2RJCA

Crystal structure of l3mbtl1 protein in complex with mes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
313
structure length
313
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 79
structure length 313
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjcA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjcA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjcA03
2B8AA 4QQ6A 2R57A 5FRNA 3L42A 2RHZA 3META 4BD3A 2RI3A 2X4WA 3ASKA 3S3NA 4PL6A 1G5VA 3LGFA 2BIVA 4A4HA 4A4FA 4C5HA 4N4GA 3OYIA 1H3ZA 1MHNA 1XNIA 3FDRA 3OY9A 3S6WA 2RO0A 2E5QA 5KE2A 4ZTJA 1OZ3A 3FLGA 2EKOA 2IG0A 5C6SA 2GF7A 2LVMA 2R5MA 2K3YA 1WJQA 3EAEA 4IUQA 3QIIA 2O4XB 4A4EA 2D9TA 2RJEA 2RJFA 3OYLA 4E7LA 3OQ5A 3OYFA 4E7HA 3MEVA 4RG2A 2WACA 3Q1JA 5D6YA 5J39A 3MP1A 3DLMA 3OYCA 4BDYA 5KE3A 2RJCA 4X34A 5KH6A 2RI5A 1RI0A 3L2QA 3UT1A 2L8DA 2L89A 3L2VA 2RI2A 4N4HA 2LDMA 1OYXA 2G3RA 3DB4A 2NLUA 2XK0A 3LYIA 4L59A 4LD6A 1WJSA 2DIGA 3OYHA 3PFSA 2P0KA 4FU6A 5J26A 4QQGA 3OYEA 2EQJA 2JTFA 5FRMA 3MEWA 3LGLA 3OB9A 2LTOA 3MEUA 2BKDN 4FL6A 3UWNA 4NS5A 5CIUA 2M1HA 2RHYA 1SSFA 5IN1A 4BE2A 2LCCA 3OYAA 2QQRA 2RJDA 3LX7A 3QJ6A 2EFIA 4GY5A 2L3RA 3KUFA 3MO8A 2X4XA 2VYTA 3QBYA 3FC3A 1KHCA 2O4XA 2GFUA 4B9WA 3LLRA 4E7JA 4C5IA 4Q5WA 5M9OA 2JZ2A 2EQMA 4IUPA 4A4GA 4PLIA 3L2RA 2CKKA 2RHUA 2DAQA 3O8VA 3P8HA 2QQSA 3E9GA 3ZEHA 4EDUA 2R5AA 3S3MA 5C0MA 3NTKA 4E7KA 5KCHA 3OS2A 4Z02A 4N4IA 3OA6A 4QQDA 2BUDA 3H6ZA 2LRQA 2F5KA 2MWOA 3MP8A 4C5GA 4QW2A 3NTIA 3OYJA 1OZ2A 4IUTA 3PNWC 4IURA 3L2UA 5KCOA 3OYKA 4BACA 4BE0A 3P8DA 3OMGA 3OMCA 4IKFA 3OYBA 4BDZA 4ZTFA 4BE1A 2GFAA 3CEYA 5IAYA 2R58A 2X4YA 3BDLA 2XDPA 3F70A 3OS0A 5FROA 2K3XA 3OS1A 2M0OA 2RHIA 3S3OA 2HQEA 3C4SA 1WGSA 4IUUA 3E9FA 4QVZA 4UC4A 3MEAA 4C5EA 3OYNA 3OYDA 1OI1A 2E6NA 4CRIA 3PMTA 3FEOA 4E7IA 3GOXA 2EQUA 3LH0A 5D6WA 2MWPA 2FHDA 5D6XA 1WJRA 2DIQA 3L2WA 2HQXA 3QKJA 4IUVA 3OYMA 3M9QA 3OYGA 2YRVA 4OVAA 3ME9A 3NTHA 3SD4A 2RHXA 3H8ZA 4II1A 2X35A 1N27A 3MP6A 2M16A 4B9XA 4PLLA 2EQKA 2PQWA 3PMIA 4HCZA 3DB3A
chains in the Genus database with same CATH superfamily
2FL7A 2AT1B 3META 4M77C 4XTUA 2QI2A 1NYGA 4A4HA 2A0FB 4N4GA 1MNDA 1OU9A 3SB2A 2EVRA 3VS6A 3RUXA 5KE2A 2RNAA 1PG5B 2Z0WA 2K3YA 1WJQA 2MK5A 1U8RA 1Q82R 2MMPA 4PJJA 2YT6A 4OGCA 4M75A 3JCMg 1H641 4PJOA 4OB3B 1D1BA 2HDAA 1K9AA 4HA8A 4M75D 3QYGB 3LYIA 1KG1A 4JRIA 2F2VA 3CCQT 1K73U 4OB0B 2KR3A 1HJDA 2LTOA 1QVGS 2VASA 2LCCA 5I21A 1X01A 1K9MU 2KNBB 2QQRA 1X6OA 7AT1B 4DEYA 5IT9E 2KT1A 5KYXB 5A0GA 4PJOB 1B34B 1VQ9T 3C94A 3VS3A 2QTXA 1V76A 1MGQA 1VQ8T 6AT1B 3ZEHA 4XTYA 4C92A 2DJQA 2PU9B 4QQDA 1HD3A 3RKXA 2QA4A 4C5GA 3I55Q 4IUTA 5KCOA 1ZLMA 2FG0A 2KMTA 3M55A 4A53A 5GJVB 5GANg 1XTDA 1Z9ZA 3ZBDA 1ZUYA 4IUUA 2M51A 2XDDA 1K73R 2CT4A 3VKIA 5KYWA 1ARKA 3ULRB 4J9DA 1KFZA 1K9MR 1I0CA 1VQPQ 4M7DC 2KVQG 5LJ3h 3H8ZA 3M0PA 1TTHB 3OBWA 1VQ4A 1MV0B 4LDVA 1B07A 4DOWA 1OULA 2RQTA 1G5VA 4C0DB 1I4K1 5CQXA 2BIVA 4A4FA 1RAFB 4KH1B 1H3ZA 3GIBA 4J6YA 4B6MA 5KYYA 4BI3A 2DMOA 1NLOC 3EFRA 2QYZA 3PVQA 1GFCA 1FWZA 2KYMA 3G1JA 4M77G 2LT4A 1W4SA 2WACA 4BY6B 5D6YA 3DLMA 1IHWA 2EKHA 4M7AF 2FRWA 2RJCA 3EFOA 5I22A 2YXYA 4BI8B 2B86A 2GQVA 2SEMA 3UT1A 1PRMC 2RI2A 2DYIA 2LDMA 1YP5A 4J7IA 2VWFA 1WQWA 3CQTA 5LJ5g 1NLPC 1M90C 1E6GA 4R55A 1G83A 5EC7A 2E1HA 2H3EB 3MEUA 1X43A 4QVDA 4ORZA 3OBYA 1SSFA 2K4YA 2JS0A 4EMKA 1VQMT 4KBMB 2X51A 4CI0C 3V7SA 4C0ZA 1WX6A 2JZ2A 1X69A 5A2QE 1K0SA 3SDZA 4F7UG 1KQSS 1V29B 3KXTA 2BUDA 4K11A 5LJ5h 5DM7R 2WSEE 1M9SA 1IB8A 3BE3A 3OYJA 4IURA 1YHQT 3CCUT 1YIJQ 1W70A 4ZTFA 1QW1A 1C1AA 1B3QA 5A0DA 1A0NB 2YUQA 1FXXA 3CCLT 3QG1A 3OS1A 2COWA 1QMCA 2OI3A 5HY6A 2FPDA 3E9FA 4OMFB 2E6NA 4OMOA 2XG8D 3PMTA 1M1KC 2JTEA 1CSKA 1BK2A 1OQKA 2IIMA 5HCKA 2K5IA 1EX4A 5I2MA 2V8KA 4DQ2A 4ANJA 3SD4A 5GANh 2DXBA 4M78G 1QP3A 4M7AC 2COYA 1UHCA 2PNIA 2A36A 3DB3A 1UGSB 1P92A 2LT1A 2RQRA 3L42A 3S3NA 2X4WA 2DTHA 4GBQA 2HD0A 4M75G 2HAXA 3M5AA 4PJOE 1PSEA 2E12A 2FPFA 4FYWB 1RABB 1QKXA 2D8HA 2VUBA 2F5TX 2P84A 1VQKT 2FYKA 4M7DF 4C8QE 5FWBA 3JRZA 3VUBA 2DE0X 4PJMA 3PFSA 4PK4A 2RD1A 5FLXE 1O75A 2HL5C 2DA9A 4M77F 3FJPA 1KHIA 4C0FA 1VYVA 3UA7A 3LLRA 4BB7A 1ZUKA 4J9HA 4CC4B 4KUIA 3L2RA 4HVWA 4M7AA 2DAQA 4DBFA 1JJ2A 3RERA 5KCHA 3EHQA 2O01E 3HRTA 3H6ZA 2AK5A 2LMJA 3ER0A 3P8DA 5IHIA 3A8LB 1KC8U 8ATCB 1JB0E 3CMAQ 4BE1A 3TU4K 3CC4Q 1WZOA 2M0OA 2RHIA 1I81A 2BE9B 3OYNA 1Q82U 3JAME 3E19A 1ZSZB 3CCLQ 2EYQA 2FRYA 3CPFA 5LJ3e 2X35A 1N27A 4XAXB 2KSSA 3PMIA 1UJYA 2CDTA 3CCRT 1D1AA 3FJ5A 4M77B 2DZCA 2KDSA 4C8QG 4XU1A 1BIAA 4C92E 1YITA 2Y4XA 5FU6C 1UGVA 4ZTJA 3GP8A 1AWOA 1ZA1B 3FLGA 1LJOA 2DL5A 3MEVA 3G4ST 2F2WA 3Q1JA 1GXIE 5CVIA 2E5KA 5KYUA 4J5YA 5CR2A 1SRLA 4MZMA 1VQ8A 2QDYB 4F17A 5CKBA 1QVGP 2CP6A 2CT3A 4C8QB 1VQ5A 4M7DE 5EG2A 2HEQA 4AG1C 1JJ2P 4FL6A 2COZA 3M54A 3HSBA 4J8OA 1H8KA 2EPDA 1NJIU 3R6OA 1JJ2S 3JCMc 2JN0A 2CYZB 1YJWQ 4LDUA 4Q5WA 5M9OA 1JU5C 4PJOF 1HYOA 2KAFA 5GAN8 2FZGB 1PD1A 1QVFA 2A28A 1WLPB 2DF6A 3RMSA 2NUPA 4FSXA 2GCXA 3OA6A 1QVFP 3SHWA 4RTXA 3CCMT 1XQHA 4WF2A 3I55T 1K0XA 1LOJA 1SF9A 2FPEA 2JTMA 5KYNA 