 2IVWA 3VS4A 2QQSA 3OYHA 1WHJA 4HCKA 1WZOA 2KSSA 5IHIA 1I1JA 3PT9A 1UHFA 5GMKm 2RD1A 3E2UA 3EG0A 4MZPA 4NL2A 3SWNC 1NJIU 1BI2A 1V29B 1WA7A 1AWJA 3FIFA 1QWFA 1VQ7T 4GLMA 1M4ZA 4GBQA 1TH7A 3AHUA 3EFSA 1LNXA 3A8HB 3LH5A 5LJ3g 3PVQA 2EGAA 4CC7A 2QG9B 1GCQC 2E5KA 4MZTA 5A0LA 2XG8D 3V8LA 3BW1A 4A63B 5GAMh 1KSWA 4E7KA 1M1FA 1BK2A 4OMFB 4JLGA 4RG8A 2OTLA 1I07A 4E7IA 3CC2Q 2CH4A 3RESA 3JAME 3VUZA 3FB9A 2BIVA 3M57A 1Y57A 2KK4A 3PIOA 2LCSA 3DLMA 4M77D 2JN0A 1EX4A 5GAOl 3C94A 1X75C 4O5VA 1JEGA 3M55A 3CCVA 1N8RR 1KC8C 1S72T 2HZYA 3S3NA 4J9EA 1U06A 3I56Q 4M75D 2KRNA 4FW1A 1MMNA 1PD0A 4N4HA 4ELYC 2DAQA 2NUPB 1M27C 2B8AA 1PSFA 2DKGA 5C0MA 2DF6A 4JJCA 1IGQA 3EG2A 4CI0C 4XTYA 3CXCP 2E1HA 2RHYA 1X43A 2OTLQ 2GBQA 5A2QE 2A08A 2DZCA 1TU0B 1PSEA 4J83A 1SG5A 1W1FA 3DB3A 4M7DD 1D3BA 3GNFB 1QVPA 2HBPA 3R6OA 3UA7A 4HCCA 2LNVA 4M7AD 4BUGA 1YI2Q 4GY5A 4F7UG 3CD6Q 3O5ZA 1RADB 2DD4A 1ZHIA 1XQHA 1K8AR 2M02A 4M75F 2VVKA 4B9XA 2O4XB 2O01E 4A4HA 1NG2A 4EDUA 1M1KU 1OZ2A 4FYXB 2RF0A 3NGPA 4V2SA 3EHQA 2P4TA 4J9GA 3VJPA 3JB9I 1UTIA 1LJOA 1MNEA 1HSQA 2OI3A 4X1VA 5GANj 3NFCA 4E7JA 2A0FB 5GMKh 3EG9A 1T0HA 1Q86U 2J6KA 5CR2A 5FU7C 3HHTB 2ROTA 1VOMA 4JJBA 2PVGB 3OYIA 1HJDA 5KYYB 1AZEA 3CCRA 4XU1A 3RKYA 5HK0A 3CEYA 1K9MC 2F1LA 1N8RU 3HRUA 1N6AA 2YUOA 3NMZC 3QKJA 4Y28E 4E7ZA 2PUOB 2K3YA 2H3EB 2MWOA 1NPPA 2FO0A 3CXCS 1W70A 3V8KA 2ROLA 3X25B 1YCYA 4LE9A 5GMKj 4F04B 3PMIA 4FW2A 3CCJA 4M78A 2AIRB 3QZ5B 5GAMe 2CSIA 4M77E 3JB9G 1NM7A 4C5GA 5GAMj 1OZ3A 1R77A 1M90U 1M2VA 2RK1A 1UUEA 1E6GA 1Y71A 2HBWA 1RAHB 3H9NA 5I21A 3M0SA 4MDWA 1VQ6Q 2AZSA 5KYXB 4DOWA 1M30A 3VS2A 2E3HA 4JZ4A 2VXFA 4LNPA 3VYHB 2F69A 4P5NA 4LN2A 2KYMA 1RAIB 3J7AF 2XDBA 2JS0A 1S72A 1IXDA 4J9FA 1D1AA 4RG2A 3SHWA 3ER0A 1YIJQ 2E70A 1GBRA 2DL3A 3H0IA 2R57A 4M78D 3REBB 2DL4A 3GLXA 2CT3A 3TU4K 1YJNT 2OTJQ 5D6XA 3SFMA 1U8RA 1BBZA 2L5QA 2RHZA 3P8BB 2RNAA 1WQ7A 2XI9A 3PMTA 1T3SA 5LJ5f 3L2QA 4ATOA 3CC7A 1ZSZC 1BI3A 2HDAA 1VQ5T 2BE7D 2CGHA 2EGCA 3M0TA 5LJ5j 3JB9F 2KXDA 4DEYA 1VQ9Q 1RL2A 1NBEB 2X9HA 1WIEA 1NEGA 2YUPA 2EYZA 1VQMA 1CKBA 1JXMA 3EAEA 1O9SA 1VQ7A 1ARKA 1UGSB 1WQWA 3NTHA 2KVQG 3HFOA 5LJ5e 1HYOA 3RMSA 1I81A 1JO8A 3CMAA 2W0ZA 1ZSGA 4BDZA 1YIJA 2K5IA 2EGEA 4BE0A 2ZPIB 1SF9A 3G1JA 2LNHB 3CCRQ 8ATCB 2OAWA 2K57A 3PIPA 2FYKA 1PRMC 3HKSA 4LD9K 3OS5A 2JTMA 5CQXA 5GANh 1TUGB 2V1RA 4C92B 2QDYB 3GNGA 1KIKA 1KC8R 1VQ8Q 4X34A 4WTOB 2DVJA 2KRSA 4ZGJB 3EHRA 4LXCA 2PNIA 5I22A 4JJNK 2M1HA 4CC4B 1VQKQ 1KD1R 4M7AF 1R8OB 2X3XD 3ZFJA 2SEMA 1FMVA 3G4ST 4ESRA 3BFMA 4PLIA 3RDVA 1K73C 4R56A 1HK9A 3FC3A 2BZ8A 4J6YA 2R58A 2ZPBB 3M58A 3OS2A 4M7AG 3OW2A 2EJGA 3M0PA 2L0AA 3GF5A 4HKEA 1GCPA 3M56A 1JRIA 1JU5C 1OU9A 2ATCB 4RTVA 2RQRA 4M7DG 2DVEA 3V7SA 1S72Q 2EQIA 1QP2A 2DE0X 1VQPQ 1M3AA 1MNDA 1AHJB 2ZPGB 3E9GA 2EQKA 1IHVA 3IQLA 2NUTA 5LJ3f 3BDLA 2EJ9A 2ESWA 3L42A 3CCJT 4KH1B 1VQ5Q 1I8FA 2HQHA 4C8QB 1JJ2A 1UG1A 2QI2A 3RNJA 2EW3A 1Q82U 1UDLA 4IUVA 1RI0A 2D6FA 1X6OA 2MK5A 3EGDB 2A37A 2VB6A 1ZSZA 4M7AE 2MAMA 4QQ6A 4BD3A 2EQJA 2EYXA 5D6WA 2DTOA 3OS1A 1MGQA 5GAMg 4N4IA 1ABQA 5IT9E 2AHJB 2DJQA 2L3PA 3VS0A 1YHQA 2NUZA 2QTVA 3OS0A 4JLIA 3C95A 4IUUA 2HCKA 5LJ3h 3NTKA 5DLOA 1V76A 3V7CA 4PJOA 2IIMA 4HA8A 5IHNA 2EYQA 2EKOA 2LJ3A 2RPNA 2XMFA 5A0GA 1OV3A 1Q81U 3THKA 3QZ9B 3QG1A 4PJOF 1XTDA 4C92E 1YI2T 3PGGA 3CCUQ 4PJLA 2HAXA 7AT1B 3EGDA 3I55A 3CPWA 4DEXA 4PJOE 2MPXC 1YITQ 3HSBA 4Z89A 3OBYA 2YRVA 4DA4A 4C0ZA 2J6OA 3VV0A 5FLXE 2QEXA 3CCLT 5CKHA 3CPFA 2YRCA 4DQ2A 1EZZB 2L89A 3HFNA 2K3XA 2QA4A 3EFOA 1OYXA 4C0DC 1VQOA 1OX9A 1YP5A 3V8JA 2D1XA 1GRIA 4XQ3A 4M4ZA 1NE8A 2H3JA 2AT1B 1V1CA 2FPDA 2JVVA 3J80E 4BI3A 4M7AB 2GQIA 4BY6C 3OYJA 4DBFA 3UDCA 2E65A 4F7UE 2ABLA 4M7AA 4X9DA 3P8HA 1VIEA 2RQVA 2HSPA 2RI2A 3C12A 4XTZA 2DBKA 2LQWA 5GJVB 5CCAA 3KFVA 4X9CA 2KQWA 1BI1A 2LP5A 3H8ZA 5GAOq 2YUNA 1M90R 4M7DA 3G71Q 1JJ2S 4BDYA 4RUGA 3OYKA 1UJ0A 1RLPC 5KCHA 2QTXA 1W2BP 3QIIA 1WHLA 4LDYA 1UJYA 4C92G 1UFFA 4A4EA 4Y92A 4M7DF 2K9GA 4M75C 2ZPFB 1RACB 5LJ5g 2GNCA 1G3WA 2L3RA 3M4YA 2CZ0B 1M90C 3MCAB 3CCQT 4VUBA 4D6WA 4Q5WA 3CC2A 1YFNA 2DFUA 2O4XA 3VRYA 2K5FA 1QLYA 3OBWA 2YHTA 3SDZA 1WXTA 2FRWA 2X3WD 3I56T 2Y90A 4J7IA 1GBQA 5J26A 5GAN6 1ZBXA 2DTIA 4BACA 2PVDB 3OW2S 1EFNA 3GPLA 2GTOA 1D1BA 3CC4T 4C8QG 1R0BG 4F16A 3CCRT 1KD1C 1D0XA 3R6NA 1ZX6A 1QVGP 2J05A 1SPKA 2JNGA 3CMAQ 4M78F 1K73R 1KD1U 1SSHA 2D9TA 3JCMe 2K5LA 3M5AA 2NUPA 4FT2A 4IUQA 3TCJA 3T9NA 1NEBA 3GBQA 3H0FA 4OB0B 3RR6A 2PU9B 1NYFA 1X2QA 2Y4XA 2DILA 1D1CA 3G6EA 3BY7A 4A4GA 3MEUA 4OMLA 2LRQA 2OX7A 2VGNA 4IIMA 2JS2A 2V8IA 1UGPB 2ED1A 3M0QA 2QASA 1QKXA 2PZ1A 2QQ9A 4PFOA 3OA6A 1VUBA 4L59A 5I2SA 1PD1A 3CCSA 2QAZA 3X28B 3CCST 4FYVB 2HSEB 5CQYA 2EKHA 2HKNA 3MEVA 5FRMA 4J5YA 1Q81R 2E6ZA 1TG0A 1SHGA 2E41A 5GMKi 2LQKA 4C92A 4RTZA 1X01A 2B86A 4IIOA 1IO6A 3MP1A 4KULA 1VQ6A 1AWXA 1RAEB 1YBYA 4ZNXA 1WJSA 3M59A 5D7UA 3PVLA 2FG0A 3CCQQ 1VQNQ 1T3LA 5GAOp 1LCKA 4AFZC 1UGRB 3AT1B 4XU3A 1QQJA 4KUDK 1IGUA 4A4KA 3TSWA 3KXTA 2X4XA 2ECZA 4KGZB 1LVKA 2QQAA 2FZCB 1FWZA 1D0YA 2XU8A 3LGFA 1PC0A 3RIRA 4CC3A 5IN1A 4M77C 4GLKA 4EPCA 1E7OA 5GAOn 2EVRA 2OTLT 3CCMT 1PKSA 2FPFA 1GCQA 2ZCFB 2BUDA 2GGRA 5CVIA 1H3HA 2I2LA 2F2XA 5HCKA 3CXCA 6AT1B 3X26B 2X4WA 1BIAA 1T0JA 1VQNT 2YUQA 3RKXA 1OU8A 1IREB 1TSFA 1PM3A 2RQTA 3L2ZA 3CC4Q 2BZXA 1SHFA 3JCMQ 5GANe 5HK3A 3FEOA 1FMKA 4JS5A 1X2KA 1VQLT 4M7DC 3M54A 4C0GA 1VYUA 2OAUA 4PKCC 5HY6A 3C4SA 4M7AC 2DD5A 3EFRA 1OPKA 1GFCA 3SWNA 5LJ3e 2COZA 1YITA 2RJDA 3ASKA 2FZGB 3MEAA 1K0XA 2EIFA 1EIFA 1VIFA 2X51A 3HRTA 4PLLA 2C0TA 1UECA 3TVTA 3GOXA 4OB2B 2CS7A 4C8QD 1I0CA 2EQUA 1X27A 1M3BA 1ZSZB 1UHCA 4NS5A 2RN8A 4C8QE 2WSFE 1Q86R 3I56A 2CDTA 2L2PA 4ZGEB 1VQ4Q 1YHQQ 5GANd 3JCMV 2WSCE 4F7UA 5I11A 2PQWA 1Q7YU 4AT1B 1NLOC 1K76A 1M3CA 2DO3A 3L2UA 4OB1B 1VQPT 1KHIA 4JRPA 2DTHA 2J6FA 3FJPA 1Q7YC 3EFOB 3LX7A 2QQRA 3OQ5A 5J3BA 3M0UA 5IXBA 1VQ4A 1ZA2B 4M75G 3E19A 4JJDA 4M7DE 2KGTA 4RMOA 1K4US 5DY9A 3LWIA 2RB6A 5GAN7 3H41A 3M9QA 4CRIA 1YJ9A 3REAB 3WVEB 3OSSC 1S1NA 2RJFA 3QYHB 3CCUT 1WHHA 1H8KA 1Y7XA 4II1A 4JDSA 2EFIA 4ORZA 4RTUA 1OI1A 3QDFA 1TUDA 1Y96B 4UC4A 2GQVA 1WPYA 4M77G 2RJCA 4XTVA 2EYYA 3N5BB 1IZ6A 1JQQA 1U1SA 2A3LA 5FW9A 4LUEA 1KQSA 1NJIR 2DNUA 2ENMA 2HL3A 1PNJA 3DB4A 4C5HA 1UEBA 3CPWP 4RKUE 5L23A 1ZA1B 2R5AA 1M8VA 3VU3C 2NUTB 2EJFA 3VRZA 