1M27C 3PT9A 2DBKA 1D09B 2DL4A 3M58A 1QCNA 2LQKA 4M7AD 2J05A 1S1NA 3A8OB 4MZPA 4E7IA 4A54A 4QKUA 3UPUA 2K9GA 1K4US 5GAMh 3OYMA 2RQWA 2XU8A 4OMLA 2RHXA 4AG2C 2JM9A 2M16A 1YIJT 1WI7A 2QGGA 4BD3A 1SRMA 1ABOA 2FEIA 3OY9A 2K6DA 4JRKA 2K3BA 2IG0A 2K57A 2RM4A 1BB9A 2LVMA 4JJCA 2L3PA 1X2QA 4RG2A 2EWNA 1Q7YC 1DJ7B 2RH2A 5GAN5 1BCOA 2DPPB 3X20B 3CCJA 3JB9I 3OYHA 4M78C 1UJ0A 3FB9A 4NL2A 2BKDN 5GANd 4RTZA 1RLPC 1X6GA 1RACB 2M1HA 3M0QA 5GAMj 1YI2Q 4BE2A 2HNIA 1QVGA 4DEXA 1M1GA 1NZ9A 2CZ0B 2ZPFB 1K8AC 2ZPBB 1ACMB 2JVVA 5LJ3f 2MIOA 2YWWA 1QKWA 3SEMA 8AT1B 2LRQA 3QHSA 5LJ3g 3I35A 3UDCA 1D3BA 4WCIA 1QWFA 2O88A 4FW2A 2DLPA 2ZPIB 3NMZC 5LJ5j 3BDLA 1OEBA 2EYWA 3UA6A 3MEAA 1VQLQ 2RN8A 2K2VA 2IPOB 3HHTB 1AT1B 1T0JA 1K1ZA 5D6WA 2MWPA 4JZ3A 5J3BA 5GANj 3NFCA 1JXOA 3EFOB 1IZ6A 2HQHA 3NTHA 2QASA 2NUZA 1YBYA 1NE8A 2HSPA 1UG1A 1N8RU 1GFDA 1FX7A 5GAMe 2HBPA 3VS2A 4PL6A 1AOJA 3HRUA 1W2BA 2AHJB 4ESRA 4MMLA 2P4RA 4HXJA 4OB2B 1IHVA 2MPXC 3CCMA 5D7UA 2DNUA 4J9GA 2R5MA 3RBBB 1U1TA 3EAEA 4XK8E 4O5VA 2XD0A 1RLQC 4F04B 1BBZA 3QWYA 4DBQA 3G71T 1WHLA 4XU2A 3DLLA 4NL3A 1WFWA 2L0AA 4OMPA 1W6XA 4HCBA 2RB6A 4V2SA 3CMAT 2EQJA 3LGLA 4EMKB 4KGXB 3JCMb 3OW2A 1GCPA 2ZCFB 1K76A 1YJWA 4AFZC 3G4SA 1X75C 4JS4A 1N8RR 3CC7Q 5CCAA 3BW1A 2FB7A 4DBHA 1FMWA 1KD1U 1VQ7A 3TSWA 3NTKA 4M7AG 2HBWA 4N4IA 3CPWS 1VQNA 2YLCA 2YDLA 1BI0A 3LWIA 2DL3A 3EFSA 1SG5A 3CMEQ 1OZ2A 3TEEA 4R56A 1ZSZC 2JS2A 3M4YA 4EMGA 1Q7YR 1G8XA 3OMCA 3RKWA 2MF2A 4JJBA 3CCST 1BYMA 1SHGA 2K7AA 3CCEA 1M8VA 3HFNA 2KBTA 3BDUA 2K3XA 2V8JA 2PUKB 5IXBA 1TUDA 1YWOA 2EQUA 2CP0A 4JUVA 5GAOp 1QWEA 2DIQA 3X26B 2CREA 3X24B 3QZ5B 3CBOA 4D6WA 3I56T 4FIBA 1EIFA 2F1LA 3MP6A 3QXEB 1YCYA 4RMOA 1YJ9Q 1R77A 1R0CB 2LC4A 1AWWA 2J6KA 3NHNA 3THKA 1AD5A 1M1FA 3OYIA 1YJ9T 4D8KA 4KT0E 4PJOD 3H0HA 4N0AC 1X2KA 3A5ZB 2DL8A 5AT1B 1VQ8Q 1D0YA 2ZPEB 4DOVA 4JRPA 4J9BA 2RJFA 4MMKA 3V7RA 2QK0A 2LQWA 3WVDB 1M90U 2QDLA 4CC3A 1H3HA 5LJ5d 4BI4A 2L89A 2DXUA 3DB4A 1N8RC 1LNXA 4WTOB 4LUDA 1V1CA 2DERA 2ECZA 3CCVT 4RG8A 4LNPA 3CXCS 4C8QF 4OF1A 3OYAA 4GY5A 2MCNA 1WPYA 1TS9A 5LJ3j 2YUPA 1BU1A 4KUDK 4IIOA 3G4SQ 1R0BG 1AWJA 3CC4T 4RTUA 2QQSA 4FCYA 1WXBA 1YCSB 1B7TA 5KYYB 3C95A 1BI3A 3CCRQ 5CK9A 3OYKA 1B34A 4XTZA 3CMAA 2JW4A 3A1PA 1VYTA 3CC2A 5IAYA 2Y4YA 2LP5A 4PJLA 3BFMA 2CZ6B 2XKOC 2D8JA 2CH4A 3MPUB 4PFPA 3CCQA 2OTJT 4M7AE 1ZBXA 5LJ5f 1VQ7Q 1VQ5T 4X9CA 1TUCA 2A37A 2HL3A 2K5LA 1UFFA 2YRVA 1LCKA 1SPKA 1PSFA 2KRNA 1JXMA 4LDWA 2CSQA 1GCQC 4HCKA 3EG9B 4F7UB 2BE7D 4ZGJB 5GANe 2QEXA 1D0ZA 1T3LA 1I1JA 1OX8A 1VQLA 3MKDA 5HK3A 1G3TA 4AT1B 2O4XB 5IHNA 1WXUA 2LQNA 4C92F 1X27A 2DILA 3GF5A 2RF0A 1YIJA 3EG9A 4F7UA 2ZZDA 2DXCA 5KYXA 2L8DA 2OTLA 4N4HA 2G3RA 3LH5A 3PIOA 4M7DD 5AYFA 3JB9F 2ABLA 3G71A 2QA4T 3CD6T 2A7YA 2JJ9A 2RPNA 3LX7A 4B9WA 1KD1R 2LNVA 5GJWB 4C5IA 1WNLA 4Y92A 4ATOA 2BZXA 1YI2A 2O31A 4LDYA 5L23A 2MI6A 3H0IA 4CC7A 5C0MA 3UATA 3ZFJA 4FM4B 4Z02A 3CCUA 1UEBA 3CCJQ 1NPPA 2F5KA 4XU0A 5LJ5e 1JRIA 2V1RA 4Z89A 4BACA 4RCBA 4ELZC 4KH0B 2O2OA 4BDZA 3VS7A 2KRMA 2ED0A 4JJDA 1XOVA 3PTAA 3S3OA 4J9FA 3LH0A 2JT4A 1ZBJA 5GAOl 1GCQA 2FHDA 4FYXB 2D6FA 2DO3A 4M75E 3J81E 1UHFA 3JCMP 2MOXA 2PTKA 3JB9H 1GRIA 1RAGB 3V7CA 4B9XA 2EQKA 2RHZA 2FZKB 5GAOn 1XNIA 3RESA 2QQAA 4M7DG 2KK4A 4IUQA 3T9NA 1U5SA 5DLQE 2ROTA 4DA4A 3KBGA 2O9SA 1YJWT 2BZYA 3A98A 4KGZB 3AHUA 5KE3A 2M0YA 5CAIA 2CP5A 3RNJA 4OMMA 3CBMA 1VQ6A 1KQ2A 2NLUA 2VKNA 3M56A 4PKCC 2DRKA 5J26A 3RMQA 3MEWA 3QJYA 1ZA2B 1AVZC 2RJDA 4Z88A 4C8QD 3M0SA 2DETA 2DD4A 1KHCA 1Q82C 4KGVB 3H0FA 1TXQA 1WHMA 4IUPA 4M75B 3JCMV 4D8DA 3N5BB 2CKKA 1GBQA 1HXDA 1LVKA 2VGMA 3CPWP 2DRMA 2RMOA 3OSSC 1M3AA 4HCCA 1M2VB 2VXEA 4TVRA 5GAN6 1IGUA 3HL8A 4IKFA 1VQPT 3HFOA 2GTJA 1SHFA 1EFNA 2BZ8A 3SWNB 5GAN2 3OYDA 4CRIA 1VA7A 4KULA 1NG2A 3OSVA 3EG0A 4P5NA 1YITQ 4LDXA 4JLIA 1Z9QA 3WVEB 3QKJA 3IQLA 1TUGB 3ME9A 5GAMf 2EAYA 1BKBA 1YJNT 3AT1B 1FMVA 1VIFA 1T3SA 2FO0A 5GAOr 3TSZA 3CCLA 3LGFA 2YUNA 3HTRA 2Y90A 1BI1A 1QQJA 2ZGWA 5DLOA 1OZ3A 2GF7A 1Y0MA 2NUPB 1RUWA 2HMAA 3L1AA 2DEQA 4C92D 3QO3A 3CC4A 1WHHA 1PKSA 4J7FA 4RTWA 3LW5E 1K8AU 1WDXA 1D0XA 1EZZB 5GMKm 2OAWA 2DM1A 2KQWA 3HRSA 4L59A 2PVGB 4LD6A 3X25B 3CXCP 2P0KA 4M77A 4J9EA 4OMQA 4F7UE 2OTLT 4GLKA 2RHYA 1Y7XA 1MMDA 4XTVA 5IN1A 4YTLA 2X9HA 3OW2S 2CZ1B 4FYYB 4J9IA 3MO8A 2X4XA 2AIRB 4Y28E 4XQ3A 1RAAB 1UB4A 5IXFA 4RTVA 2KYBA 3S3MA 4GLMA 2H8HA 2DXTA 5LJ3d 4E7KA 3EGDA 2YRDA 3R6NA 2CP7A 1VUBA 4KRTA 3CPWA 3EG3A 1Y57A 3O5ZA 2CSIA 3OYBA 3GNGA 2V26A 1PCXA 1MMGA 4M78A 1VQ9Q 3C4SA 1WGSA 2KXCA 1JO8A 2CS7A 2X4JA 2KT8A 4JLGA 2ZAEA 4ZN3A 2F2XA 2CP2A 2EJFA 1N9SA 1Y07A 1MMAA 1IRXA 3M9QA 3VS1A 2ZPGB 3CCVQ 1KC8R 4M78F 1M3CA 4QQ6A 3CMET 2OAUA 2C0TA 2MYSA 1ZHIA 2P0PA 5LL6S 3JB9G 5FU7B 1PKTA 1S72A 2XDBA 2GQIA 2EKOA 3HP9A 1JQQA 1I07A 4A4EA 3QIIA 1WA7A 1YFNA 1JBMA 2LZ6B 1BIBA 1ZUUA 1D1CA 3I5SA 5GAOm 1WXTA 3MP1A 4J6WA 4EPCA 2RI5A 2CP3A 3G7ZA 3CCET 4EMHA 2J06A 1AHJB 2DIGA 3EHRA 3EH1A 3H41A 2H3JA 2KEAA 2LX9A 2DD5A 4AFQC 1NBEB 2V8IA 1YHQQ 4HT8A 3VU3C 1HK9A 1UTIA 1NPRA 3CXCA 1SKUB 3VYHB 2EIFA 3M0RA 1NM7A 4M4ZA 3U23A 4X9DA 4A4GA 1KQ1A 2YHTA 2RHUA 3G6ET 3H9NA 2L3QA 1VQNQ 1UDLA 4E6RA 2EYXA 1VOMA 2JNGA 4LD9K 1QLYA 4L5GA 2QAZA 3CD6Q 5KYUB 1Q95G 2YLBA 1OX9A 1NJIR 2ZPHB 3OMGA 1TSFA 2CGHA 2XHCA 5CKFA 3F70A 4E47A 1G2BA 4QVZA 2ROLA 3M0TA 1QCFA 1PNJA 3GOXA 1U3OA 4PJOG 2E10A 3CC2T 3L2WA 1VQ6Q 4IUVA 1QVPA 1K8AR 5CKHA 2RQVA 2PVOB 1VQ4Q 3TCJA 2GBQA 2VVKA 4PLLA 4C92C 2CZ7B 4RUGA 5GAOq 4HCZA 2B8AA 1VQPA 3RIRA 3TQ7P 5GMKi 4MZTA 5HKCA 1S72Q 1M4ZA 3FDRA 4F16A 1G3SA 4C5HA 1UUEA 1Q81U 2C06A 3A8GB 3OQ5A 4Z8AA 4J9CA 4C8QA 2DJZA 4JZ4A 4FYVB 1PHTA 1VQMQ 3OYCA 2OTJQ 4X34A 1RI0A 1YI2T 1HSQA 2XK0A 2QA4Q 3L2ZA 1I8FA 2D0QB 4QQGA 3CCQQ 1M90R 2JTFA 1WHKA 4NS5A 4ZNXA 4ZN1A 1TH7A 2X3WD 4HKEA 4XU3A 1OOTA 3CC2Q 4E7SA 2L3RA 3MJXA 4FW1A 5GANf 3QBYA 3FC3A 1M5Q1 1NYFA 2GFUA 2FZCB 4IIMA 4M75C 5I2SA 1Q81C 1ZQ1A 2BTTA 4M75F 4PJNA 1Q86C 3E9GA 1TOVA 3JV3A 2YSQA 3CCUQ 2EGCA 1SSHA 3V8KA 4FT2A 3I9QA 3NTIA 4BE0A 3LWHA 2AKKA 2JXBA 4M7AB 4JS5A 2WSCE 2PZ1A 1W1FA 2X4YA 2XDPA 4M77D 1YWPA 1K9MC 5FROA 1PD0A 1KJWA 3QYHB 3ZL7C 3G71Q 1E7OA 1FMKA 1VQKQ 1UGPB 1PRLC 2E41A 1AZEA 2LX7A 1RAEB 1K73C 5D6XA 4QT7A 3EGUA 2ATCB 1M1KU 3EGXA 3JB9J 3I5RA 4Y91A 3VS5A 4EMKC 1KC8C 1Q7YU 2W0ZA 2PQWA 5FW9A 3EH2A 2RI3A 3CCJT 4HVUA 3TREA 4C8QC 1VQOA 3D7SB 3S6WA 2V1QA 1I5LA 2LQ8A 2VV5A 5C6SA 2QEXQ 5GAN7 1O9SA 4L6V5 1WHJA 2D9TA 2DTOA 2LJ1A 1YJ9A 9ATCB 5J39A 3REBB 1WYXA 2ENMA 5GMKl 3VRZA 1Q86R 1C0MA 1OYXA 2DYBA 2KGTA 2P0QA 2HSEB 4AFUC 2J7IA 3V8LA 3EG2A 4M77E 2K5FA 2EYYA 4XTXA 3JSCA 2HKNA 4RKUE 1FYNA 3SWNA 4N0AA 1GBRA 2NUTB 2KI7A 3QDRB 4RTYA 2D1XA 4F7UF 1ZX6A 4M78D 2JMCA 2CH4W 3M4GA 2LCSA 4EDUA 2DVJA 1PM3A 3GLXA 2VB6A 1SEMA 2X3XD 3MP8A 2QXFA 3QWXX 2D0NA 4F14A 2A3LA 4C92B 3L2UA 2DZ9A 2GNCA 4OGEA 3EG1A 4O6JA 2RA2A 2GFAA 2LJ3A 1MV3A 1YN8A 5CO7A 2L5QA 3MCAB 4C5EA 1OI1A 2LCLA 3FEOA 3UF4A 2QG9B 1KQSP 3VV0A 1VQOQ 4DBRA 1TG0A 1N9RA 2HKQB 5CKDA 3JCMf 3QDFA 5I11A 1UGRB 1AZGB 3VJPA 2RK1A 3M59A 4A4KA 3PVLA 4M78B 5GMKe 5IHKA 1OPKA 3CCMQ 1UECA 1KQSA 2LNHB 1Y96A 3CCSA 3DKMA 2K79A 4RTTA 2E5QA 2O9VA 3JCMX 1Q81R 2SRCA 2GGRA 2QTVA 2EJGA 1W2BP 1WIEA 3RKYA 1KD1C 3GNFB 3JCMJ 4X1VA 4E7HA 2YUOA 1D3BB 3X28B 5KH6A 2AZVA 3J80E 2EBPA 2JUFA 5FU6B 3GPLA 5FU7C 1IREB 3A8MB 4FU6A 2E3HA 3OYEA 2E3IA 3OB9A 2MAMA 4MDXA 4XTWA 4EIKA 3QJ6A 1AEYA 4PFOA 1IO6A 2O4XA 2DX1A 4ME7A 4JJNK 3PGGA 1JEGA 2C0OA 4M7DA 5DY9A 3O8VA 4C92G 3SFMA 2QEXT 2CUBA 1R8OB 2R5AA 2EQIA 1VQKA 2KE9A 1M1KR 2E6ZA 1TU0B 4HVVA 2J6FA 5IH2A 4RCCA 4QW2A 5CKEA 4C0GA 3TVTA 3KFVA 3INZA 3CC7A 1QP2A 1VQMA 1ZSZA 2RQUA 2XMFA 2DEUA 3I56Q 4E2FB 3CEYA 3VUZA 3M53A 3G6EA 2I0NA 4MDWA 2W10A 2VXFA 2DTIA 1OU8A 1WQ7A 2OTLQ 1GL5A 3VRYA 2DFUA 3BY7A 2QQ9A 1XJWB 4OVAA 3E2UA 3NPFA 3QUIA 3CBPA 4LN2A 4ZGEB 2R57A 5FRNA 2QGFB 3ASKA 2E4HA 2FVUA 3FRNA 2KY9A 2QQBA 1YJNA 4QVCA 5GAN4 4M78E 3C0CA 5A0LA 2G6FX 2CUDA 3G6EQ 4E7LA 1C6VX 1G3YA 2JM8A 1M2VA 3OYFA 2OTJA 5CQYA 1VQ7T 1Q86U 4BY6C 1ZSGA 4BDYA 1S72T 2JOYA 1T0HA 1CKBA 1PWTA 3CD6A 1RL2A 3L2VA 2I2LA 2L2PA 2IVWA 1WJSA 3FIFA 1YJNQ 3EGXB 1KIKA 5FRMA 1J3TA 1OPLA 1RI9A 4PNOA 3UWNA 4BUGA 2LJ0A 5CIUA 1TWBA 4JRQA 4AMCA 4OP0A 2EGAA 1YITT 1BCMA 1VQLT 1Y71A 2EGEA 4ZGDB 4E7JA 3VS0A 4NOYA 3CCRA 2EQMA 3A8HB 3JCMe 2HZYA 3P8HA 5GAN3 2DVEA 1M2OA 2E70A 2NUTA 1X6BA 3QSUA 3URGA 1OV3A 4OMNA 2MWOA 5HK0A 1VYUA 4E7ZA 1VIEA 3I56A 4JDSA 1W2BS 1UGQB 5GAMg 1F1BB 1VQ4T 2DKGA 1IGQA 1RADB 2R58A 3EGDB 1VQ6T 1MUZA 1H92A 1UE9A 1VQ5Q 2DL7A 4J83A 1LPLA 1M8MA 4LE9A 1M30A 2VC8A 3HPWA 1RAHB 2EJ9A 5KYWB 2ED1A 4OB1B 4A63B 5GMKj 2EW3A 3JCMQ 4CC2A 2RK2A 2VGNA 2PUOB 3V8JA 3CCVA 1BI2A 2E65A 3JCMW 1Y96B 1G3WA 2XI9A 1QVFS 1YHQA 2EYZA 2ESWA 1MHNA 2L3SA 3C12A 3NGPA 3PE0A 2RO0A 1N6AA 1MMNA 3OYLA 2XIDA 2JMAA 1NEBA 2RJEA 3HKSA 3RDVA 2F69A 3PIPA 3QZ9B 4M7DB 3WXMB 1M3BA 3M0UA 1NJIC 3L2QA 5FWCA 3QPHA 2AZSA 2KXDA 5ECAA 2C0IA 2E64A 3VYGA 1RAIB 5L8RE 3CCSQ 2M02A 2A08A 2XICA 1QCOA 2WSFE 3CCEQ 2OX7A 2J6OA 1N5ZA 1E6HA 2EFIA 3KUFA 1MNEA 2VYTA 4HT9A 3JB9D 2DBMA 3CMEA 4PLIA 4J6XA 4C0DC 3I55A 4LUEA 3CC7T 3OW2P 3OS2A 2KROA 3REAB 1YNZA 3SWNC 1CKAA 5GMKh 2PVDB 3E1SA 4PFZA 1VQ9A 1KSWA 1AWXA 2NYSA 1IXDA 2OJ2A 3PNWC 4FSSA 2GTOA 4PJOC 1PC0A 1VQNT 4FT4A 2AKLA 2HCKA 2K2MA 2KRSA 4VUBA 3OS0A 1VQOT 3RR6A 2M9UA 2NWMA 3J7AF 2HQEA 3P8BB 4ELYC 4UC4A 2YRCA 1ABQA 3MHXA 1U1SA 1I5OB 3VS4A 4R0KA 3M57A 1U06A 3GBQA 1KK7A 3OYYA 1WJRA 5GAMd 2HQXA 3JCMd 4AFSC 3OYGA 3JCMh 4LXCA 3OS5A 4II1A 1WHGA 1NEGA 2P4TA 2DK3A 4JPBW
chains in the Genus database with same CATH topology