3VS7A 4A54A 1WDXA 1U5SA 4DOVA 4FIBA 4A53A 1VQ8A 2O9SA 4Z8AA 4J6XA 3FJ5A 4XTUA 1U3OA 5FU7B 3JCMW 4F7UB 1B3QA 2V8JA 2LVMA 5GJWB 4XTWA 1M8MA 2DPPB 1WYXA 2GF7A 2M16A 5I2MA 3G6ET 3PFSA 4ANJA 3UF4A 5GAN3 5CIUA 2DEUA 2O31A 4ELZC 3QDRB 1QW1A 4JRKA 1X6BA 4OMMA 4EMKA 5FU6B 3S6WA 1ZQ1A 2RI3A 2QYZA 1MMAA 1FYNA 1KK7A 4HCBA 1PWTA 2YXYA 1C1AA 5LJ3d 2KROA 4C5EA 3SD4A 1RAGB 1K9MU 2KAFA 2QDLA 4FCYA 4HT9A 2DERA 3I35A 5D6YA 1KC8U 4D8DA 1Y96A 1I5LA 1UE9A 4PJMA 2CZ1B 3MP8A 5KE2A 1RUWA 2V8KA 2C06A 4LDUA 2EYWA 3J81E 1VQPA 3KBGA 1YJWQ 3JB9D 5DM7R 2KE9A 1MMDA 2JMCA 1RAAB 2JT4A 1NJIC 2WACA 1IB8A 4TVRA 1J3TA 1G8XA 1MUZA 2PUKB 1YJNA 3OSVA 2RH2A 2DYIA 3EG1A 2X35A 2DM1A 4OMQA 5J39A 2YLBA 1W2BS 3MO8A 3EH1A 3CCEA 1U1TA 2GFAA 1NLPC 2AKKA 1WI7A 3L2RA 3G4SA 2YDLA 1YJWT 2ZPHB 3OYLA 4PL6A 2FHDA 1ZUYA 5KCOA 2ZAEA 5FRNA 4HCZA 2CREA 3EH2A 2BZYA 2CZ6B 2M0OA 2QA4T 1B34B 3CMEQ 2CP0A 2DZ9A 3TEEA 1Q82R 1N9RA 4OMNA 2LCCA 4HVUA 5GAOm 1DJ7B 2DL7A 3EG9B 5GANf 4FYYB 2CP5A 3OYCA 2A7YA 4J9DA 1CKAA 4DBRA 2CP7A 2QEXT 2V1QA 1BCOA 1YJWA 1RABB 2LQNA 2HKQB 5CO7A 2PVOB 5GAN2 4J9HA 1SSFA 3QUIA 1YIJT 1WHKA 2XDDA 1VQ8T 3BDUA 3I55T 4OGEA 3OYGA 3CMET 4B6MA 1VYTA 4PNOA 1A0NB 3CC2T 2CYZB 3M4GA 3OYNA 2K79A 2JTFA 5CKFA 1QP3A 1H92A 3SEMA 3PTAA 5L8RE 3OYFA 3OMCA 3CC7Q 4PJOC 3G71T 1O75A 2CT4A 4QQGA 4KUIA 1HXDA 3EGXA 2XKOC 4E47A 4C0FA 1WGSA 4M78G 5LL6S 2E5QA 3VKIA 2M9UA 3D7SB 1AWOA 2DYBA 1ZLMA 5GAMd 1K0SA 2H8HA 1YJ9Q 2E6NA 4JPBW 5AT1B 2RMOA 3CBPA 4F7UF 5CAIA 4FSXA 4HT8A 2VKNA 1VQOQ 5EG2A 2YT6A 2FPEA 4ZN3A 2COWA 2DETA 3CQTA 1PCXA 2VV5A 1SRLA 4JUVA 2DK3A 2HEQA 3QJYA 3G71A 4N4GA 3CCLA 1YN8A 4Z88A 2CP6A 2AKLA 2RHXA 2KT8A 4OF1A 2QEXQ 3OYAA 2W10A 4AFSC 4OMOA 1G2BA 2GCXA 1YNZA 2RK2A 3U23A 2ED0A 4PJOB 3E9FA 1QVFS 2G6FX 3I9QA 4OVAA 3E1SA 1QWEA 3LYIA 2C0OA 2LZ6B 4LD6A 4LDXA 1FX7A 2LJ0A 4AFUC 4JS4A 2HMAA 4M78E 9ATCB 1OEBA 2F2VA 1LPLA 4HXJA 3UPUA 3JCMg 2E64A 4F17A 2DRMA 3QWYA 1VA7A 2L3SA 1I4K1 4RTWA 2X4YA 1JBMA 3JCMJ 2LTOA 2O9VA 1NYGA 2EAYA 1GL5A 1QVFP 3TREA 3I55Q 2LCLA 3F70A 1YJ9T 2K6DA 4C92C 3LH0A 1FMWA 3CC4A 1C0MA 1YCSB 4J7FA 3L1AA 4A4FA 5LJ5h 3CCEQ 2DBMA 4XU2A 3JB9J 1PRLC 5DLQE 3Q1JA 4FSSA 4J9CA 3QSUA 1TXQA 2IG0A 4EMKC 1VQ6T 4MDXA 1VQNA 3CCQA 2J7IA 1G3SA 2G3RA 4AMCA 5A0DA 1WJQA 1GXIE 4C8QC 3JCMh 4C0DB 3M0RA 5LJ3j 1YWOA 3VS6A 2ZPEB 1VQ9T 3LWHA 1UB4A 2D0QB 2MI6A 2P4RA 3CCMA 5M9OA 4O6JA 4M77A 1R0CB 2KR3A 3I5RA 3CMEA 2RHUA 3URGA 2F2WA 2LQ8A 2VUBA 1G3YA 4L6V5 1WHGA 3MHXA 2VC8A 3MEWA 3RBBB 4XK8E 4QVDA 1KQSS 3CBMA 1KQSP 4DBQA 3CD6T 2DX1A 1KJWA 2MOXA 5KE3A 1Z9ZA 1IRXA 2LT4A 1F1BB 3P8DA 3CCVT 3QHSA 1TS9A 1RAFB 1Y0MA 2M0YA 3SB2A 4N0AC 2AK5A 1K8AU 3DKMA 4OP0A 2AZVA 3JCMP 1VQKA 2D0NA 2LJ1A 4BE1A 4E2FB 4QW2A 4EIKA 2QXFA 2XIDA 2CKKA 2YRDA 2R5MA 4K11A 2A28A 1TOVA 3S3MA 3LLRA 5GAN8 2VXEA 2EQMA 2JMAA 2OJ2A 3VS5A 1BCMA 2YWWA 2RJEA 1Q7YR 3H6ZA 4ZTJA 3HPWA 1VQLA 1IHWA 4QKUA 4EMHA 2P0KA 1FXXA 3CCET 3HRSA 4C8QF 2MWPA 1N27A 1MHNA 5IH2A 1VQMQ 2V26A 1BYMA 3O8VA 3A98A 1JJ2P 1RLQC 2CP2A 3DLLA 3M53A 3FRNA 4LUDA 1H3ZA 4KRTA 1BB9A 2DXCA 2D8JA 2LX7A 3UATA 2FVUA 5KH6A 4JRIA 2VASA 4YTLA 2GFUA 2KXCA 1XJWB 4M75E 3MKDA 3ULRB 5IAYA 4J8OA 3G6EQ 4FT4A 1P92A 2VGMA 4F14A 2VWFA 5IXFA 1YJNQ 1M2VB 3HTRA 2HQEA 1QCFA 2RI5A 4LDWA 1Q86C 5GAN4 3OW2P 4D8KA 4M78C 1MMGA 1NPRA 2COYA 2RQWA 2QK0A 2J06A 2QQBA 2HQXA 4KT0E 1OX8A 2LC4A 1NZ9A 3RUXA 2MYSA 8AT1B 1K8AC 3NTIA 4PJOG 1UGVA 4QVCA 5KYUB 3ME9A 1N8RC 5GAOr 4NOYA 2KMTA 2RHIA 1PG5B 4BB7A 3QWXX 2RQUA 4PFZA 3VYGA 1X6GA 1OULA 3JRZA 2FRYA 2JM8A 4CC2A 4NL3A 3V7RA 2DIGA 1ABOA 1B34A 2JW4A 2JJ9A 3WXMB 5IHKA 1C6VX 2OTJT 4M77F 3CC7T 4B9WA 2JM9A 5KYYA 2XD0A 2K3BA 2GTJA 4AG1C 3CCJQ 4RTTA 2KRMA 1AOJA 4MMLA 3S3OA 5GMKl 2DXTA 1ZBJA 3LW5E 1X69A 1TUCA 4OB3B 2EWNA 4MZMA 1YI2A 4Y91A 3A1PA 4QVZA 1WHMA 1BKBA 4RCBA 5ECAA 3INZA 2A36A 3A8GB 3RERA 2VYTA 4MMKA 3OYYA 3QJ6A 1Z9QA 4AG2C 4KH0B 1TWBA 4M75B 2XHCA 1OQKA 5C6SA 4EMGA 1WNLA 1QCOA 3QO3A 3UA6A 1G5VA 4IKFA 1BU1A 1WX6A 2FL7A 3UT1A 3QPHA 2QA4Q 2JUFA 1TTHB 3MPUB 2DA9A 1M1GA 3TQ7P 1K9AA 2E3IA 5KYXA 3G7ZA 1QVGS 5LJ5d 1W4SA 3I5SA 3OYBA 2O2OA 1KQ2A 4C8QA 3A8LB 4DBHA 1QMCA 1K1ZA 3L2VA 4BE2A 3HP9A 3CCVQ 1D09B 1M9SA 3WVDB 3X24B 1QVFA 2Y4YA 4Z02A 3CCUA 1AT1B 2C0IA 3PNWC 2YSQA 5GANg 1AEYA 4FL6A 1WJRA 5AYFA 4J9IA 5HKCA 2DXUA 4R55A 2KNBB 1VYVA 2MF2A 2DEQA 3NHNA 4RTYA 2JXBA 4IUPA 1VQMT 3OMGA 2ZZDA 2EBPA 1KFZA 1H641 2FB7A 4PJJA 4QT7A 2XICA 2O88A 2E10A 1N9SA 2P0QA 2BKDN 3OY9A 1B07A 1VQ5A 1D0ZA 2PTKA 3NPFA 5KYNA 1KG1A 2K7AA 2NYSA 2E12A 4FU6A 4HVWA 1YHQT 1RI9A 2LX9A 5KYWB 4WCIA 4JRQA 2DL5A 2P0PA 3HL8A 1K9MR 2KEAA 2HD0A 2CH4W 4KGVB 1ZUUA 1M1KC 2NWMA 2QGGA 5CKBA 2I0NA 4ME7A 4PJOD 2E4HA 4ZN1A 2CZ7B 2MIOA 5FWBA 1SEMA 1B7TA 3CD6A 1VQOT 2K4YA 4J6WA 1XOVA 4M75A 2DLPA 3CCLQ 2F5TX 2Z0WA 1UGQB 1K73U 4RTXA 3QXEB 4FM4B 3A5ZB 2KI7A 1YITT 2KDSA 1MV3A 2NLUA 1G3TA 2BTTA 2K2MA 3VUBA 1WFWA 1YWPA 3EGUA 4JZ3A 2IPOB 1HD3A 1OPLA 3MJXA 2LT1A 5FWCA 4N0AA 3META 2LMJA 2HL5C 3CMAT 4PFPA 1BIBA 1KHCA 1MV0B 3OB9A 3LGLA 3JCMb 3A8OB 5CKDA 2RA2A 2FZKB 1BI0A 1SRMA 2L8DA 2DRKA 5EC7A 1Q82C 1I5OB 3EG3A 3G4SQ 1G83A 1AZGB 3GP8A 2DXBA 2FEIA 2SRCA 2JZ2A 4M78B 3JCMd 1N5ZA 1WXUA 3ZL7C 1ZUKA 2WSEE 1KQ1A 1OOTA 3JV3A 2MCNA 4HVVA 3OYEA
chains in the Genus database with same CATH topology
2DD5A 2K57A 3EFRA 3JCMg 2E64A 2FYKA 3PIPA 3SWNA 3HKSA 3L2WA 5LJ3e 4LD9K 3OS5A 4WF2A 2JTMA 5CQXA 5GANh 2XK0A 1YITA 4C92B 2RJDA 4M7AE 2QDYB 1I4K1 3GNGA 3JSCA 3X20B 3ASKA 3MEAA 2DJZA 2X4YA 1JBMA 2EIFA 4X34A 3JCMf 3JCMJ 1EIFA 2LTOA 4ZGJB 1VIFA 3ZBDA 4JJNK 3HRTA 2M1HA 4PLLA 5GAMf 3GOXA 2EAYA 4OB2B 2K2VA 4M7AF 5GAN5 4IUTA 5GMKe 3RMQA 3QBYA 2CS7A 4IURA 4C8QD 4XTXA 3TREA 1R8OB 2EQUA 2JOYA 2LCLA 3F70A 3ZFJA 1YJ9T 4ZGDB 4C92C 3G4ST 3LH0A 2F5KA 2X4JA 3CC4A 3BFMA 4J7FA 3L1AA 4PLIA 4A4FA 5LJ5h 3JCMc 1K73C 4XU2A 3JB9J 4NS5A 4R56A 1HK9A 2WSFE 3FLGA 4C8QE 3FC3A 4J6YA 5DLQE 4ZTFA 3GIBA 3Q1JA 3I56A 1VQ4T 3QSUA 2IG0A 4ZGEB 2R58A 3QYGB 4EMKC 4RCCA 2ZPBB 3UWNA 3M58A 3OS2A 4BY6B 5GANd 3JCMV 1VQ6T 3OW2A 1VQNA 3CCQA 4M7AG 2EJGA 1G3SA 2WSCE 2ZGWA 2G3RA 3GF5A 4F7UA 4HKEA 5A0DA 3M56A 1JRIA 1WJQA 1W2BA 1GXIE 2PQWA 4C8QC 3JCMh 4C0DB 3CPWS 4E7LA 5LJ3j 1Q7YU 4M7DG 2DVEA 5FU6C 3V7SA 2DO3A 3L2UA 4C92F 4OB1B 4C92D 3SWNB 1VQPT 1KHIA 1QP2A 1AHJB 2ZPEB 2YLCA 2ZPGB 4JRPA 2DTHA 2OTJA 3FJPA 