2FL7A 4BD3A 2RHZA 3META 4M77C 2RI3A 4XTUA 2QI2A 5GAOn 3CCJT 3TREA 4C8QC 1VQOA 4A4HA 4N4GA 1XNIA 3SB2A 3OY9A 4JRKA 3S6WA 1I5LA 3RUXA 3RESA 5KE2A 4PJOD 2QQAA 2LQ8A 4M7DG 2VV5A 2IG0A 2K57A 2RM4A 2KK4A 5C6SA 5GAN7 2LVMA 2K3YA 4IUQA 1O9SA 1WJQA 4L6V5 2D9TA 3T9NA 2DTOA 5DLQE 1U8RA 4DA4A 3KBGA 1YJ9A 2MMPA 1YJWT 4RG2A 4OGCA 5J39A 4M75A 2EWNA 3JCMg 1H641 5GMKl 5KE3A 3AHUA 1Q7YC 1DJ7B 5CAIA 2RH2A 4OB3B 5GAN5 4PJOA 3CBMA 4HA8A 4M75D 1VQ6A 1OYXA 3QYGB 1KQ2A 2DPPB 2NLUA 3LYIA 3X20B 3CCJA 1KG1A 3JB9I 3OYHA 4JRIA 4M78C 2P0QA 1K73U 3CCQT 3FB9A 3M56A 4PKCC 4NL2A 5J26A 4OB0B 3RMQA 3MEWA 3QJYA 2LTOA 3V8LA 2BKDN 5GANd 1QVGS 2M1HA 5GAMj 4BE2A 2HNIA 1QVGA 2LCCA 4M77E 2K5FA 5I21A 1X01A 1K9MU 4XTXA 2QQRA 1X6OA 2RJDA 3JSCA 4C8QD 1M1GA 1NZ9A 5IT9E 2CZ0B 4RKUE 2ZPFB 2DD4A 5A0GA 1KHCA 3SWNA 1Q82C 4PJOB 4N0AA 1B34B 5GMKi 3C94A 2ZPBB 1VQ9T 1K8AC 4IUPA 3QDRB 2QTXA 4M75B 3JCMV 3N5BB 2CKKA 4F7UF 4M78D 1MGQA 1HXDA 2JVVA 2VGMA 3M4GA 5LJ3f 4EDUA 1VQ8T 3ZEHA 4XTYA 3GLXA 4C92A 2PU9B 4QQDA 3OSSC 4HCCA 3RKXA 2QA4A 2LRQA 3MP8A 3QHSA 2QXFA 4C5GA 5LJ3g 2VXEA 2A3LA 4TVRA 4C92B 4IUTA 3L2UA 3UDCA 5KCOA 1D3BA 2DZ9A 2KMTA 3M55A 4OGEA 4A53A 5GAN6 3HL8A 4IKFA 4O6JA 2RA2A 5GANg 3HFOA 1VQPT 1XTDA 2GFAA 2ZPIB 5LJ5j 3BDLA 3ZBDA 3SWNB 4IUUA 5CO7A 5GAN2 2L5QA 3MEAA 3MCAB 4C5EA 2XDDA 1OI1A 2LCLA 4CRIA 3OYDA 3VKIA 3FEOA 4KULA 3OSVA 2K2VA 4P5NA 3HHTB 4LDXA 4JLIA 5D6WA 2MWPA 3VV0A 5J3BA 5GANj 3NFCA 3WVEB 1N9RA 3QKJA 3ME9A 5CKDA 1IZ6A 3NTHA 3JCMf 4M7DC 2KVQG 5GAMf 1UGRB 5LJ3h 3H8ZA 3VJPA 2EAYA 2RK1A 1BKBA 3M59A 4A4KA 1YJNT 1YBYA 1NE8A 3OBWA 1VQ4A 1VIFA 1N8RU 4LDVA 1FX7A 4M78B 4DOWA 2HBPA 5GAMe 5GMKe 5GAOr 3CCLA 4PL6A 1G5VA 4C0DB 3LGFA 3HRUA 1I4K1 1KQSA 5CQXA 2BIVA 4A4FA 2Y90A 1BI1A 2AHJB 1W2BA 1Y96A 4MMLA 3GIBA 4J6YA 3CCSA 1H3ZA 3DKMA 4BI3A 2ZGWA 2E5QA 4OB2B 5DLOA 3JCMX 1OZ3A 3EFRA 3CCMA 2EJGA 2GF7A 3L1AA 2R5MA 4C92D 1U1TA 2DEQA 3EAEA 4O5VA 4XK8E 2XD0A 3QO3A 1FWZA 3RKYA 1KD1C 3CC4A 3GNFB 3JCMJ 4E7HA 4M77G 4J7FA 2LT4A 1W4SA 2WACA 4BY6B 5D6YA 1D3BB 3DLMA 4M7AF 3G71T 3X28B 2RJCA 5KH6A 4BI8B 3J80E 3LW5E 2GQVA 3UT1A 1K8AU 4XU2A 3DLLA 2RI2A 4NL3A 2LDMA 5GMKm 2KQWA 2JUFA 3HRSA 2PVGB 4L59A 4LD6A 5FU6B 3GPLA 5FU7C 4J7IA 3X25B 1IREB 1WQWA 3A8MB 4HCBA 2P0KA 4FU6A 2RB6A 4M77A 5LJ5g 4V2SA 3OYEA 1M90C 2EQJA 4R55A 3CMAT 3LGLA 3OB9A 4EMKB 2E1HA 3MEUA 3JCMb 4F7UE 2MAMA 4QVDA 3OW2A 2OTLT 4GLKA 2RHYA 4MDXA 1Y7XA 3OBYA 1SSFA 4XTVA 4YTLA 5IN1A 3OW2S 4XTWA 2K4YA 2CZ1B 3QJ6A 2ZCFB 4EMKA 1VQMT 3MO8A 4KBMB 2X4XA 1YJWA 4Y28E 4CI0C 1X75C 3G4SA 3V7SA 2O4XA 4XQ3A 4JS4A 4ME7A 4C0ZA 4JJNK 3PGGA 5CCAA 2JZ2A 3BW1A 2FB7A 1UB4A 4M7DA 5A2QE 1KD1U 5DY9A 3SDZA 3O8VA 4C92G 3SFMA 4F7UG 2QEXT 1KQSS 1VQ7A 1R8OB 2R5AA 3S3MA 2DXTA 3NTKA 5LJ3d 4E7KA 1VQKA 4M7AG 1V29B 4N4IA 2E6ZA 3CPWS 3KXTA 2YLCA 1VUBA 1VQNA 2BUDA 1BI0A 3LWIA 5LJ5h 5DM7R 3EFSA 2WSEE 1M9SA 3CPWA 4RCCA 4QW2A 3OYJA 1OZ2A 3TEEA 4IURA 5CKEA 4C0GA 4R56A 3M4YA 4EMGA 3INZA 3X26B 3CC7A 1YHQT 1QP2A 3CCUT 3OMCA 3RKWA 1VQMA 2MF2A 3OYBA 1QW1A 3CCST 4ZTFA 1BYMA 5A0DA 3CCEA 3CEYA 3GNGA 1FXXA 3VUZA 1M8VA 3M53A 3HFNA 3CCLT 3QG1A 3BDUA 3OS1A 2K3XA 5HY6A 3G6EA 4M78A 2V8JA 3C4SA 1WGSA 3E9FA 4MDWA 4OMFB 2E6NA 2PUKB 2XG8D 2CS7A 2X4JA 3PMTA 4JLGA 1M1KC 4ZN3A 2EQUA 2VXFA 4JUVA 5GAOp 2DTIA 2K5IA 2EJFA 2DIQA 1N9SA 1WQ7A 1Y07A 5I2MA 3QZ5B 2V8KA 3BY7A 2QQ9A 3M9QA 4OVAA 3X24B 3CBOA 4DQ2A 4D6WA 2ZPGB 3I56T 4FIBA 3SD4A 1EIFA 5GANh 2DXBA 4M78G 1QP3A 3QUIA 4M7AC 3MP6A 3QXEB 4M78F 3CBPA 1YCYA 4RMOA 4ZGEB 3DB3A 1UGSB 2LC4A 2R57A 4QQ6A 3CMET 2OAUA 1P92A 2LT1A 3L42A 5FRNA 3S3NA 2X4WA 3ASKA 2DTHA 2FVUA 3FRNA 2HD0A 1M1FA 2KY9A 3OYIA 4M75G 1YJ9T 1ZHIA 4KT0E 2P0PA 2QQBA 5LL6S 3JB9G 1YJNA 5FU7B 4QVCA 4N0AC 2HAXA 5GAN4 3M5AA 3A5ZB 4M78E 1S72A 2XDBA 4PJOE 1PSEA 2E12A 2EKOA 3HP9A 5A0LA 2ZPEB 4DOVA 4JRPA 4E7LA 4A4EA 3QIIA 2RJFA 1G3YA 4MMKA 3OYFA 2VUBA 1JBMA 3V7RA 2OTJA 1BIBA 2F5TX 5CQYA 1VQ7T 1Q86U 4BY6C 5GAOm 1VQKT 3MP1A 2FYKA 4J6WA 4BDYA 2JOYA 1S72T 4EPCA 3WVDB 1M90U 2RI5A 3G7ZA 4M7DF 3CCET 4C8QE 5LJ5d 4BI4A 2L89A 1RL2A 3L2VA 3CD6A 2I2LA 4EMHA 2DXUA 2IVWA 3JRZA 3DB4A 1N8RC 3VUBA 1AHJB 1LNXA 1WJSA 2DIGA 2H3JA 3FIFA 3PFSA 2LX9A 2DD5A 3CCVT 2RD1A 4RG8A 5FLXE 5FRMA 2V8IA 1O75A 4PNOA 3UWNA 4BUGA 3CXCS 4HT8A 5CIUA 3VU3C 4OF1A 4C8QF 1HK9A 4JRQA 1NPRA 3CXCA 4OP0A 3OYAA 4M77F 4GY5A 1YITT 1WPYA 5LJ3j 1VQLT 3FJPA 1KHIA 3VYHB 1Y71A 4KUDK 2EIFA 4C0FA 4ZGDB 3LLRA 4E7JA 4BB7A 4NOYA 3CCRA 2EQMA 4X9DA 4A4GA 3A8HB 4KUIA 1KQ1A 3JCMe 3L2RA 2YHTA 3CC4T 2RHUA 2DAQA 4M7AA 3G6ET 3P8HA 5GAN3 1JJ2A 2QQSA 2DVEA 2E70A 3RERA 5KCHA 3QSUA 3URGA 2O01E 3HRTA 2JNGA 3H6ZA 4LD9K 2MWOA 5HK0A 3C95A 1BI3A 4L5GA 1VIEA 3ER0A 5CK9A 3I56A 3OYKA 4JDSA 2YLBA 3P8DA 2ZPHB 3OMGA 1B34A 3A8LB 4XTZA 1UGQB 1W2BS 1KC8U 5GAMg 1JB0E 3CMAA 1VQ4T 4BE1A 3TU4K 2DKGA 2CGHA 3CC2A 2XHCA 5IAYA 2Y4YA 2R58A 5CKFA 3BFMA 2CZ6B 2XKOC 3F70A 1VQ6T 4E47A 2M0OA 2RHIA 1I81A 4J83A 4QVZA 3CCQA 3OYNA 2OTJT 1Q82U 2VC8A 3HPWA 4M7AE 1ZBXA 3GOXA 3JAME 5LJ5f 4PJOG 2E10A 3CC2T 3E19A 2EJ9A 1VQ5T 4X9CA 4OB1B 3L2WA 4IUVA 2K5LA 2YRVA 1QVPA 5GMKj 2EYQA 5CKHA 3JCMQ 2RK2A 2PVOB 3CPFA 5LJ3e 2X35A 1N27A 2VGNA 4XAXB 3TCJA 1PSFA 2KSSA 2PUOB 4PLLA 4C92C 2CZ7B 5GAOq 3V8JA 3CCVA 3PMIA 4HCZA 4LDWA 1BI2A 2B8AA 2E65A 1VQPA 3CCRT 3RIRA 3JCMW 4M77B 1Y96B 1G3WA 2DZCA 2KDSA 4C8QG 4F7UB 2XI9A 4MZTA 4XU1A 4ZGJB 5GANe 1QVFS 1YHQA 1BIAA 5HKCA 2QEXA 1M4ZA 4C92E 1MHNA 3FDRA 1YITA 3C12A 2Y4XA 5FU6C 1G3SA 2RO0A 4ZTJA 3GP8A 1VQLA 1N6AA 5HK3A 3FLGA 1G3TA 1LJOA 4C5HA 3OYLA 1Q81U 2C06A 2O4XB 2XIDA 3HKSA 2RJEA 3A8GB 3OQ5A 2F69A 4C92F 3PIPA 4C8QA 3MEVA 3G4ST 2DJZA 3Q1JA 1GXIE 3GF5A 3QZ9B 4M7DB 3WXMB 5CVIA 1YIJA 3OYCA 4J5YA 4F7UA 4X34A 2ZZDA 1NJIC 1RI0A 