3E9GA 2EQKA 5LJ3f 1VQ9T 4M77B 3BDLA 4XAXB 3LWHA 2LDMA 1UB4A 1Q7YC 2D0QB 2EJ9A 3L42A 3LX7A 2MI6A 3CCJT 2QQRA 3OQ5A 3KUFA 3CCMA 5J3BA 5M9OA 2MMPA 1VQ4A 4O6JA 3MP6A 1I8FA 4M77A 1D3BB 4M75G 3CBOA 3E19A 4BI4A 4C8QB 2DIQA 3CMEA 4M7DE 2KY9A 2RHUA 4RMOA 3URGA 1JJ2A 2QI2A 3ZEHA 1VQKT 5DY9A 3LWIA 2LQ8A 1Q82U 2RB6A 5GAN7 2VUBA 1G3YA 4L6V5 4IUVA 1RI0A 3M9QA 4OGCA 4CRIA 2D6FA 1X6OA 1XNIA 1YJ9A 3MHXA 2VC8A 3MEWA 4XK8E 3OSSC 1LOJA 2RJFA 3WVEB 4QVDA 5FROA 3CBMA 3QYHB 1KQSS 3CCUT 3CD6T 1Y7XA 5KE3A 4XU0A 2LT4A 3FDRA 3P8DA 4II1A 4JDSA 2MAMA 1JB0E 3QHSA 4QQ6A 2EFIA 3CCVT 4BD3A 2EQJA 5CKEA 5D6WA 2DTOA 3SB2A 1OI1A 4N0AC 3OS1A 4E7HA 1MGQA 1K8AU 1Y96B 2RO0A 3DKMA 4OP0A 2GQVA 1WPYA 4UC4A 5GAMg 4M77G 3JCMP 1VQKA 3JCMX 2RJCA 4BE1A 4N4IA 4LDVA 4XTVA 5IT9E 2AHJB 3N5BB 1Y07A 4QW2A 2QXFA 2XIDA 1IZ6A 2CKKA 1U1SA 2R5MA 2A3LA 4KBMB 1YHQA 2RM4A 3OS0A 3OYMA 4JLIA 3OYDA 3C95A 3S3MA 4IUUA 3LLRA 5GAN8 1KQSA 2VXEA 3DB4A 4M7DB 4QQDA 2EQMA 4EMKB 1VQ9A 2XDPA 5LJ3h 3A8MB 3NTKA 4BI8B 4C5IA 4L5GA 4C5HA 5CK9A 2HNIA 5DLOA 1UEBA 3RKWA 1Q81C 2RJEA 1M5Q1 2IVWA 3H6ZA 2QQSA 4RKUE 3OYHA 2R5AA 1M8VA 3VU3C 3V7CA 4ZTJA 3HPWA 2EJFA 1VQLA 2KSSA 4PJOA 4HA8A 4EMHA 3PT9A 2EYQA 5GMKm 2EKOA 2P0KA 2RD1A 4NL2A 4MZPA 4A54A 1FXXA 5A0GA 3HRSA 4C8QF 3CCET 3SWNC 1Q81U 4DOVA 2MWPA 1N27A 1NJIU 1BI2A 1MHNA 1V29B 3QZ9B 3QG1A 4PJOF 3FIFA 4FIBA 1VQ7T 1XTDA 4C92E 1BYMA 1YI2T 3O8VA 3PGGA 4A53A 1M4ZA 1VQ8A 1TH7A 4J6XA 2HAXA 3AHUA 3EFSA 3I55A 1LNXA 3DLLA 1QVGA 3A8HB 3M53A 4XTUA 3CPWA 3FRNA 5LJ3g 4PJOE 1H3ZA 2DXCA 3HSBA 5FU7B 3JCMW 4MZTA 2FVUA 4F7UB 3OBYA 5KH6A 4JRIA 2YRVA 4YTLA 2GFUA 2V8JA 5A0LA 2LVMA 4M75E 4XTWA 2XG8D 4DA4A 4C0ZA 2DPPB 3V8LA 3BW1A 3VV0A 5FLXE 5IAYA 2QEXA 5CKHA 4J8OA 2GF7A 2M16A 5GAMh 3CCLT 1M1FA 3CPFA 5I2MA 4E7KA 4FT4A 1P92A 2VGMA 4JLGA 4OMFB 4RG8A 4DQ2A 3G6ET 3PFSA 2OTLA 4E7IA 5GAN3 5CIUA 3RESA 2L89A 3HFNA 3JAME 3VUZA 4ELZC 3FB9A 2BIVA 1QW1A 2K3XA 3QDRB 4JRKA 2HQEA 2QA4A 3M57A 4EMKA 1OYXA 2RI5A 4C0DC 2KK4A 3JCMb 1VQOA 4LDWA 3PIOA 1Q86C 3V8JA 3DLMA 5FU6B 5GAN4 3S6WA 4XQ3A 1ZQ1A 1NE8A 2JN0A 4M77D 2RI3A 4M78C 5GAOl 3C94A 2H3JA 1X75C 4O5VA 1NPRA 3M55A 4HCBA 2JVVA 3J80E 4BI3A 4M7AB 3OYJA 4BY6C 3UDCA 2QQBA 2HQXA 4KT0E 3CCVA 2LC4A 1KC8C 2E65A 1NZ9A 3RUXA 4F7UE 1K8AC 1S72T 3NTIA 4PJOG 5LJ3d 4M7AA 4X9DA 4C5EA 3P8HA 1VIEA 3SD4A 4QVCA 1K9MU 2KAFA 3S3NA 2RI2A 3ME9A 1N8RC 3C12A 5GAOr 4NOYA 2KMTA 2RHIA 4BB7A 4XTZA 3VYGA 4HT9A 4M75D 5CCAA 5D6YA 1KC8U 3JRZA 4N4HA 1Y96A 4ELYC 1I5LA 2DAQA 4X9CA 5KE2A 2CZ1B 3MP8A 2KQWA 2B8AA 1PSFA 2DKGA 2V8KA 2C06A 5C0MA 4LDUA 4NL3A 3V7RA 2DIGA 1BI1A 1B34A 3H8ZA 5GAOq 4CI0C 4XTYA 2E1HA 4M7DA 3WXMB 3J81E 1JJ2S 4BDYA 1VQPA 2RHYA 3OYKA 2OTJT 4M77F 3KBGA 3CC7T 5A2QE 4B9WA 2QTXA 2DZCA 5KCHA 5DM7R 3JB9D 3QIIA 4LDYA 2XD0A 4C92G 1PSEA 4J83A 4A4EA 3DB3A 1NJIC 4M7DD 2WACA 4M7DF 4M75C 1D3BA 2ZPFB 4TVRA 4MMLA 3GNFB 5LJ5g 2L3RA 1G3WA 1QVPA 2HBPA 3M4YA 2CZ0B 3R6OA 2DXTA 5GMKl 1M90C 4HCCA 2PUKB 2LNVA 3LW5E 3MCAB 4VUBA 3OSVA 4OB3B 3CCQT 2RH2A 2EWNA 4MZMA 4Q5WA 4BUGA 4D6WA 1YI2A 3CC2A 2O4XA 4QVZA 4GY5A 4Y91A 4F7UG 1BKBA 2K5FA 3OBWA 4RCBA 2YHTA 3INZA 2X35A 3SDZA 2DD4A 3I56T 1ZHIA 3A8GB 1XQHA 4M7AD 2Y90A 4J7IA 5J39A 2YLBA 4M75F 4B9XA 2VYTA 1W2BS 3MO8A 5J26A 2O4XB 4MMKA 3OYYA 5GAN6 3QJ6A 1ZBXA 3CCEA 1U1TA 2DTIA 4BACA 2GFAA 2PVDB 2O01E 4A4HA 3OW2S 3GPLA 3CC4T 4C8QG 4EDUA 3L2RA 3G4SA 3CCRT 1KD1C 4M75B 1M1KU 1OZ2A 2XHCA 1YJWT 5C6SA 4EMGA 1WNLA 2ZPHB 3OYLA 4V2SA 2P4TA 4PL6A 2FHDA 3QO3A 5KCOA 3S3OA 3VJPA 2JNGA 3JB9I 5FRNA 1G5VA 4IKFA 4HCZA 1LJOA 4M78F 1YJNA 2CZ6B 1KD1U 5GANj 3NFCA 2FL7A 2M0OA 3UT1A 4E7JA 2D9TA 3JCMe 3QPHA 2JUFA 5GMKh 2K5LA 3M5AA 1B34B 2QA4T 1Q86U 4FT2A 4IUQA 2DZ9A 3T9NA 3TCJA 3TEEA 4OB0B 1N9RA 1M1GA 5CR2A 2PU9B 2LCCA 5FU7C 3HHTB 2Y4XA 3G7ZA 5GAOm 1DJ7B 1QVGS 5GANf 2PVGB 5LJ5d 1W4SA 3OYIA 4MDXA 3OYBA 1KQ2A 4C8QA 3A8LB 3G6EA 4BE2A 3L2VA 3BY7A 3OYCA 4A4GA 2A7YA 3MEUA 3HP9A 2QEXT 2LRQA 1M9SA 2VGNA 3WVDB 3X24B 4XU1A 3CCRA 1QVFA 2Y4YA 2V8IA 3RKYA 5HK0A 3CEYA 4Z02A 1UGPB 1YJWA 1K9MC 3CCUA 3PNWC 1N8RU 5GANg 3HRUA 4FL6A 1N6AA 5CO7A 2QQ9A 2PVOB 1WJRA 5GAN2 1SSFA 5AYFA 3QUIA 5HKCA 3OA6A 1YIJT 1VUBA 2DXUA 3QKJA 4L59A 4Y28E 4R55A 2PUOB 2K3YA 2XDDA 5I2SA 2MWOA 1NPPA 1VQ8T 3CXCS 3BDUA 3CCSA 3I55T 4OGEA 2MF2A 3X28B 2DEQA 3OYGA 3CMET 4PNOA 3V8KA 4IUPA 3CCST 1VQMT 3OMGA 2ZZDA 2CYZB 1YCYA 3M4GA 3X25B 3OYNA 1H641 5GMKj 3CC2T 2FB7A 3PMIA 5CQYA 2JTFA 3CCJA 2XICA 5CKFA 1QP3A 3MEVA 4M78A 3PTAA 5FRMA 3QZ5B 5L8RE 5GAMe 3OYFA 2E10A 2P0QA 1N9SA 4M77E 4J5YA 2BKDN 3OMCA 3OY9A 1VQ5A 2E6ZA 3JB9G 1KG1A 2E41A 5GMKi 3G71T 4PJOC 2LQKA 4C92A 4C5GA 1O75A 5GAMj 4QQGA 4KUIA 1X01A 1OZ3A 2E12A 1M90U 1HXDA 4FU6A 2RK1A 1Y71A 2XKOC 5I21A 3MP1A 4MDWA 4E47A 4KULA 4C0FA 1YHQT 1WGSA 1VQ6A 2LX9A 4M78G 1YBYA 4JRQA 5LL6S 1WJSA 3M59A 4DOWA 2E5QA 2P0PA 3HL8A 3VKIA 2M9UA 2HD0A 2VXFA 3VYHB 5GAOp 2F69A 1M1KC 4P5NA 5GAMd 5CKBA 3J7AF 1UGRB 4XU3A 4ME7A 2XDBA 4PJOD 1S72A 2E6NA 4ZN1A 2CZ7B 4KUDK 4A4KA 3CBPA 3KXTA 2X4XA 4F7UF 5CAIA 2QQAA 4RG2A 3CD6A 1VQOT 2K4YA 4J6WA 3ER0A 4FSXA 1FWZA 1XOVA 2E70A 4M75A 4HT8A 2XU8A 3LGFA 5EG2A 3RIRA 2F5TX 5IN1A 4M77C 4ZN3A 4GLKA 1UGQB 2R57A 4M78D 4EPCA 1K73U 5GAOn 3QXEB 4FM4B 3GLXA 3TU4K 1YJNT 2OTLT 5D6XA 3A5ZB 3RERA 3CCMT 3SFMA 1YITT 2KDSA 2VV5A 4JUVA 2L5QA 2RHZA 3P8BB 1U8RA 2DK3A 1WQ7A 3QJYA 2NLUA 2XI9A 4N4GA 3G71A 3CCLA 1G3TA 3PMTA 2ZCFB 5LJ5f 3L2QA 2BUDA 3VUBA 4ATOA 5CVIA 3CC7A 2RHXA 2I2LA 1BI3A 4OF1A 2LT1A 3CXCA 1VQ5T 3OYAA 4N0AA 3X26B 2X4WA 3META 1BIAA 2CGHA 3JB9H 5LJ5j 3JB9F 2GCXA 1VQNT 2RK2A 1RL2A 3CMAT 3RKXA 4PJOB 3E9FA 1IREB 1BIBA 1KHCA 3L2ZA 1VQMA 3EAEA 1VQ7A 1QVFS 1O9SA 1UGSB 1WQWA 3NTHA 3OB9A 2KVQG 3HFOA 5LJ5e 3E1SA 3LGLA 1I81A 3A8OB 3LYIA 4OVAA 2RA2A 3RMSA 5CKDA 1BI0A 5GANe 5HK3A 3JCMQ 3CMAA 3FEOA 4LD6A 4LDXA 2L8DA 4BDZA 1YIJA 4JS5A 1FX7A 2K5IA 1Q82C 1VQLT 4BE0A 3GP8A 4JS4A 2DXBA 4M7DC 4M78E 2ZPIB 2JZ2A 4M78B 3JCMd 3M54A 4C0GA 2WSEE 2OAUA 1KQ1A 4PKCC 5HY6A 3UPUA 3C4SA 4M7AC 3OYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKD N;  3OMC A;  3MP8 A;  4N4I A;  5KE2 A;  3OY9 A;  2B8A A;  4QW2 A;  5C0M A;  2CKK A;  2DIG A;  3L2W A;  2R5M A;  3H8Z A;  2XK0 A;  3OS0 A;  3OYM A;  3OYD A;  4C5G A;  4BDY A;  3S3M A;  4IUU A;  2RJD A;  2RHY A;  3LLR A;  1OZ3 A;  3DB4 A;  4QQG A;  3OYK A;  4QQD