3L2QA 2DXCA 2L8DA 1YI2T 2OTLA 5CR2A 4N4HA 4MZMA 1VQ8A 2G3RA 2XK0A 2QDYB 3QPHA 3L2ZA 3PIOA 5CKBA 1I8FA 2E64A 3VYGA 5L8RE 5AYFA 4M7DD 3JB9F 2D0QB 4QQGA 2JTFA 4C8QB 1VQ5A 4M7DE 5EG2A 3G71A 2QA4T 4FL6A 2A7YA 3CD6T 3M54A 4NS5A 2XICA 3HSBA 4J8OA 4ZN1A 1TH7A 2WSFE 4HKEA 1NJIU 4XU3A 3R6OA 1JJ2S 3LX7A 2EFIA 2L3RA 3KUFA 5GANf 2VYTA 2JN0A 3QBYA 3JCMc 1M5Q1 3FC3A 4HT9A 2GFUA 2CYZB 4B9WA 2LNVA 4LDUA 3JB9D 4C5IA 1WNLA 4Q5WA 5M9OA 3CMEA 4PJOF 4M75C 4ATOA 4PLIA 4J6XA 2KAFA 1YI2A 4LDYA 4C0DC 5I2SA 5GAN8 1ZQ1A 2MI6A 3I55A 1Q81C 4M75F 1QVFA 1Q86C 3E9GA 3CC7T 5C0MA 3ZFJA 4FM4B 3RMSA 4Z02A 3OS2A 4FSXA 3CCUA 2GCXA 3OA6A 1UEBA 3SWNC 5GMKh 2PVDB 3E1SA 1VQ9A 3V8KA 4FT2A 3CCMT 1NPPA 2F5KA 4XU0A 5LJ5e 1XQHA 3NTIA 4WF2A 1JRIA 3I55T 3PNWC 4BACA 1LOJA 4BE0A 3LWHA 2JTMA 4RCBA 4PJOC 4ELZC 4BDZA 1VQNT 4FT4A 4M7AB 4JS5A 2WSCE 4VUBA 3PT9A 1XOVA 3PTAA 2X4YA 2XDPA 4M77D 1K9MC 3OS0A 5FROA 1VQOT 3M58A 2M9UA 3QYHB 3J7AF 2HQEA 2LQKA 3P8BB 4ELYC 4M7AD 3S3OA 4UC4A 3MHXA 3A8OB 4MZPA 1U1SA 1UGPB 4E7IA 2E41A 3LH0A 4A54A 3M57A 5GAOl 1K73C 3UPUA 2FHDA 5D6XA 3OYYA 2D6FA 1WJRA 5GAMd 2HQXA 2DO3A 3JCMd 5GAMh 4M75E 3J81E 3OYMA 3OYGA 1M1KU 3JCMh 2XU8A 3JCMP 3JB9J 3JB9H 2RHXA 3OS5A 4Y91A 4II1A 4EMKC 3V7CA 2M16A 4B9XA 1YIJT 1Q7YU 2P4TA 1KC8C 2DK3A 2EQKA 2PQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8A A;  4QQ6 A;  2R57 A;  5FRN A;  3L42 A;  2RHZ A;  3MET A;  4BD3 A;  2RI3 A;  2X4W A;  3ASK A;  3S3N A;  4PL6 A;  1G5V A;  3LGF A;  2BIV A;  4A4H A;  4A4F A;  4C5H A;  4N4G A;  3OYI A;  1H3Z A;  1MHN A;  1XNI A;  3FDR A;  3OY9 A;  3S6W A;  2RO0 A;  2E5Q A;  5KE2 A;  4ZTJ A;  1OZ3 A;  3FLG A;  2EKO A;  2IG0 A;  5C6S A;  2GF7 A;  2LVM A;  2R5M A;  2K3Y A;  1WJQ A;  3EAE A;  4IUQ A;  3QII A;  2O4X B;  4A4E A;  2D9T A;  2RJE A;  2RJF A;  3OYL A;  4E7L A;  3OQ5 A;  3OYF A;  4E7H A;  3MEV A;  4RG2 A;  2WAC A;  3Q1J A;  5D6Y A;  5J39 A;  3MP1 A;  3DLM A;  3OYC A;  4BDY A;  5KE3 A;  2RJC A;  4X34 A;  5KH6 A;  2RI5 A;  1RI0 A;  3L2Q A;  3UT1 A;  2L8D A;  2L89 A;  3L2V A;  2RI2 A;  4N4H A;  2LDM A;  1OYX A;  2G3R A;  3DB4 A;  2NLU A;  2XK0 A;  3LYI A;  4L59 A;  4LD6 A;  1WJS A;  2DIG A;  3OYH A;  3PFS A;  2P0K A;  4FU6 A;  5J26 A;  4QQG A;  3OYE A;  2EQJ A;  2JTF A;  5FRM A;  3MEW A;  3LGL A;  3OB9 A;  2LTO A;  3MEU A;  2BKD N;  4FL6 A;  3UWN A;  4NS5 A;  5CIU A;  2M1H A;  2RHY A;  1SSF A;  5IN1 A;  4BE2 A;  2LCC A;  3OYA A;  2QQR A;  2RJD A;  3LX7 A;  3QJ6 A;  2EFI A;  4GY5 A;  2L3R A;  3KUF A;  3MO8 A;  2X4X A;  2VYT A;  3QBY A;  3FC3 A;  1KHC A;  2O4X A;  2GFU A;  4B9W A;  3LLR A;  4E7J A;  4C5I A;  4Q5W A;  5M9O A;  2JZ2 A;  2EQM A;  4IUP A;  4A4G A;  4PLI A;  3L2R A;  2CKK A;  2RHU A;  2DAQ A;  3O8V A;  3P8H A;  2QQS A;  3E9G A;  3ZEH A;  4EDU A;  2R5A A;  3S3M A;  5C0M A;  3NTK A;  4E7K A;  5KCH A;  3OS2 A;  4Z02 A;  4N4I A;  3OA6 A;  4QQD A;  2BUD A;  3H6Z A;  2LRQ A;  2F5K A;  2MWO A;  3MP8 A;  4C5G A;  4QW2 A;  3NTI A;  3OYJ A;  1OZ2 A;  4IUT A;  3PNW C;  4IUR A;  3L2U A;  5KCO A;  3OYK A;  4BAC A;  4BE0 A;  3P8D A;  3OMG A;  3OMC A;  4IKF A;  3OYB A;  4BDZ A;  4ZTF A;  4BE1 A;  2GFA A;  3CEY A;  5IAY A;  2R58 A;  2X4Y A;  3BDL A;  2XDP A;  3F70 A;  3OS0 A;  5FRO A;  2K3X A;  3OS1 A;  2M0O A;  2RHI A;  3S3O A;  2HQE A;  3C4S A;  1WGS A;  4IUU A;  3E9F A;  4QVZ A;  4UC4 A;  3MEA A;  4C5E A;  3OYN A;  3OYD A;  1OI1 A;  2E6N A;  4CRI A;  3PMT A;  3FEO A;  4E7I A;  3GOX A;  2EQU A;  3LH0 A;  5D6W A;  2MWP A;  2FHD A;  5D6X A;  1WJR A;  2DIQ A;  3L2W A;  2HQX A;  3QKJ A;  4IUV A;  3OYM A;  3M9Q A;  3OYG A;  2YRV A;  4OVA A;  3ME9 A;  3NTH A;  3SD4 A;  2RHX A;  3H8Z A;  4II1 A;  2X35 A;  1N27 A;  3MP6 A;  2M16 A;  4B9X A;  4PLL A;  2EQK A;  2PQW A;  3PMI A;  4HCZ A;  3DB3 A; 
#chains in the Genus database with same CATH topology
 2FL7 A;  2AT1 B;  3MET A;  4M77 C;  4XTU A;  2QI2 A;  1NYG A;  4A4H A;  2A0F B;  4N4G A;  1MND A;  1OU9 A;  3SB2 A;  2EVR A;  3VS6 A;  3RUX A;  5KE2 A;  2RNA A;  1PG5 B;  2Z0W A;  2K3Y A;  1WJQ A;  2MK5 A;  1U8R A;  1Q82 R;  2MMP A;  4PJJ A;  2YT6 A;  4OGC A;  4M75 A;  3JCM g;  1H64 1;  4PJO A;  4OB3 B;  1D1B A;  2HDA A;  1K9A A;  4HA8 A;  4M75 D;  3QYG B;  3LYI A;  1KG1 A;  4JRI A;  2F2V A;  3CCQ T;  1K73 U;  4OB0 B;  2KR3 A;  1HJD A;  2LTO A;  1QVG S;  2VAS A;  2LCC A;  5I21 A;  1X01 A;  1K9M U;  2KNB B;  2QQR A;  1X6O A;  7AT1 B;  4DEY A;  5IT9 E;  2KT1 A;  5KYX B;  5A0G A;  4PJO B;  1B34 B;  1VQ9 T;  3C94 A;  3VS3 A;  2QTX A;  1V76 A;  1MGQ A;  1VQ8 T;  6AT1 B;  3ZEH A;  4XTY A;  4C92 A;  2DJQ A;  2PU9 B;  4QQD A;  1HD3 A;  3RKX A;  2QA4 A;  4C5G A;  3I55 Q;  4IUT A;  5KCO A;  1ZLM A;  2FG0 A;  2KMT A;  3M55 A;  4A53 A;  5GJV B;  5GAN g;  1XTD A;  1Z9Z A;  3ZBD A;  1ZUY A;  4IUU A;  2M51 A;  2XDD A;  1K73 R;  2CT4 A;  3VKI A;  5KYW A;  1ARK A;  3ULR B;  4J9D A;  1KFZ A;  1K9M R;  1I0C A;  1VQP Q;  4M7D C;  2KVQ G;  5LJ3 h;  3H8Z A;  3M0P A;  1TTH B;  3OBW A;  1VQ4 A;  1MV0 B;  4LDV A;  1B07 A;  4DOW A;  1OUL A;  