A;  2EQM A;  4FU6 A;  4B9W A;  5KCH A;  2XDP A;  3ASK A;  3MEA A;  3NTK A;  3QII A;  4C5I A;  4C5H A;  2X4Y A;  3MP1 A;  4X34 A;  2LTO A;  4A4E A;  1WGS A;  2RJE A;  3DB3 A;  3H6Z A;  2QQS A;  2WAC A;  3OYH A;  2R5A A;  2M1H A;  4PLL A;  1WJS A;  3S3O A;  4ZTJ A;  2L3R A;  2E5Q A;  3GOX A;  2EKO A;  2P0K A;  4IUT A;  4Q5W A;  2O4X A;  3QBY A;  4GY5 A;  4IUR A;  4QVZ A;  2EQU A;  3F70 A;  2MWP A;  1N27 A;  2X35 A;  3L2V A;  1MHN A;  3LH0 A;  2F5K A;  5J39 A;  2E6N A;  4B9X A;  2VYT A;  3MO8 A;  5J26 A;  2O4X B;  4PLI A;  4A4F A;  3QJ6 A;  4BAC A;  2GFA A;  4A4H A;  3O8V A;  4NS5 A;  3FC3 A;  3FLG A;  4ZTF A;  2X4X A;  4EDU A;  4RG2 A;  3OYE A;  3L2R A;  3Q1J A;  1OZ2 A;  5C6S A;  1H3Z A;  2IG0 A;  2R58 A;  3OYL A;  3LGF A;  4PL6 A;  2FHD A;  3UWN A;  5KCO A;  3OS2 A;  5FRN A;  5IN1 A;  4IKF A;  4HCZ A;  5KH6 A;  2R57 A;  1G5V A;  2YRV A;  2G3R A;  2GFU A;  1WJQ A;  2LVM A;  2PQW A;  4E7L A;  5D6X A;  2M0O A;  4E7J A;  3UT1 A;  2D9T A;  3L2U A;  5IAY A;  4E7K A;  2GF7 A;  2M16 A;  2RHZ A;  4IUQ A;  3PFS A;  2NLU A;  4N4G A;  3PMT A;  4E7I A;  2LCC A;  3E9G A;  2EQK A;  5CIU A;  2L89 A;  3L2Q A;  2BUD A;  3BDL A;  3OYI A;  2LDM A;  2RHX A;  2BIV A;  3L42 A;  2K3X A;  3OYB A;  3LX7 A;  4BE2 A;  2QQR A;  3OQ5 A;  3KUF A;  2HQE A;  4A4G A;  5M9O A;  3MEU A;  3OYC A;  1OYX A;  2RI5 A;  3OYA A;  2X4W A;  2LRQ A;  3DLM A;  3MET A;  3MP6 A;  3S6W A;  2RI3 A;  2DIQ A;  3CEY A;  2RHU A;  4Z02 A;  3ZEH A;  3PNW C;  3E9F A;  4FL6 A;  3OYJ A;  1KHC A;  1WJR A;  4IUV A;  1SSF A;  1RI0 A;  3M9Q A;  4CRI A;  1XNI A;  2HQX A;  3EAE A;  3QKJ A;  3MEW A;  4L59 A;  3OA6 A;  2K3Y A;  2RJF A;  3NTH A;  3OB9 A;  2MWO A;  5FRO A;  3LGL A;  3NTI A;  4OVA A;  3LYI A;  4C5E A;  3P8H A;  3SD4 A;  3FEO A;  3OYG A;  4LD6 A;  5KE3 A;  3S3N A;  2RI2 A;  2L8D A;  3ME9 A;  4IUP A;  3FDR A;  3P8D A;  4II1 A;  4BDZ A;  4BE1 A;  2RHI A;  3OMG A;  2EFI A;  4QQ6 A;  4BE0 A;  4BD3 A;  2EQJ A;  3OYN A;  5D6W A;  3PMI A;  3OS1 A;  1OI1 A;  5D6Y A;  2JZ2 A;  2JTF A;  4E7H A;  3MEV A;  2RO0 A;  4UC4 A;  4N4H A;  5FRM A;  3OYF A;  3C4S A;  2DAQ A;  2RJC A; 
#chains in the Genus database with same CATH topology
 1AWW A;  4E7S A;  1ACM B;  3L2W A;  4WF2 A;  2XK0 A;  2DMO A;  4E6R A;  2P84 A;  3EGX B;  1E6H A;  3TSZ A;  3JSC A;  3X20 B;  1M2O A;  2CUB A;  2DJZ A;  3JB9 H;  3JCM f;  1GFD A;  3ZBD A;  1CSK A;  4PK4 A;  1M1K R;  5GAM f;  4FYW B;  3BE3 A;  2K2V A;  5GAN 5;  4IUT A;  5GMK e;  3RMQ A;  3QBY A;  4IUR A;  1W6X A;  4XTX A;  2JOY A;  1VQL Q;  4ZGD B;  2F5K A;  2X4J A;  3C0C A;  3JCM c;  3FLG A;  2L3Q A;  4ZTF A;  1PHT A;  3GIB A;  1Q95 G;  1VQ4 T;  1VQ7 Q;  1SKU B;  3QYG B;  1QKW A;  4RCC A;  1WLP B;  3UWN A;  2QGF B;  4BY6 B;  2D8H A;  2ZGW A;  1W2B A;  3CPW S;  4E7L A;  2DL8 A;  5FU6 C;  4C92 F;  4C92 D;  3SWN B;  2KT1 A;  5KYW A;  2YLC A;  2CSQ A;  2OTJ A;  4OMP A;  4R0K A;  4M77 B;  4XAX B;  2LDM A;  1PKT A;  2M51 A;  3KUF A;  2MMP A;  3MP6 A;  4KGX B;  1D3B B;  2BE9 B;  3CBO A;  1QCN A;  4BI4 A;  2DIQ A;  2KY9 A;  3ZEH A;  1VQK T;  1JXO A;  4OGC A;  1XNI A;  1QVG A;  2CUD A;  1LOJ A;  3CCM Q;  5FRO A;  4PJN A;  3VS1 A;  2KYB A;  3VS3 A;  4XU0 A;  3FDR A;  1JB0 E;  5KYU A;  1AVZ C;  5CKE A;  4E7H A;  2RO0 A;  2KBT A;  3JCM X;  2EPD A;  4LDV A;  3CCS Q;  1Y07 A;  1AD5 A;  4KBM B;  1WXB A;  2RM4 A;  3OYM A;  4J9B A;  3OYD A;  4M7D B;  2CP3 A;  4QQD A;  2JTE A;  4EMK B;  1VQ9 A;  2XDP A;  3A8M B;  4BI8 B;  4C5I A;  5CK9 A;  4L5G A;  3PE0 A;  2HNI A;  4AFQ C;  3RKW A;  3H0H A;  1Q81 C;  1M5Q 1;  2IVW A;  3VS4 A;  2QQS A;  3OYH A;  1WHJ A;  4HCK A;  1WZO A;  2KSS A;  5IHI A;  1I1J A;  3PT9 A;  1UHF A;  5GMK m;  2RD1 A;  3E2U A;  3EG0 A;  4MZP A;  4NL2 A;  3SWN C;  1NJI U;  1BI2 A;  1V29 B;  1WA7 A;  1AWJ A;  3FIF A;  1QWF A;  1VQ7 T;  4GLM A;  1M4Z A;  4GBQ A;  1TH7 A;  3AHU A;  3EFS A;  1LNX A;  3A8H B;  3LH5 A;  5LJ3 g;  3PVQ A;  2EGA A;  4CC7 A;  2QG9 B;  1GCQ C;  2E5K A;  4MZT A;  5A0L A;  2XG8 D;  3V8L A;  3BW1 A;  4A63 B;  5GAM h;  1KSW A;  4E7K A;  1M1F A;  1BK2 A;  4OMF B;  4JLG A;  4RG8 A;  2OTL A;  1I07 A;  4E7I A;  3CC2 Q;  2CH4 A;  3RES A;  3JAM E;  3VUZ A;  3FB9 A;  2BIV A;  3M57 A;  1Y57 A;  2KK4 A;  3PIO A;  2LCS A;  3DLM A;  4M77 D;  2JN0 A;  1EX4 A;  5GAO l;  3C94 A;  1X75 C;  4O5V A;  1JEG A;  3M55 A;  3CCV A;  1N8R R;  1KC8 C;  1S72 T;  2HZY A;  3S3N A;  4J9E A;  1U06 A;  3I56 Q;  4M75 D;  2KRN A;  4FW1 A;  1MMN A;  1PD0 A;  4N4H A;  4ELY C;  2DAQ A;  2NUP B;  1M27 C;  2B8A A;  1PSF A;  2DKG A;  5C0M A;  2DF6 A;  4JJC A;  1IGQ A;  3EG2 A;  4CI0 C;  4XTY A;  3CXC P;  2E1H A;  2RHY A;  1X43 A;  2OTL Q;  2GBQ A;  5A2Q E;  2A08 A;  2DZC A;  1TU0 B;  1PSE A;  4J83 A;  1SG5 A;  1W1F A;  3DB3 A;  4M7D D;  1D3B A;  3GNF B;  1QVP A;  2HBP A;  3R6O A;  3UA7 A;  4HCC A;  2LNV A;  4M7A D;  4BUG A;  1YI2 Q;  4GY5 A;  4F7U G;  3CD6 Q;  3O5Z A;  1RAD B;  2DD4 A;  1ZHI A;  1XQH A;  1K8A R;  2M02 A;  4M75 F;  2VVK A;  4B9X A;  2O4X B;  2O01 E;  4A4H A;  1NG2 A;  4EDU A;  1M1K U;  1OZ2 A;  4FYX B;  2RF0 A;  3NGP A;  4V2S A;  3EHQ A;  2P4T A;  4J9G A;  3VJP A;  3JB9 I;  1UTI A;  1LJO A;  1MNE A;  1HSQ A;  2OI3 A;  4X1V A;  5GAN j;  3NFC A;  4E7J A;  2A0F B;  5GMK h;  3EG9 A;  1T0H A;  1Q86 U;  2J6K A;  5CR2 A;  5FU7 C;  3HHT B;  2ROT A;  1VOM A;  4JJB A;  2PVG B;  3OYI A;  1HJD A;  5KYY B;  1AZE A;  3CCR A;  4XU1 A;  3RKY A;  5HK0 A;  3CEY A;  1K9M C;  2F1L A;  1N8R U;  3HRU A;  1N6A A;  2YUO A;  3NMZ C;  3QKJ A;  4Y28 E;  4E7Z A;  2PUO B;  2K3Y A;  2H3E B;  2MWO A;  1NPP A;  2FO0 A;  3CXC S;  1W70 A;  3V8K A;  2ROL A;  3X25 B;  1YCY A;  4LE9 A;  5GMK j;  4F04 B;  3PMI A;  4FW2 A;  3CCJ A;  4M78 A;  2AIR B;  3QZ5 B;  5GAM e;  2CSI A;  4M77 E;  3JB9 G;  1NM7 A;  4C5G A;  5GAM j;  1OZ3 A;  1R77 A;  1M90 U;  1M2V A;  2RK1 A;  1UUE A;  1E6G A;  1Y71 A;  2HBW A;  1RAH B;  3H9N A;  5I21 A;  3M0S A;  4MDW A;  1VQ6 Q;  2AZS A;  5KYX B;  4DOW A;  1M30 A;  3VS2 A;  2E3H A;  4JZ4 A;  2VXF A;  4LNP A;  3VYH B;  2F69 A;  4P5N A;  4LN2 A;  2KYM A;  1RAI B;  3J7A F;  2XDB A;  2JS0 A;  1S72 A;  1IXD A;  4J9F A;  1D1A A;  4RG2 A;  3SHW A;  3ER0 A;  1YIJ Q;  2E70 A;  1GBR A;  2DL3 A;  3H0I A;  2R57 A;  4M78 D;  3REB B;  2DL4 A;  3GLX A;  2CT3 A;  3TU4 K;  1YJN T;  2OTJ Q;  5D6X A;  3SFM A;  1U8R A;  1BBZ A;  2L5Q A;  2RHZ A;  3P8B B;  2RNA A;  1WQ7 A;  2XI9 A;  3PMT A;  1T3S A;  5LJ5 f;  3L2Q A;  4ATO A;  3CC7 A;  1ZSZ C;  1BI3 A;  2HDA A;  1VQ5 T;  2BE7 D;  2CGH A;  2EGC A;  3M0T A;  5LJ5 j;  3JB9 F;  2KXD A;  4DEY A;  1VQ9 Q;  1RL2 A;  1NBE B;  2X9H A;  1WIE A;  1NEG A;  2YUP A;  2EYZ A;  1VQM A;  1CKB A;  1JXM A;  3EAE A;  1O9S A;  1VQ7 A;  1ARK A;  1UGS B;  1WQW A;  3NTH A;  2KVQ G;  3HFO A;  5LJ5 e;  1HYO A;  3RMS A;  1I81 A;  1JO8 A;  3CMA A;  2W0Z A;  1ZSG A;  4BDZ A;  1YIJ A;  2K5I A;  2EGE A;  4BE0 A;  2ZPI B;  1SF9 A;  3G1J A;  2LNH B;  3CCR Q;  8ATC B;  2OAW A;  2K57 A;  3PIP A;  2FYK A;  1PRM C;  3HKS A;  4LD9 K;  3OS5 A;  2JTM A;  5CQX A;  5GAN h;  1TUG B;  2V1R A;  4C92 B;  2QDY B;  3GNG A;  1KIK A;  1KC8 R;  1VQ8 Q;  4X34 A;  4WTO B;  2DVJ A;  2KRS A;  4ZGJ B;  3EHR A;  4LXC A;  2PNI A;  5I22 A;  4JJN K;  2M1H A;  4CC4 B;  1VQK Q;  1KD1 R;  4M7A F;  1R8O B;  2X3X D;  3ZFJ A;  2SEM A;  1FMV A;  3G4S T;  4ESR A;  3BFM A;  4PLI A;  3RDV A;  1K73 C;  4R56 A;  1HK9 A;  3FC3 A;  2BZ8 A;  4J6Y A;  2R58 A;  2ZPB B;  3M58 A;  3OS2 A;  4M7A G;  3OW2 A;  2EJG A;  3M0P A;  2L0A A;  3GF5 A;  4HKE A;  1GCP A;  3M56 A;  1JRI A;  1JU5 C;  1OU9 A;  2ATC B;  4RTV A;  2RQR A;  4M7D G;  2DVE A;  3V7S A;  1S72 Q;  2EQI A;  1QP2 A;  2DE0 X;  1VQP Q;  1M3A A;  1MND A;  1AHJ B;  2ZPG B;  3E9G A;  2EQK A;  1IHV A;  3IQL A;  2NUT A;  5LJ3 f;  3BDL A;  2EJ9 A;  2ESW A;  3L42 A;  3CCJ T;  4KH1 B;  1VQ5 Q;  1I8F A;  2HQH A;  4C8Q B;  1JJ2 A;  1UG1 A;  2QI2 A;  3RNJ A;  2EW3 A;  1Q82 U;  1UDL A;  4IUV A;  1RI0 A;  2D6F A;  1X6O A;  2MK5 A;  3EGD B;  2A37 A;  2VB6 A;  1ZSZ A;  4M7A E;  2MAM A;  4QQ6 A;  4BD3 A;  2EQJ A;  2EYX A;  5D6W A;  2DTO A;  3OS1 A;  1MGQ A;  5GAM g;  4N4I A;  1ABQ A;  5IT9 E;  2AHJ B;  2DJQ A;  2L3P A;  3VS0 A;  1YHQ A;  2NUZ A;  2QTV A;  3OS0 A;  4JLI A;  3C95 A;  4IUU A;  2HCK A;  5LJ3 h;  3NTK A;  5DLO A;  1V76 A;  3V7C A;  4PJO A;  2IIM A;  4HA8 A;  5IHN A;  2EYQ A;  2EKO A;  2LJ3 A;  2RPN A;  2XMF A;  5A0G A;  1OV3 A;  1Q81 U;  3THK A;  3QZ9 B;  3QG1 A;  4PJO F;  1XTD A;  4C92 E;  1YI2 T;  3PGG A;  3CCU Q;  4PJL A;  2HAX A;  7AT1 B;  3EGD A;  3I55 A;  3CPW A;  4DEX A;  4PJO E;  2MPX C;  1YIT Q;  3HSB A;  4Z89 A;  3OBY A;  2YRV A;  4DA4 A;  4C0Z A;  2J6O A;  3VV0 A;  5FLX E;  2QEX A;  3CCL T;  5CKH A;  3CPF A;  2YRC A;  4DQ2 A;  1EZZ B;  2L89 A;  3HFN A;  2K3X A;  2QA4 A;  3EFO A;  1OYX A;  4C0D C;  1VQO A;  1OX9 A;  1YP5 A;  3V8J A;  2D1X A;  1GRI A;  4XQ3 A;  4M4Z A;  1NE8 A;  2H3J A;  2AT1 B;  1V1C A;  2FPD A;  2JVV A;  3J80 E;  4BI3 A;  4M7A B;  2GQI A;  4BY6 C;  3OYJ A;  4DBF A;  3UDC A;  2E65 A;  4F7U E;  2ABL A;  4M7A A;  4X9D A;  3P8H A;  1VIE A;  2RQV A;  2HSP A;  2RI2 A;  3C12 A;  4XTZ A;  2DBK A;  2LQW A;  5GJV B;  5CCA A;  3KFV A;  4X9C A;  2KQW A;  1BI1 A;  2LP5 A;  3H8Z A;  5GAO q;  2YUN A;  1M90 R;  4M7D A;  3G71 Q;  1JJ2 S;  4BDY A;  4RUG A;  3OYK A;  1UJ0 A;  1RLP C;  5KCH A;  2QTX A;  1W2B P;  3QII A;  1WHL A;  4LDY A;  1UJY A;  4C92 G;  1UFF A;  4A4E A;  4Y92 A;  4M7D F;  2K9G A;  4M75 C;  2ZPF B;  1RAC B;  5LJ5 g;  2GNC A;  1G3W A;  2L3R A;  3M4Y A;  2CZ0 B;  1M90 C;  3MCA B;  3CCQ T;  4VUB A;  4D6W A;  4Q5W A;  3CC2 A;  1YFN A;  2DFU A;  2O4X A;  3VRY A;  2K5F A;  1QLY A;  3OBW A;  2YHT A;  3SDZ A;  1WXT A;  2FRW A;  2X3W D;  3I56 T;  2Y90 A;  4J7I A;  1GBQ A;  5J26 A;  5GAN 6;  1ZBX A;  2DTI A;  4BAC A;  2PVD B;  3OW2 S;  1EFN A;  3GPL A;  2GTO A;  1D1B A;  3CC4 T;  4C8Q G;  1R0B G;  4F16 A;  3CCR T;  1KD1 C;  1D0X A;  3R6N A;  1ZX6 A;  1QVG P;  2J05 A;  1SPK A;  2JNG A;  3CMA Q;  4M78 F;  1K73 R;  1KD1 U;  1SSH A;  2D9T A;  3JCM e;  2K5L A;  3M5A A;  2NUP A;  4FT2 A;  4IUQ A;  3TCJ A;  3T9N A;  1NEB A;  3GBQ A;  3H0F A;  4OB0 B;  3RR6 A;  2PU9 B;  1NYF A;  1X2Q A;  2Y4X A;  2DIL A;  1D1C A;  3G6E A;  3BY7 A;  4A4G A;  3MEU A;  4OML A;  2LRQ A;  2OX7 A;  2VGN A;  4IIM A;  2JS2 A;  2V8I A;  1UGP B;  2ED1 A;  3M0Q A;  2QAS A;  1QKX A;  2PZ1 A;  2QQ9 A;  4PFO A;  3OA6 A;  1VUB A;  4L59 A;  5I2S A;  1PD1 A;  3CCS A;  2QAZ A;  3X28 B;  3CCS T;  4FYV B;  2HSE B;  5CQY A;  2EKH A;  2HKN A;  3MEV A;  5FRM A;  4J5Y A;  1Q81 R;  2E6Z A;  1TG0 A;  1SHG A;  2E41 A;  5GMK i;  2LQK A;  4C92 A;  4RTZ A;  1X01 A;  2B86 A;  4IIO A;  1IO6 A;  3MP1 A;  4KUL A;  1VQ6 A;  1AWX A;  1RAE B;  1YBY A;  4ZNX A;  1WJS A;  3M59 A;  5D7U A;  3PVL A;  2FG0 A;  3CCQ Q;  1VQN Q;  1T3L A;  5GAO p;  1LCK A;  4AFZ C;  1UGR B;  3AT1 B;  4XU3 A;  1QQJ A;  4KUD K;  1IGU A;  4A4K A;  3TSW A;  3KXT A;  2X4X A;  2ECZ A;  4KGZ B;  1LVK A;  2QQA A;  2FZC B;  1FWZ A;  1D0Y A;  2XU8 A;  3LGF A;  1PC0 A;  3RIR A;  4CC3 A;  5IN1 A;  4M77 C;  4GLK A;  4EPC A;  1E7O A;  5GAO n;  2EVR A;  2OTL T;  3CCM T;  1PKS A;  2FPF A;  1GCQ A;  2ZCF B;  2BUD A;  2GGR A;  5CVI A;  1H3H A;  2I2L A;  2F2X A;  5HCK A;  3CXC A;  6AT1 B;  3X26 B;  2X4W A;  1BIA A;  1T0J A;  1VQN T;  2YUQ A;  3RKX A;  1OU8 A;  1IRE B;  1TSF A;  1PM3 A;  2RQT A;  3L2Z A;  3CC4 Q;  2BZX A;  1SHF A;  3JCM Q;  5GAN e;  5HK3 A;  3FEO A;  1FMK A;  4JS5 A;  1X2K A;  1VQL T;  4M7D C;  3M54 A;  4C0G A;  1VYU A;  2OAU A;  4PKC C;  5HY6 A;  3C4S A;  4M7A C;  2DD5 A;  3EFR A;  1OPK A;  1GFC A;  3SWN A;  5LJ3 e;  2COZ A;  1YIT A;  2RJD A;  3ASK A;  2FZG B;  3MEA A;  1K0X A;  2EIF A;  1EIF A;  1VIF A;  2X51 A;  3HRT A;  4PLL A;  2C0T A;  1UEC A;  3TVT A;  3GOX A;  4OB2 B;  2CS7 A;  4C8Q D;  1I0C A;  2EQU A;  1X27 A;  1M3B A;  1ZSZ B;  1UHC A;  4NS5 A;  2RN8 A;  4C8Q E;  2WSF E;  1Q86 R;  3I56 A;  2CDT A;  2L2P A;  4ZGE B;  1VQ4 Q;  1YHQ Q;  5GAN d;  3JCM V;  2WSC E;  4F7U A;  5I11 A;  2PQW A;  1Q7Y U;  4AT1 B;  1NLO C;  1K76 A;  1M3C A;  2DO3 A;  3L2U A;  4OB1 B;  1VQP T;  1KHI A;  4JRP A;  2DTH A;  2J6F A;  3FJP A;  1Q7Y C;  3EFO B;  3LX7 A;  2QQR A;  3OQ5 A;  5J3B A;  3M0U A;  5IXB A;  1VQ4 A;  1ZA2 B;  4M75 G;  3E19 A;  4JJD A;  4M7D E;  2KGT A;  4RMO A;  1K4U S;  5DY9 A;  3LWI A;  2RB6 A;  5GAN 7;  3H41 A;  3M9Q A;  4CRI A;  1YJ9 A;  3REA B;  3WVE B;  