2RQT A;  1G5V A;  4C0D B;  1I4K 1;  5CQX A;  2BIV A;  4A4F A;  1RAF B;  4KH1 B;  1H3Z A;  3GIB A;  4J6Y A;  4B6M A;  5KYY A;  4BI3 A;  2DMO A;  1NLO C;  3EFR A;  2QYZ A;  3PVQ A;  1GFC A;  1FWZ A;  2KYM A;  3G1J A;  4M77 G;  2LT4 A;  1W4S A;  2WAC A;  4BY6 B;  5D6Y A;  3DLM A;  1IHW A;  2EKH A;  4M7A F;  2FRW A;  2RJC A;  3EFO A;  5I22 A;  2YXY A;  4BI8 B;  2B86 A;  2GQV A;  2SEM A;  3UT1 A;  1PRM C;  2RI2 A;  2DYI A;  2LDM A;  1YP5 A;  4J7I A;  2VWF A;  1WQW A;  3CQT A;  5LJ5 g;  1NLP C;  1M90 C;  1E6G A;  4R55 A;  1G83 A;  5EC7 A;  2E1H A;  2H3E B;  3MEU A;  1X43 A;  4QVD A;  4ORZ A;  3OBY A;  1SSF A;  2K4Y A;  2JS0 A;  4EMK A;  1VQM T;  4KBM B;  2X51 A;  4CI0 C;  3V7S A;  4C0Z A;  1WX6 A;  2JZ2 A;  1X69 A;  5A2Q E;  1K0S A;  3SDZ A;  4F7U G;  1KQS S;  1V29 B;  3KXT A;  2BUD A;  4K11 A;  5LJ5 h;  5DM7 R;  2WSE E;  1M9S A;  1IB8 A;  3BE3 A;  3OYJ A;  4IUR A;  1YHQ T;  3CCU T;  1YIJ Q;  1W70 A;  4ZTF A;  1QW1 A;  1C1A A;  1B3Q A;  5A0D A;  1A0N B;  2YUQ A;  1FXX A;  3CCL T;  3QG1 A;  3OS1 A;  2COW A;  1QMC A;  2OI3 A;  5HY6 A;  2FPD A;  3E9F A;  4OMF B;  2E6N A;  4OMO A;  2XG8 D;  3PMT A;  1M1K C;  2JTE A;  1CSK A;  1BK2 A;  1OQK A;  2IIM A;  5HCK A;  2K5I A;  1EX4 A;  5I2M A;  2V8K A;  4DQ2 A;  4ANJ A;  3SD4 A;  5GAN h;  2DXB A;  4M78 G;  1QP3 A;  4M7A C;  2COY A;  1UHC A;  2PNI A;  2A36 A;  3DB3 A;  1UGS B;  1P92 A;  2LT1 A;  2RQR A;  3L42 A;  3S3N A;  2X4W A;  2DTH A;  4GBQ A;  2HD0 A;  4M75 G;  2HAX A;  3M5A A;  4PJO E;  1PSE A;  2E12 A;  2FPF A;  4FYW B;  1RAB B;  1QKX A;  2D8H A;  2VUB A;  2F5T X;  2P84 A;  1VQK T;  2FYK A;  4M7D F;  4C8Q E;  5FWB A;  3JRZ A;  3VUB A;  2DE0 X;  4PJM A;  3PFS A;  4PK4 A;  2RD1 A;  5FLX E;  1O75 A;  2HL5 C;  2DA9 A;  4M77 F;  3FJP A;  1KHI A;  4C0F A;  1VYV A;  3UA7 A;  3LLR A;  4BB7 A;  1ZUK A;  4J9H A;  4CC4 B;  4KUI A;  3L2R A;  4HVW A;  4M7A A;  2DAQ A;  4DBF A;  1JJ2 A;  3RER A;  5KCH A;  3EHQ A;  2O01 E;  3HRT A;  3H6Z A;  2AK5 A;  2LMJ A;  3ER0 A;  3P8D A;  5IHI A;  3A8L B;  1KC8 U;  8ATC B;  1JB0 E;  3CMA Q;  4BE1 A;  3TU4 K;  3CC4 Q;  1WZO A;  2M0O A;  2RHI A;  1I81 A;  2BE9 B;  3OYN A;  1Q82 U;  3JAM E;  3E19 A;  1ZSZ B;  3CCL Q;  2EYQ A;  2FRY A;  3CPF A;  5LJ3 e;  2X35 A;  1N27 A;  4XAX B;  2KSS A;  3PMI A;  1UJY A;  2CDT A;  3CCR T;  1D1A A;  3FJ5 A;  4M77 B;  2DZC A;  2KDS A;  4C8Q G;  4XU1 A;  1BIA A;  4C92 E;  1YIT A;  2Y4X A;  5FU6 C;  1UGV A;  4ZTJ A;  3GP8 A;  1AWO A;  1ZA1 B;  3FLG A;  1LJO A;  2DL5 A;  3MEV A;  3G4S T;  2F2W A;  3Q1J A;  1GXI E;  5CVI A;  2E5K A;  5KYU A;  4J5Y A;  5CR2 A;  1SRL A;  4MZM A;  1VQ8 A;  2QDY B;  4F17 A;  5CKB A;  1QVG P;  2CP6 A;  2CT3 A;  4C8Q B;  1VQ5 A;  4M7D E;  5EG2 A;  2HEQ A;  4AG1 C;  1JJ2 P;  4FL6 A;  2COZ A;  3M54 A;  3HSB A;  4J8O A;  1H8K A;  2EPD A;  1NJI U;  3R6O A;  1JJ2 S;  3JCM c;  2JN0 A;  2CYZ B;  1YJW Q;  4LDU A;  4Q5W A;  5M9O A;  1JU5 C;  4PJO F;  1HYO A;  2KAF A;  5GAN 8;  2FZG B;  1PD1 A;  1QVF A;  2A28 A;  1WLP B;  2DF6 A;  3RMS A;  2NUP A;  4FSX A;  2GCX A;  3OA6 A;  1QVF P;  3SHW A;  4RTX A;  3CCM T;  1XQH A;  4WF2 A;  3I55 T;  1K0X A;  1LOJ A;  1SF9 A;  2FPE A;  2JTM A;  5KYN A;  1M27 C;  3PT9 A;  2DBK A;  1D09 B;  2DL4 A;  3M58 A;  1QCN A;  2LQK A;  4M7A D;  2J05 A;  1S1N A;  3A8O B;  4MZP A;  4E7I A;  4A54 A;  4QKU A;  3UPU A;  2K9G A;  1K4U S;  5GAM h;  3OYM A;  2RQW A;  2XU8 A;  4OML A;  2RHX A;  4AG2 C;  2JM9 A;  2M16 A;  1YIJ T;  1WI7 A;  2QGG A;  4BD3 A;  1SRM A;  1ABO A;  2FEI A;  3OY9 A;  2K6D A;  4JRK A;  2K3B A;  2IG0 A;  2K57 A;  2RM4 A;  1BB9 A;  2LVM A;  4JJC A;  2L3P A;  1X2Q A;  4RG2 A;  2EWN A;  1Q7Y C;  1DJ7 B;  2RH2 A;  5GAN 5;  1BCO A;  2DPP B;  3X20 B;  3CCJ A;  3JB9 I;  3OYH A;  4M78 C;  1UJ0 A;  3FB9 A;  4NL2 A;  2BKD N;  5GAN d;  4RTZ A;  1RLP C;  1X6G A;  1RAC B;  2M1H A;  3M0Q A;  5GAM j;  1YI2 Q;  4BE2 A;  2HNI A;  1QVG A;  4DEX A;  1M1G A;  1NZ9 A;  2CZ0 B;  2ZPF B;  1K8A C;  2ZPB B;  1ACM B;  2JVV A;  5LJ3 f;  2MIO A;  2YWW A;  1QKW A;  3SEM A;  8AT1 B;  2LRQ A;  3QHS A;  5LJ3 g;  3I35 A;  3UDC A;  1D3B A;  4WCI A;  1QWF A;  2O88 A;  4FW2 A;  2DLP A;  2ZPI B;  3NMZ C;  5LJ5 j;  3BDL A;  1OEB A;  2EYW A;  3UA6 A;  3MEA A;  1VQL Q;  2RN8 A;  2K2V A;  2IPO B;  3HHT B;  1AT1 B;  1T0J A;  1K1Z A;  5D6W A;  2MWP A;  4JZ3 A;  5J3B A;  5GAN j;  3NFC A;  1JXO A;  3EFO B;  1IZ6 A;  2HQH A;  3NTH A;  2QAS A;  2NUZ A;  1YBY A;  1NE8 A;  2HSP A;  1UG1 A;  1N8R U;  1GFD A;  1FX7 A;  5GAM e;  2HBP A;  3VS2 A;  4PL6 A;  1AOJ A;  3HRU A;  1W2B A;  2AHJ B;  4ESR A;  4MML A;  2P4R A;  4HXJ A;  4OB2 B;  1IHV A;  2MPX C;  3CCM A;  5D7U A;  2DNU A;  4J9G A;  2R5M A;  3RBB B;  1U1T A;  3EAE A;  4XK8 E;  4O5V A;  2XD0 A;  1RLQ C;  4F04 B;  1BBZ A;  3QWY A;  4DBQ A;  3G71 T;  1WHL A;  4XU2 A;  3DLL A;  4NL3 A;  1WFW A;  2L0A A;  4OMP A;  1W6X A;  4HCB A;  2RB6 A;  4V2S A;  3CMA T;  2EQJ A;  3LGL A;  4EMK B;  4KGX B;  3JCM b;  3OW2 A;  1GCP A;  2ZCF B;  1K76 A;  1YJW A;  