3OSS C;  1S1N A;  2RJF A;  3QYH B;  3CCU T;  1WHH A;  1H8K A;  1Y7X A;  4II1 A;  4JDS A;  2EFI A;  4ORZ A;  4RTU A;  1OI1 A;  3QDF A;  1TUD A;  1Y96 B;  4UC4 A;  2GQV A;  1WPY A;  4M77 G;  2RJC A;  4XTV A;  2EYY A;  3N5B B;  1IZ6 A;  1JQQ A;  1U1S A;  2A3L A;  5FW9 A;  4LUE A;  1KQS A;  1NJI R;  2DNU A;  2ENM A;  2HL3 A;  1PNJ A;  3DB4 A;  4C5H A;  1UEB A;  3CPW P;  4RKU E;  5L23 A;  1ZA1 B;  2R5A A;  1M8V A;  3VU3 C;  2NUT B;  2EJF A;  3VRZ A;  3VS7 A;  4A54 A;  1WDX A;  1U5S A;  4DOV A;  4FIB A;  4A53 A;  1VQ8 A;  2O9S A;  4Z8A A;  4J6X A;  3FJ5 A;  4XTU A;  1U3O A;  5FU7 B;  3JCM W;  4F7U B;  1B3Q A;  2V8J A;  2LVM A;  5GJW B;  4XTW A;  1M8M A;  2DPP B;  1WYX A;  2GF7 A;  2M16 A;  5I2M A;  3G6E T;  3PFS A;  4ANJ A;  3UF4 A;  5GAN 3;  5CIU A;  2DEU A;  2O31 A;  4ELZ C;  3QDR B;  1QW1 A;  4JRK A;  1X6B A;  4OMM A;  4EMK A;  5FU6 B;  3S6W A;  1ZQ1 A;  2RI3 A;  2QYZ A;  1MMA A;  1FYN A;  1KK7 A;  4HCB A;  1PWT A;  2YXY A;  1C1A A;  5LJ3 d;  2KRO A;  4C5E A;  3SD4 A;  1RAG B;  1K9M U;  2KAF A;  2QDL A;  4FCY A;  4HT9 A;  2DER A;  3I35 A;  5D6Y A;  1KC8 U;  4D8D A;  1Y96 A;  1I5L A;  1UE9 A;  4PJM A;  2CZ1 B;  3MP8 A;  5KE2 A;  1RUW A;  2V8K A;  2C06 A;  4LDU A;  2EYW A;  3J81 E;  1VQP A;  3KBG A;  1YJW Q;  3JB9 D;  5DM7 R;  2KE9 A;  1MMD A;  2JMC A;  1RAA B;  2JT4 A;  1NJI C;  2WAC A;  1IB8 A;  4TVR A;  1J3T A;  1G8X A;  1MUZ A;  2PUK B;  1YJN A;  3OSV A;  2RH2 A;  2DYI A;  3EG1 A;  2X35 A;  2DM1 A;  4OMQ A;  5J39 A;  2YLB A;  1W2B S;  3MO8 A;  3EH1 A;  3CCE A;  1U1T A;  2GFA A;  1NLP C;  2AKK A;  1WI7 A;  3L2R A;  3G4S A;  2YDL A;  1YJW T;  2ZPH B;  3OYL A;  4PL6 A;  2FHD A;  1ZUY A;  5KCO A;  2ZAE A;  5FRN A;  4HCZ A;  2CRE A;  3EH2 A;  2BZY A;  2CZ6 B;  2M0O A;  2QA4 T;  1B34 B;  3CME Q;  2CP0 A;  2DZ9 A;  3TEE A;  1Q82 R;  1N9R A;  4OMN A;  2LCC A;  4HVU A;  5GAO m;  1DJ7 B;  2DL7 A;  3EG9 B;  5GAN f;  4FYY B;  2CP5 A;  3OYC A;  2A7Y A;  4J9D A;  1CKA A;  4DBR A;  2CP7 A;  2QEX T;  2V1Q A;  1BCO A;  1YJW A;  1RAB B;  2LQN A;  2HKQ B;  5CO7 A;  2PVO B;  5GAN 2;  4J9H A;  1SSF A;  3QUI A;  1YIJ T;  1WHK A;  2XDD A;  1VQ8 T;  3BDU A;  3I55 T;  4OGE A;  3OYG A;  3CME T;  4B6M A;  1VYT A;  4PNO A;  1A0N B;  3CC2 T;  2CYZ B;  3M4G A;  3OYN A;  2K79 A;  2JTF A;  5CKF A;  1QP3 A;  1H92 A;  3SEM A;  3PTA A;  5L8R E;  3OYF A;  3OMC A;  3CC7 Q;  4PJO C;  3G71 T;  1O75 A;  2CT4 A;  4QQG A;  4KUI A;  1HXD A;  3EGX A;  2XKO C;  4E47 A;  4C0F A;  1WGS A;  4M78 G;  5LL6 S;  2E5Q A;  3VKI A;  2M9U A;  3D7S B;  1AWO A;  2DYB A;  1ZLM A;  5GAM d;  1K0S A;  2H8H A;  1YJ9 Q;  2E6N A;  4JPB W;  5AT1 B;  2RMO A;  3CBP A;  4F7U F;  5CAI A;  4FSX A;  4HT8 A;  2VKN A;  1VQO Q;  5EG2 A;  2YT6 A;  2FPE A;  4ZN3 A;  2COW A;  2DET A;  3CQT A;  1PCX A;  2VV5 A;  1SRL A;  4JUV A;  2DK3 A;  2HEQ A;  3QJY A;  3G71 A;  4N4G A;  3CCL A;  1YN8 A;  4Z88 A;  2CP6 A;  2AKL A;  2RHX A;  2KT8 A;  4OF1 A;  2QEX Q;  3OYA A;  2W10 A;  4AFS C;  4OMO A;  1G2B A;  2GCX A;  1YNZ A;  2RK2 A;  3U23 A;  2ED0 A;  4PJO B;  3E9F A;  1QVF S;  2G6F X;  3I9Q A;  4OVA A;  3E1S A;  1QWE A;  3LYI A;  2C0O A;  2LZ6 B;  4LD6 A;  4LDX A;  1FX7 A;  2LJ0 A;  4AFU C;  4JS4 A;  2HMA A;  4M78 E;  9ATC B;  1OEB A;  2F2V A;  1LPL A;  4HXJ A;  3UPU A;  3JCM g;  2E64 A;  4F17 A;  2DRM A;  3QWY A;  1VA7 A;  2L3S A;  1I4K 1;  4RTW A;  2X4Y A;  1JBM A;  3JCM J;  2LTO A;  2O9V A;  1NYG A;  2EAY A;  1GL5 A;  1QVF P;  3TRE A;  3I55 Q;  2LCL A;  3F70 A;  1YJ9 T;  2K6D A;  4C92 C;  3LH0 A;  1FMW A;  3CC4 A;  1C0M A;  1YCS B;  4J7F A;  3L1A A;  4A4F A;  5LJ5 h;  3CCE Q;  2DBM A;  4XU2 A;  3JB9 J;  1PRL C;  5DLQ E;  3Q1J A;  4FSS A;  4J9C A;  3QSU A;  1TXQ A;  2IG0 A;  4EMK C;  1VQ6 T;  4MDX A;  1VQN A;  3CCQ A;  2J7I A;  1G3S A;  2G3R A;  4AMC A;  5A0D A;  1WJQ A;  1GXI E;  4C8Q C;  3JCM h;  4C0D B;  3M0R A;  5LJ3 j;  1YWO A;  3VS6 A;  2ZPE B;  1VQ9 T;  3LWH A;  1UB4 A;  2D0Q B;  2MI6 A;  2P4R A;  3CCM A;  5M9O A;  4O6J A;  4M77 A;  1R0C B;  2KR3 A;  3I5R A;  3CME A;  2RHU A;  3URG A;  2F2W A;  2LQ8 A;  2VUB A;  1G3Y A;  4L6V 5;  1WHG A;  3MHX A;  2VC8 A;  3MEW A;  3RBB B;  4XK8 E;  4QVD A;  1KQS S;  3CBM A;  1KQS P;  4DBQ A;  3CD6 T;  2DX1 A;  1KJW A;  2MOX A;  5KE3 A;  1Z9Z A;  1IRX A;  2LT4 A;  1F1B B;  3P8D A;  3CCV T;  3QHS A;  1TS9 A;  1RAF B;  1Y0M A;  2M0Y A;  3SB2 A;  4N0A C;  2AK5 A;  1K8A U;  3DKM A;  4OP0 A;  2AZV A;  3JCM P;  1VQK A;  2D0N A;  2LJ1 A;  4BE1 A;  4E2F B;  4QW2 A;  4EIK A;  2QXF A;  2XID A;  2CKK A;  2YRD A;  2R5M A;  4K11 A;  2A28 A;  1TOV A;  3S3M A;  3LLR A;  5GAN 8;  2VXE A;  2EQM A;  2JMA A;  2OJ2 A;  3VS5 A;  1BCM A;  2YWW A;  2RJE A;  1Q7Y R;  3H6Z A;  4ZTJ A;  3HPW A;  1VQL A;  1IHW A;  4QKU A;  4EMH A;  2P0K A;  1FXX A;  3CCE T;  3HRS A;  4C8Q F;  2MWP A;  1N27 A;  1MHN A;  5IH2 A;  1VQM Q;  2V26 A;  1BYM A;  3O8V A;  3A98 A;  1JJ2 P;  1RLQ C;  2CP2 A;  3DLL A;  3M53 A;  3FRN A;  4LUD A;  1H3Z A;  4KRT A;  1BB9 A;  2DXC A;  2D8J A;  2LX7 A;  3UAT A;  2FVU A;  5KH6 A;  4JRI A;  2VAS A;  4YTL A;  2GFU A;  2KXC A;  1XJW B;  4M75 E;  3MKD A;  3ULR B;  5IAY A;  4J8O A;  3G6E Q;  4FT4 A;  1P92 A;  2VGM A;  4F14 A;  2VWF A;  5IXF A;  1YJN Q;  1M2V B;  3HTR A;  2HQE A;  1QCF A;  2RI5 A;  4LDW A;  1Q86 C;  5GAN 4;  3OW2 P;  4D8K A;  4M78 C;  1MMG A;  1NPR A;  2COY A;  2RQW A;  2QK0 A;  2J06 A;  2QQB A;  2HQX A;  4KT0 E;  1OX8 A;  2LC4 A;  1NZ9 A;  3RUX A;  2MYS A;  8AT1 B;  1K8A C;  3NTI A;  4PJO G;  1UGV A;  4QVC A;  5KYU B;  3ME9 A;  1N8R C;  5GAO r;  4NOY A;  2KMT A;  2RHI A;  1PG5 B;  4BB7 A;  3QWX X;  2RQU A;  4PFZ A;  3VYG A;  1X6G A;  1OUL A;  3JRZ A;  2FRY A;  2JM8 A;  4CC2 A;  4NL3 A;  3V7R A;  2DIG A;  1ABO A;  1B34 A;  2JW4 A;  2JJ9 A;  3WXM B;  5IHK A;  1C6V X;  2OTJ T;  4M77 F;  3CC7 T;  4B9W A;  2JM9 A;  5KYY A;  2XD0 A;  2K3B A;  2GTJ A;  4AG1 C;  3CCJ Q;  4RTT A;  2KRM A;  1AOJ A;  4MML A;  3S3O A;  5GMK l;  2DXT A;  1ZBJ A;  3LW5 E;  1X69 A;  1TUC A;  4OB3 B;  2EWN A;  4MZM A;  1YI2 A;  4Y91 A;  3A1P A;  4QVZ A;  1WHM A;  1BKB A;  4RCB A;  5ECA A;  3INZ A;  2A36 A;  3A8G B;  3RER A;  2VYT A;  4MMK A;  3OYY A;  3QJ6 A;  1Z9Q A;  4AG2 C;  4KH0 B;  1TWB A;  4M75 B;  2XHC A;  1OQK A;  5C6S A;  4EMG A;  1WNL A;  1QCO A;  3QO3 A;  3UA6 A;  1G5V A;  4IKF A;  1BU1 A;  1WX6 A;  2FL7 A;  3UT1 A;  3QPH A;  2QA4 Q;  2JUF A;  1TTH B;  3MPU B;  2DA9 A;  1M1G A;  3TQ7 P;  1K9A A;  2E3I A;  5KYX A;  3G7Z A;  1QVG S;  5LJ5 d;  1W4S A;  3I5S A;  3OYB A;  2O2O A;  1KQ2 A;  4C8Q A;  3A8L B;  4DBH A;  1QMC A;  1K1Z A;  3L2V A;  4BE2 A;  3HP9 A;  3CCV Q;  1D09 B;  1M9S A;  3WVD B;  3X24 B;  1QVF A;  2Y4Y A;  4Z02 A;  3CCU A;  1AT1 B;  2C0I A;  3PNW C;  2YSQ A;  5GAN g;  1AEY A;  4FL6 A;  1WJR A;  5AYF A;  4J9I A;  5HKC A;  2DXU A;  4R55 A;  2KNB B;  1VYV A;  2MF2 A;  2DEQ A;  3NHN A;  4RTY A;  2JXB A;  4IUP A;  1VQM T;  3OMG A;  2ZZD A;  2EBP A;  1KFZ A;  1H64 1;  2FB7 A;  4PJJ A;  4QT7 A;  2XIC A;  2O88 A;  2E10 A;  1N9S A;  2P0Q A;  2BKD N;  3OY9 A;  1B07 A;  1VQ5 A;  1D0Z A;  2PTK A;  3NPF A;  5KYN A;  1KG1 A;  2K7A A;  2NYS A;  2E12 A;  4FU6 A;  4HVW A;  1YHQ T;  1RI9 A;  2LX9 A;  5KYW B;  4WCI A;  4JRQ A;  2DL5 A;  2P0P A;  3HL8 A;  1K9M R;  2KEA A;  2HD0 A;  2CH4 W;  4KGV B;  1ZUU A;  1M1K C;  2NWM A;  2QGG A;  5CKB A;  2I0N A;  4ME7 A;  4PJO D;  2E4H A;  4ZN1 A;  2CZ7 B;  2MIO A;  5FWB A;  1SEM A;  1B7T A;  3CD6 A;  1VQO T;  2K4Y A;  4J6W A;  1XOV A;  4M75 A;  2DLP A;  3CCL Q;  2F5T X;  2Z0W A;  1UGQ B;  1K73 U;  4RTX A;  3QXE B;  4FM4 B;  3A5Z B;  2KI7 A;  1YIT T;  2KDS A;  1MV3 A;  2NLU A;  1G3T A;  2BTT A;  2K2M A;  3VUB A;  1WFW A;  1YWP A;  3EGU A;  4JZ3 A;  2IPO B;  1HD3 A;  1OPL A;  3MJX A;  2LT1 A;  5FWC A;  4N0A A;  3MET A;  2LMJ A;  2HL5 C;  3CMA T;  4PFP A;  1BIB A;  1KHC A;  1MV0 B;  3OB9 A;  3LGL A;  3JCM b;  3A8O B;  5CKD A;  2RA2 A;  2FZK B;  1BI0 A;  1SRM A;  2L8D A;  2DRK A;  5EC7 A;  1Q82 C;  1I5O B;  3EG3 A;  3G4S Q;  1G83 A;  1AZG B;  3GP8 A;  2DXB A;  2FEI A;  2SRC A;  2JZ2 A;  4M78 B;  3JCM d;  1N5Z A;  1WXU A;  3ZL7 C;  1ZUK A;  2WSE E;  1KQ1 A;  1OOT A;  3JV3 A;  2MCN A;  4HVV A;  3OYE A; 
#chains in the Genus database with same CATH homology
 2DD5 A;  2K57 A;  3EFR A;  3JCM g;  2E64 A;  2FYK A;  3PIP A;  3SWN A;  3HKS A;  3L2W A;  5LJ3 e;  4LD9 K;  3OS5 A;  4WF2 A;  2JTM A;  5CQX A;  5GAN h;  2XK0 A;  1YIT A;  4C92 B;  2RJD A;  4M7A E;  2QDY B;  1I4K 1;  3GNG A;  3JSC A;  3X20 B;  3ASK A;  3MEA A;  2DJZ A;  2X4Y A;  1JBM A;  2EIF A;  4X34 A;  3JCM f;  3JCM J;  1EIF A;  2LTO A;  4ZGJ B;  1VIF A;  3ZBD A;  4JJN K;  3HRT A;  2M1H A;  4PLL A;  5GAM f;  3GOX A;  2EAY A;  4OB2 B;  2K2V A;  4M7A F;  5GAN 5;  4IUT A;  5GMK e;  3RMQ A;  3QBY A;  2CS7 A;  4IUR A;  4C8Q D;  4XTX A;  3TRE A;  1R8O B;  2EQU A;  2JOY A;  2LCL A;  3F70 A;  3ZFJ A;  1YJ9 T;  4ZGD B;  4C92 C;  3G4S T;  3LH0 A;  2F5K A;  2X4J A;  3CC4 A;  3BFM A;  4J7F A;  3L1A A;  4PLI A;  4A4F A;  5LJ5 h;  3JCM c;  1K73 C;  4XU2 A;  3JB9 J;  4NS5 A;  4R56 A;  1HK9 A;  2WSF E;  3FLG A;  4C8Q E;  3FC3 A;  4J6Y A;  5DLQ E;  4ZTF A;  3GIB A;  3Q1J A;  3I56 A;  1VQ4 T;  3QSU A;  2IG0 A;  4ZGE B;  2R58 A;  3QYG B;  4EMK C;  4RCC A;  2ZPB B;  3UWN A;  3M58 A;  3OS2 A;  4BY6 B;  5GAN d;  3JCM V;  1VQ6 T;  3OW2 A;  1VQN A;  3CCQ A;  4M7A G;  2EJG A;  1G3S A;  2WSC E;  2ZGW A;  2G3R A;  3GF5 A;  4F7U A;  4HKE A;  5A0D A;  3M56 A;  1JRI A;  1WJQ A;  1W2B A;  1GXI E;  2PQW A;  4C8Q C;  3JCM h;  4C0D B;  3CPW S;  4E7L A;  5LJ3 j;  1Q7Y U;  4M7D G;  2DVE A;  5FU6 C;  3V7S A;  2DO3 A;  3L2U A;  4C92 F;  4OB1 B;  4C92 D;  3SWN B;  1VQP T;  1KHI A;  1QP2 A;  1AHJ B;  2ZPE B;  2YLC A;  2ZPG B;  4JRP A;  2DTH A;  2OTJ A;  3FJP A;  3E9G A;  2EQK A;  5LJ3 f;  1VQ9 T;  4M77 B;  3BDL A;  4XAX B;  3LWH A;  2LDM A;  1UB4 A;  1Q7Y C;  2D0Q B;  2EJ9 A;  3L42 A;  3LX7 A;  2MI6 A;  3CCJ T;  2QQR A;  3OQ5 A;  3KUF A;  3CCM A;  5J3B A;  5M9O A;  2MMP A;  1VQ4 A;  4O6J A;  3MP6 A;  1I8F A;  4M77 A;  1D3B B;  4M75 G;  3CBO A;  3E19 A;  4BI4 A;  4C8Q B;  2DIQ A;  3CME A;  4M7D E;  2KY9 A;  2RHU A;  4RMO A;  3URG A;  1JJ2 A;  2QI2 A;  3ZEH A;  1VQK T;  5DY9 A;  3LWI A;  2LQ8 A;  1Q82 U;  2RB6 A;  5GAN 7;  2VUB A;  1G3Y A;  4L6V 5;  4IUV A;  1RI0 A;  3M9Q A;  4OGC A;  4CRI A;  2D6F A;  1X6O A;  1XNI A;  1YJ9 A;  3MHX A;  2VC8 A;  3MEW A;  4XK8 E;  3OSS C;  1LOJ A;  2RJF A;  3WVE B;  4QVD A;  5FRO A;  3CBM A;  3QYH B;  1KQS S;  3CCU T;  3CD6 T;  1Y7X A;  5KE3 A;  4XU0 A;  2LT4 A;  3FDR A;  3P8D A;  4II1 A;  4JDS A;  2MAM A;  1JB0 E;  3QHS A;  4QQ6 A;  2EFI A;  3CCV T;  4BD3 A;  2EQJ A;  5CKE A;  5D6W A;  2DTO A;  3SB2 A;  1OI1 A;  4N0A C;  3OS1 A;  4E7H A;  1MGQ A;  1K8A U;  1Y96 B;  2RO0 A;  3DKM A;  4OP0 A;  2GQV A;  1WPY A;  4UC4 A;  5GAM g;  4M77 G;  3JCM P;  1VQK A;  3JCM X;  2RJC A;  4BE1 A;  4N4I A;  4LDV A;  4XTV A;  5IT9 E;  2AHJ B;  3N5B B;  1Y07 A;  4QW2 A;  2QXF A;  2XID A;  1IZ6 A;  2CKK A;  1U1S A;  2R5M A;  2A3L A;  4KBM B;  1YHQ A;  2RM4 A;  3OS0 A;  3OYM A;  4JLI A;  3OYD A;  3C95 A;  3S3M A;  4IUU A;  3LLR A;  5GAN 8;  1KQS A;  2VXE A;  3DB4 A;  4M7D B;  4QQD A;  2EQM A;  4EMK B;  1VQ9 A;  2XDP A;  5LJ3 h;  3A8M B;  3NTK A;  4BI8 B;  4C5I A;  4L5G A;  4C5H A;  5CK9 A;  2HNI A;  5DLO A;  1UEB A;  3RKW A;  1Q81 C;  2RJE A;  1M5Q 1;  2IVW A;  3H6Z A;  2QQS A;  4RKU E;  3OYH A;  2R5A A;  1M8V A;  3VU3 C;  3V7C A;  4ZTJ A;  3HPW A;  2EJF A;  1VQL A;  2KSS A;  4PJO A;  4HA8 A;  4EMH A;  3PT9 A;  2EYQ A;  5GMK m;  2EKO A;  2P0K A;  2RD1 A;  4NL2 A;  4MZP A;  4A54 A;  1FXX A;  5A0G A;  3HRS A;  4C8Q F;  3CCE T;  3SWN C;  1Q81 U;  4DOV A;  2MWP A;  1N27 A;  1NJI U;  1BI2 A;  1MHN A;  1V29 B;  3QZ9 B;  3QG1 A;  4PJO F;  3FIF A;  4FIB A;  1VQ7 T;  1XTD A;  4C92 E;  1BYM A;  1YI2 T;  3O8V A;  3PGG A;  4A53 A;  1M4Z A;  1VQ8 A;  1TH7 A;  4J6X A;  2HAX A;  3AHU A;  3EFS A;  3I55 A;  1LNX A;  3DLL A;  1QVG A;  3A8H B;  3M53 A;  4XTU A;  3CPW A;  3FRN A;  5LJ3 g;  4PJO E;  1H3Z A;  2DXC A;  3HSB A;  5FU7 B;  3JCM W;  4MZT A;  2FVU A;  4F7U B;  3OBY A;  5KH6 A;  4JRI A;  2YRV A;  4YTL A;  2GFU A;  2V8J A;  5A0L A;  2LVM A;  4M75 E;  4XTW A;  2XG8 D;  4DA4 A;  4C0Z A;  2DPP B;  3V8L A;  3BW1 A;  3VV0 A;  5FLX E;  5IAY A;  2QEX A;  5CKH A;  4J8O A;  2GF7 A;  2M16 A;  5GAM h;  3CCL T;  1M1F A;  3CPF A;  5I2M A;  4E7K A;  4FT4 A;  1P92 A;  2VGM