4AFZ C;  3G4S A;  1X75 C;  4JS4 A;  1N8R R;  3CC7 Q;  5CCA A;  3BW1 A;  2FB7 A;  4DBH A;  1FMW A;  1KD1 U;  1VQ7 A;  3TSW A;  3NTK A;  4M7A G;  2HBW A;  4N4I A;  3CPW S;  1VQN A;  2YLC A;  2YDL A;  1BI0 A;  3LWI A;  2DL3 A;  3EFS A;  1SG5 A;  3CME Q;  1OZ2 A;  3TEE A;  4R56 A;  1ZSZ C;  2JS2 A;  3M4Y A;  4EMG A;  1Q7Y R;  1G8X A;  3OMC A;  3RKW A;  2MF2 A;  4JJB A;  3CCS T;  1BYM A;  1SHG A;  2K7A A;  3CCE A;  1M8V A;  3HFN A;  2KBT A;  3BDU A;  2K3X A;  2V8J A;  2PUK B;  5IXB A;  1TUD A;  1YWO A;  2EQU A;  2CP0 A;  4JUV A;  5GAO p;  1QWE A;  2DIQ A;  3X26 B;  2CRE A;  3X24 B;  3QZ5 B;  3CBO A;  4D6W A;  3I56 T;  4FIB A;  1EIF A;  2F1L A;  3MP6 A;  3QXE B;  1YCY A;  4RMO A;  1YJ9 Q;  1R77 A;  1R0C B;  2LC4 A;  1AWW A;  2J6K A;  3NHN A;  3THK A;  1AD5 A;  1M1F A;  3OYI A;  1YJ9 T;  4D8K A;  4KT0 E;  4PJO D;  3H0H A;  4N0A C;  1X2K A;  3A5Z B;  2DL8 A;  5AT1 B;  1VQ8 Q;  1D0Y A;  2ZPE B;  4DOV A;  4JRP A;  4J9B A;  2RJF A;  4MMK A;  3V7R A;  2QK0 A;  2LQW A;  3WVD B;  1M90 U;  2QDL A;  4CC3 A;  1H3H A;  5LJ5 d;  4BI4 A;  2L89 A;  2DXU A;  3DB4 A;  1N8R C;  1LNX A;  4WTO B;  4LUD A;  1V1C A;  2DER A;  2ECZ A;  3CCV T;  4RG8 A;  4LNP A;  3CXC S;  4C8Q F;  4OF1 A;  3OYA A;  4GY5 A;  2MCN A;  1WPY A;  1TS9 A;  5LJ3 j;  2YUP A;  1BU1 A;  4KUD K;  4IIO A;  3G4S Q;  1R0B G;  1AWJ A;  3CC4 T;  4RTU A;  2QQS A;  4FCY A;  1WXB A;  1YCS B;  1B7T A;  5KYY B;  3C95 A;  1BI3 A;  3CCR Q;  5CK9 A;  3OYK A;  1B34 A;  4XTZ A;  3CMA A;  2JW4 A;  3A1P A;  1VYT A;  3CC2 A;  5IAY A;  2Y4Y A;  2LP5 A;  4PJL A;  3BFM A;  2CZ6 B;  2XKO C;  2D8J A;  2CH4 A;  3MPU B;  4PFP A;  3CCQ A;  2OTJ T;  4M7A E;  1ZBX A;  5LJ5 f;  1VQ7 Q;  1VQ5 T;  4X9C A;  1TUC A;  2A37 A;  2HL3 A;  2K5L A;  1UFF A;  2YRV A;  1LCK A;  1SPK A;  1PSF A;  2KRN A;  1JXM A;  4LDW A;  2CSQ A;  1GCQ C;  4HCK A;  3EG9 B;  4F7U B;  2BE7 D;  4ZGJ B;  5GAN e;  2QEX A;  1D0Z A;  1T3L A;  1I1J A;  1OX8 A;  1VQL A;  3MKD A;  5HK3 A;  1G3T A;  4AT1 B;  2O4X B;  5IHN A;  1WXU A;  2LQN A;  4C92 F;  1X27 A;  2DIL A;  3GF5 A;  2RF0 A;  1YIJ A;  3EG9 A;  4F7U A;  2ZZD A;  2DXC A;  5KYX A;  2L8D A;  2OTL A;  4N4H A;  2G3R A;  3LH5 A;  3PIO A;  4M7D D;  5AYF A;  3JB9 F;  2ABL A;  3G71 A;  2QA4 T;  3CD6 T;  2A7Y A;  2JJ9 A;  2RPN A;  3LX7 A;  4B9W A;  1KD1 R;  2LNV A;  5GJW B;  4C5I A;  1WNL A;  4Y92 A;  4ATO A;  2BZX A;  1YI2 A;  2O31 A;  4LDY A;  5L23 A;  2MI6 A;  3H0I A;  4CC7 A;  5C0M A;  3UAT A;  3ZFJ A;  4FM4 B;  4Z02 A;  3CCU A;  1UEB A;  3CCJ Q;  1NPP A;  2F5K A;  4XU0 A;  5LJ5 e;  1JRI A;  2V1R A;  4Z89 A;  4BAC A;  4RCB A;  4ELZ C;  4KH0 B;  2O2O A;  4BDZ A;  3VS7 A;  2KRM A;  2ED0 A;  4JJD A;  1XOV A;  3PTA A;  3S3O A;  4J9F A;  3LH0 A;  2JT4 A;  1ZBJ A;  5GAO l;  1GCQ A;  2FHD A;  4FYX B;  2D6F A;  2DO3 A;  4M75 E;  3J81 E;  1UHF A;  3JCM P;  2MOX A;  2PTK A;  3JB9 H;  1GRI A;  1RAG B;  3V7C A;  4B9X A;  2EQK A;  2RHZ A;  2FZK B;  5GAO n;  1XNI A;  3RES A;  2QQA A;  4M7D G;  2KK4 A;  4IUQ A;  3T9N A;  1U5S A;  5DLQ E;  2ROT A;  4DA4 A;  3KBG A;  2O9S A;  1YJW T;  2BZY A;  3A98 A;  4KGZ B;  3AHU A;  5KE3 A;  2M0Y A;  5CAI A;  2CP5 A;  3RNJ A;  4OMM A;  3CBM A;  1VQ6 A;  1KQ2 A;  2NLU A;  2VKN A;  3M56 A;  4PKC C;  2DRK A;  5J26 A;  3RMQ A;  3MEW A;  3QJY A;  1ZA2 B;  1AVZ C;  2RJD A;  4Z88 A;  4C8Q D;  3M0S A;  2DET A;  2DD4 A;  1KHC A;  1Q82 C;  4KGV B;  3H0F A;  1TXQ A;  1WHM A;  4IUP A;  4M75 B;  3JCM V;  4D8D A;  3N5B B;  2CKK A;  1GBQ A;  1HXD A;  1LVK A;  2VGM A;  3CPW P;  2DRM A;  2RMO A;  3OSS C;  1M3A A;  4HCC A;  1M2V B;  2VXE A;  4TVR A;  5GAN 6;  1IGU A;  3HL8 A;  4IKF A;  1VQP T;  3HFO A;  2GTJ A;  1SHF A;  1EFN A;  2BZ8 A;  3SWN B;  5GAN 2;  3OYD A;  4CRI A;  1VA7 A;  4KUL A;  1NG2 A;  3OSV A;  3EG0 A;  4P5N A;  1YIT Q;  4LDX A;  4JLI A;  1Z9Q A;  3WVE B;  3QKJ A;  3IQL A;  1TUG B;  3ME9 A;  5GAM f;  2EAY A;  1BKB A;  1YJN T;  3AT1 B;  1FMV A;  1VIF A;  1T3S A;  2FO0 A;  5GAO r;  3TSZ A;  3CCL A;  3LGF A;  2YUN A;  3HTR A;  2Y90 A;  1BI1 A;  1QQJ A;  2ZGW A;  5DLO A;  1OZ3 A;  2GF7 A;  1Y0M A;  2NUP B;  1RUW A;  2HMA A;  3L1A A;  2DEQ A;  4C92 D;  3QO3 A;  3CC4 A;  1WHH A;  1PKS A;  4J7F A;  4RTW A;  3LW5 E;  1K8A U;  1WDX A;  1D0X A;  1EZZ B;  5GMK m;  2OAW A;  2DM1 A;  2KQW A;  3HRS A;  4L59 A;  2PVG B;  4LD6 A;  3X25 B;  3CXC P;  2P0K A;  4M77 A;  4J9E A;  4OMQ A;  4F7U E;  2OTL T;  4GLK A;  2RHY A;  1Y7X A;  1MMD A;  4XTV A;  5IN1 A;  4YTL A;  2X9H A;  3OW2 S;  2CZ1 B;  4FYY B;  4J9I A;  3MO8 A;  2X4X A;  2AIR B;  4Y28 E;  4XQ3 A;  1RAA B;  1UB4 A;  5IXF A;  4RTV A;  2KYB A;  3S3M A;  4GLM A;  2H8H A;  2DXT A;  5LJ3 d;  4E7K A;  3EGD A;  2YRD A;  3R6N A;  2CP7 A;  1VUB A;  4KRT A;  3CPW A;  3EG3 A;  1Y57 A;  3O5Z A;  2CSI A;  3OYB A;  3GNG A;  2V26 A;  1PCX A;  1MMG A;  4M78 A;  1VQ9 Q;  3C4S A;  1WGS A;  2KXC A;  1JO8 A;  2CS7 A;  2X4J A;  2KT8 A;  4JLG A;  2ZAE A;  4ZN3 A;  2F2X A;  2CP2 A;  2EJF A;  1N9S A;  1Y07 A;  1MMA A;  1IRX A;  