A;  4JLG A;  4OMF B;  4RG8 A;  4DQ2 A;  3G6E T;  3PFS A;  2OTL A;  4E7I A;  5GAN 3;  5CIU A;  3RES A;  2L89 A;  3HFN A;  3JAM E;  3VUZ A;  4ELZ C;  3FB9 A;  2BIV A;  1QW1 A;  2K3X A;  3QDR B;  4JRK A;  2HQE A;  2QA4 A;  3M57 A;  4EMK A;  1OYX A;  2RI5 A;  4C0D C;  2KK4 A;  3JCM b;  1VQO A;  4LDW A;  3PIO A;  1Q86 C;  3V8J A;  3DLM A;  5FU6 B;  5GAN 4;  3S6W A;  4XQ3 A;  1ZQ1 A;  1NE8 A;  2JN0 A;  4M77 D;  2RI3 A;  4M78 C;  5GAO l;  3C94 A;  2H3J A;  1X75 C;  4O5V A;  1NPR A;  3M55 A;  4HCB A;  2JVV A;  3J80 E;  4BI3 A;  4M7A B;  3OYJ A;  4BY6 C;  3UDC A;  2QQB A;  2HQX A;  4KT0 E;  3CCV A;  2LC4 A;  1KC8 C;  2E65 A;  1NZ9 A;  3RUX A;  4F7U E;  1K8A C;  1S72 T;  3NTI A;  4PJO G;  5LJ3 d;  4M7A A;  4X9D A;  4C5E A;  3P8H A;  1VIE A;  3SD4 A;  4QVC A;  1K9M U;  2KAF A;  3S3N A;  2RI2 A;  3ME9 A;  1N8R C;  3C12 A;  5GAO r;  4NOY A;  2KMT A;  2RHI A;  4BB7 A;  4XTZ A;  3VYG A;  4HT9 A;  4M75 D;  5CCA A;  5D6Y A;  1KC8 U;  3JRZ A;  4N4H A;  1Y96 A;  4ELY C;  1I5L A;  2DAQ A;  4X9C A;  5KE2 A;  2CZ1 B;  3MP8 A;  2KQW A;  2B8A A;  1PSF A;  2DKG A;  2V8K A;  2C06 A;  5C0M A;  4LDU A;  4NL3 A;  3V7R A;  2DIG A;  1BI1 A;  1B34 A;  3H8Z A;  5GAO q;  4CI0 C;  4XTY A;  2E1H A;  4M7D A;  3WXM B;  3J81 E;  1JJ2 S;  4BDY A;  1VQP A;  2RHY A;  3OYK A;  2OTJ T;  4M77 F;  3KBG A;  3CC7 T;  5A2Q E;  4B9W A;  2QTX A;  2DZC A;  5KCH A;  5DM7 R;  3JB9 D;  3QII A;  4LDY A;  2XD0 A;  4C92 G;  1PSE A;  4J83 A;  4A4E A;  3DB3 A;  1NJI C;  4M7D D;  2WAC A;  4M7D F;  4M75 C;  1D3B A;  2ZPF B;  4TVR A;  4MML A;  3GNF B;  5LJ5 g;  2L3R A;  1G3W A;  1QVP A;  2HBP A;  3M4Y A;  2CZ0 B;  3R6O A;  2DXT A;  5GMK l;  1M90 C;  4HCC A;  2PUK B;  2LNV A;  3LW5 E;  3MCA B;  4VUB A;  3OSV A;  4OB3 B;  3CCQ T;  2RH2 A;  2EWN A;  4MZM A;  4Q5W A;  4BUG A;  4D6W A;  1YI2 A;  3CC2 A;  2O4X A;  4QVZ A;  4GY5 A;  4Y91 A;  4F7U G;  1BKB A;  2K5F A;  3OBW A;  4RCB A;  2YHT A;  3INZ A;  2X35 A;  3SDZ A;  2DD4 A;  3I56 T;  1ZHI A;  3A8G B;  1XQH A;  4M7A D;  2Y90 A;  4J7I A;  5J39 A;  2YLB A;  4M75 F;  4B9X A;  2VYT A;  1W2B S;  3MO8 A;  5J26 A;  2O4X B;  4MMK A;  3OYY A;  5GAN 6;  3QJ6 A;  1ZBX A;  3CCE A;  1U1T A;  2DTI A;  4BAC A;  2GFA A;  2PVD B;  2O01 E;  4A4H A;  3OW2 S;  3GPL A;  3CC4 T;  4C8Q G;  4EDU A;  3L2R A;  3G4S A;  3CCR T;  1KD1 C;  4M75 B;  1M1K U;  1OZ2 A;  2XHC A;  1YJW T;  5C6S A;  4EMG A;  1WNL A;  2ZPH B;  3OYL A;  4V2S A;  2P4T A;  4PL6 A;  2FHD A;  3QO3 A;  5KCO A;  3S3O A;  3VJP A;  2JNG A;  3JB9 I;  5FRN A;  1G5V A;  4IKF A;  4HCZ A;  1LJO A;  4M78 F;  1YJN A;  2CZ6 B;  1KD1 U;  5GAN j;  3NFC A;  2FL7 A;  2M0O A;  3UT1 A;  4E7J A;  2D9T A;  3JCM e;  3QPH A;  2JUF A;  5GMK h;  2K5L A;  3M5A A;  1B34 B;  2QA4 T;  1Q86 U;  4FT2 A;  4IUQ A;  2DZ9 A;  3T9N A;  3TCJ A;  3TEE A;  4OB0 B;  1N9R A;  1M1G A;  5CR2 A;  2PU9 B;  2LCC A;  5FU7 C;  3HHT B;  2Y4X A;  3G7Z A;  5GAO m;  1DJ7 B;  1QVG S;  5GAN f;  2PVG B;  5LJ5 d;  1W4S A;  3OYI A;  4MDX A;  3OYB A;  1KQ2 A;  4C8Q A;  3A8L B;  3G6E A;  4BE2 A;  3L2V A;  3BY7 A;  3OYC A;  4A4G A;  2A7Y A;  3MEU A;  3HP9 A;  2QEX T;  2LRQ A;  1M9S A;  2VGN A;  3WVD B;  3X24 B;  4XU1 A;  3CCR A;  1QVF A;  2Y4Y A;  2V8I A;  3RKY A;  5HK0 A;  3CEY A;  4Z02 A;  1UGP B;  1YJW A;  1K9M C;  3CCU A;  3PNW C;  1N8R U;  5GAN g;  3HRU A;  4FL6 A;  1N6A A;  5CO7 A;  2QQ9 A;  2PVO B;  1WJR A;  5GAN 2;  1SSF A;  5AYF A;  3QUI A;  5HKC A;  3OA6 A;  1YIJ T;  1VUB A;  2DXU A;  3QKJ A;  4L59 A;  4Y28 E;  4R55 A;  2PUO B;  2K3Y A;  2XDD A;  5I2S A;  2MWO A;  1NPP A;  1VQ8 T;  3CXC S;  3BDU A;  3CCS A;  3I55 T;  4OGE A;  2MF2 A;  3X28 B;  2DEQ A;  3OYG A;  3CME T;  4PNO A;  3V8K A;  4IUP A;  3CCS T;  1VQM T;  3OMG A;  2ZZD A;  2CYZ B;  1YCY A;  3M4G A;  3X25 B;  3OYN A;  1H64 1;  5GMK j;  3CC2 T;  2FB7 A;  3PMI A;  5CQY A;  2JTF A;  3CCJ A;  2XIC A;  5CKF A;  1QP3 A;  3MEV A;  4M78 A;  3PTA A;  5FRM A;  3QZ5 B;  5L8R E;  5GAM e;  3OYF A;  2E10 A;  2P0Q A;  1N9S A;  4M77 E;  4J5Y A;  2BKD N;  3OMC A;  3OY9 A;  1VQ5 A;  2E6Z A;  3JB9 G;  1KG1 A;  2E41 A;  5GMK i;  3G71 T;  4PJO C;  2LQK A;  4C92 A;  4C5G A;  1O75 A;  5GAM j;  4QQG A;  4KUI A;  1X01 A;  1OZ3 A;  2E12 A;  1M90 U;  1HXD A;  4FU6 A;  2RK1 A;  1Y71 A;  2XKO C;  5I21 A;  3MP1 A;  4MDW A;  4E47 A;  4KUL A;  4C0F A;  1YHQ T;  1WGS A;  1VQ6 A;  2LX9 A;  4M78 G;  1YBY A;  4JRQ A;  5LL6 S;  1WJS A;  3M59 A;  4DOW A;  2E5Q A;  2P0P A;  3HL8 A;  3VKI A;  2M9U A;  2HD0 A;  2VXF A;  3VYH B;  5GAO p;  2F69 A;  1M1K C;  4P5N A;  5GAM d;  5CKB A;  3J7A F;  1UGR B;  4XU3 A;  4ME7 A;  2XDB A;  4PJO D;  1S72 A;  2E6N A;  4ZN1 A;  2CZ7 B;  4KUD K;  4A4K A;  3CBP A;  3KXT A;  2X4X A;  4F7U F;  5CAI A;  2QQA A;  4RG2 A;  3CD6 A;  1VQO T;  2K4Y A;  4J6W A;  3ER0 A;  4FSX A;  1FWZ A;  1XOV A;  2E70 A;  4M75 A;  4HT8 A;  2XU8 A;  3LGF A;  5EG2 A;  3RIR A;  2F5T X;  5IN1 A;  4M77 C;  4ZN3 A;  4GLK A;  1UGQ B;  2R57 A;  4M78 D;  4EPC A;  1K73 U;  5GAO n;  3QXE B;  4FM4 B;  3GLX A;  3TU4 K;  1YJN T;  2OTL T;  5D6X A;  3A5Z B;  3RER A;  3CCM T;  3SFM A;  1YIT T;  2KDS A;  2VV5 A;  4JUV A;  2L5Q A;  2RHZ A;  3P8B B;  1U8R A;  2DK3 A;  1WQ7 A;  3QJY A;  2NLU A;  2XI9 A;  4N4G A;  3G71 A;  3CCL A;  1G3T A;  3PMT A;  2ZCF B;  5LJ5 f;  3L2Q A;  2BUD A;  3VUB A;  4ATO A;  5CVI A;  3CC7 A;  2RHX A;  2I2L A;  1BI3 A;  4OF1 A;  2LT1 A;  3CXC A;  1VQ5 T;  3OYA A;  4N0A A;  3X26 B;  2X4W A;  3MET A;  1BIA A;  2CGH A;  3JB9 H;  5LJ5 j;  3JB9 F;  2GCX A;  1VQN T;  2RK2 A;  1RL2 A;  3CMA T;  3RKX A;  4PJO B;  3E9F A;  1IRE B;  1BIB A;  1KHC A;  3L2Z A;  1VQM A;  3EAE A;  1VQ7 A;  1QVF S;  1O9S A;  1UGS B;  1WQW A;  3NTH A;  3OB9 A;  2KVQ G;  3HFO A;  5LJ5 e;  3E1S A;  3LGL A;  1I81 A;  3A8O B;  3LYI A;  4OVA A;  2RA2 A;  3RMS A;  5CKD A;  1BI0 A;  5GAN e;  5HK3 A;  3JCM Q;  3CMA A;  3FEO A;  4LD6 A;  4LDX A;  2L8D A;  4BDZ A;  1YIJ A;  4JS5 A;  1FX7 A;  2K5I A;  1Q82 C;  1VQL T;  4BE0 A;  3GP8 A;  4JS4 A;  2DXB A;  4M7D C;  4M78 E;  2ZPI B;  2JZ2 A;  4M78 B;  3JCM d;  3M54 A;  4C0G A;  2WSE E;  2OAU A;  1KQ1 A;  4PKC C;  5HY6 A;  3UPU A;  3C4S A;  4M7A C;  3OYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...