3M9Q A;  3VS1 A;  2ZPG B;  3CCV Q;  1KC8 R;  4M78 F;  1M3C A;  4QQ6 A;  3CME T;  2OAU A;  2C0T A;  2MYS A;  1ZHI A;  2P0P A;  5LL6 S;  3JB9 G;  5FU7 B;  1PKT A;  1S72 A;  2XDB A;  2GQI A;  2EKO A;  3HP9 A;  1JQQ A;  1I07 A;  4A4E A;  3QII A;  1WA7 A;  1YFN A;  1JBM A;  2LZ6 B;  1BIB A;  1ZUU A;  1D1C A;  3I5S A;  5GAO m;  1WXT A;  3MP1 A;  4J6W A;  4EPC A;  2RI5 A;  2CP3 A;  3G7Z A;  3CCE T;  4EMH A;  2J06 A;  1AHJ B;  2DIG A;  3EHR A;  3EH1 A;  3H41 A;  2H3J A;  2KEA A;  2LX9 A;  2DD5 A;  4AFQ C;  1NBE B;  2V8I A;  1YHQ Q;  4HT8 A;  3VU3 C;  1HK9 A;  1UTI A;  1NPR A;  3CXC A;  1SKU B;  3VYH B;  2EIF A;  3M0R A;  1NM7 A;  4M4Z A;  3U23 A;  4X9D A;  4A4G A;  1KQ1 A;  2YHT A;  2RHU A;  3G6E T;  3H9N A;  2L3Q A;  1VQN Q;  1UDL A;  4E6R A;  2EYX A;  1VOM A;  2JNG A;  4LD9 K;  1QLY A;  4L5G A;  2QAZ A;  3CD6 Q;  5KYU B;  1Q95 G;  2YLB A;  1OX9 A;  1NJI R;  2ZPH B;  3OMG A;  1TSF A;  2CGH A;  2XHC A;  5CKF A;  3F70 A;  4E47 A;  1G2B A;  4QVZ A;  2ROL A;  3M0T A;  1QCF A;  1PNJ A;  3GOX A;  1U3O A;  4PJO G;  2E10 A;  3CC2 T;  3L2W A;  1VQ6 Q;  4IUV A;  1QVP A;  1K8A R;  5CKH A;  2RQV A;  2PVO B;  1VQ4 Q;  3TCJ A;  2GBQ A;  2VVK A;  4PLL A;  4C92 C;  2CZ7 B;  4RUG A;  5GAO q;  4HCZ A;  2B8A A;  1VQP A;  3RIR A;  3TQ7 P;  5GMK i;  4MZT A;  5HKC A;  1S72 Q;  1M4Z A;  3FDR A;  4F16 A;  1G3S A;  4C5H A;  1UUE A;  1Q81 U;  2C06 A;  3A8G B;  3OQ5 A;  4Z8A A;  4J9C A;  4C8Q A;  2DJZ A;  4JZ4 A;  4FYV B;  1PHT A;  1VQM Q;  3OYC A;  2OTJ Q;  4X34 A;  1RI0 A;  1YI2 T;  1HSQ A;  2XK0 A;  2QA4 Q;  3L2Z A;  1I8F A;  2D0Q B;  4QQG A;  3CCQ Q;  1M90 R;  2JTF A;  1WHK A;  4NS5 A;  4ZNX A;  4ZN1 A;  1TH7 A;  2X3W D;  4HKE A;  4XU3 A;  1OOT A;  3CC2 Q;  4E7S A;  2L3R A;  3MJX A;  4FW1 A;  5GAN f;  3QBY A;  3FC3 A;  1M5Q 1;  1NYF A;  2GFU A;  2FZC B;  4IIM A;  4M75 C;  5I2S A;  1Q81 C;  1ZQ1 A;  2BTT A;  4M75 F;  4PJN A;  1Q86 C;  3E9G A;  1TOV A;  3JV3 A;  2YSQ A;  3CCU Q;  2EGC A;  1SSH A;  3V8K A;  4FT2 A;  3I9Q A;  3NTI A;  4BE0 A;  3LWH A;  2AKK A;  2JXB A;  4M7A B;  4JS5 A;  2WSC E;  2PZ1 A;  1W1F A;  2X4Y A;  2XDP A;  4M77 D;  1YWP A;  1K9M C;  5FRO A;  1PD0 A;  1KJW A;  3QYH B;  3ZL7 C;  3G71 Q;  1E7O A;  1FMK A;  1VQK Q;  1UGP B;  1PRL C;  2E41 A;  1AZE A;  2LX7 A;  1RAE B;  1K73 C;  5D6X A;  4QT7 A;  3EGU A;  2ATC B;  1M1K U;  3EGX A;  3JB9 J;  3I5R A;  4Y91 A;  3VS5 A;  4EMK C;  1KC8 C;  1Q7Y U;  2W0Z A;  2PQW A;  5FW9 A;  3EH2 A;  2RI3 A;  3CCJ T;  4HVU A;  3TRE A;  4C8Q C;  1VQO A;  3D7S B;  3S6W A;  2V1Q A;  1I5L A;  2LQ8 A;  2VV5 A;  5C6S A;  2QEX Q;  5GAN 7;  1O9S A;  4L6V 5;  1WHJ A;  2D9T A;  2DTO A;  2LJ1 A;  1YJ9 A;  9ATC B;  5J39 A;  3REB B;  1WYX A;  2ENM A;  5GMK l;  3VRZ A;  1Q86 R;  1C0M A;  1OYX A;  2DYB A;  2KGT A;  2P0Q A;  2HSE B;  4AFU C;  2J7I A;  3V8L A;  3EG2 A;  4M77 E;  2K5F A;  2EYY A;  4XTX A;  3JSC A;  2HKN A;  4RKU E;  1FYN A;  3SWN A;  4N0A A;  1GBR A;  2NUT B;  2KI7 A;  3QDR B;  4RTY A;  2D1X A;  4F7U F;  1ZX6 A;  4M78 D;  2JMC A;  2CH4 W;  3M4G A;  2LCS A;  4EDU A;  2DVJ A;  1PM3 A;  3GLX A;  2VB6 A;  1SEM A;  2X3X D;  3MP8 A;  2QXF A;  3QWX X;  2D0N A;  4F14 A;  2A3L A;  4C92 B;  3L2U A;  2DZ9 A;  2GNC A;  4OGE A;  3EG1 A;  4O6J A;  2RA2 A;  2GFA A;  2LJ3 A;  1MV3 A;  1YN8 A;  5CO7 A;  2L5Q A;  3MCA B;  4C5E A;  1OI1 A;  2LCL A;  3FEO A;  3UF4 A;  2QG9 B;  1KQS P;  3VV0 A;  1VQO Q;  4DBR A;  1TG0 A;  1N9R A;  2HKQ B;  5CKD A;  3JCM f;  3QDF A;  5I11 A;  1UGR B;  1AZG B;  3VJP A;  2RK1 A;  3M59 A;  4A4K A;  3PVL A;  4M78 B;  5GMK e;  5IHK A;  1OPK A;  3CCM Q;  1UEC A;  1KQS A;  2LNH B;  1Y96 A;  3CCS A;  3DKM A;  2K79 A;  4RTT A;  2E5Q A;  2O9V A;  3JCM X;  1Q81 R;  2SRC A;  2GGR A;  2QTV A;  2EJG A;  1W2B P;  1WIE A;  3RKY A;  1KD1 C;  3GNF B;  3JCM J;  4X1V A;  4E7H A;  2YUO A;  1D3B B;  3X28 B;  5KH6 A;  2AZV A;  3J80 E;  2EBP A;  2JUF A;  5FU6 B;  3GPL A;  5FU7 C;  1IRE B;  3A8M B;  4FU6 A;  2E3H A;  3OYE A;  2E3I A;  3OB9 A;  2MAM A;  4MDX A;  4XTW A;  4EIK A;  3QJ6 A;  1AEY A;  4PFO A;  1IO6 A;  2O4X A;  2DX1 A;  4ME7 A;  4JJN K;  3PGG A;  1JEG A;  2C0O A;  4M7D A;  5DY9 A;  3O8V A;  4C92 G;  3SFM A;  2QEX T;  2CUB A;  1R8O B;  2R5A A;  2EQI A;  1VQK A;  2KE9 A;  1M1K R;  2E6Z A;  1TU0 B;  4HVV A;  2J6F A;  5IH2 A;  4RCC A;  4QW2 A;  5CKE A;  4C0G A;  3TVT A;  3KFV A;  3INZ A;  3CC7 A;  1QP2 A;  1VQM A;  1ZSZ A;  2RQU A;  2XMF A;  2DEU A;  3I56 Q;  4E2F B;  3CEY A;  3VUZ A;  3M53 A;  3G6E A;  2I0N A;  4MDW A;  2W10 A;  2VXF A;  2DTI A;  1OU8 A;  1WQ7 A;  2OTL Q;  1GL5 A;  3VRY A;  2DFU A;  3BY7 A;  2QQ9 A;  1XJW B;  4OVA A;  3E2U A;  3NPF A;  3QUI A;  3CBP A;  4LN2 A;  4ZGE B;  2R57 A;  5FRN A;  2QGF B;  3ASK A;  2E4H A;  2FVU A;  3FRN A;  2KY9 A;  2QQB A;  1YJN A;  4QVC A;  5GAN 4;  4M78 E;  3C0C A;  5A0L A;  2G6F X;  2CUD A;  3G6E Q;  4E7L A;  1C6V X;  1G3Y A;  2JM8 A;  1M2V A;  3OYF A;  2OTJ A;  5CQY A;  1VQ7 T;  1Q86 U;  4BY6 C;  1ZSG A;  4BDY A;  1S72 T;  2JOY A;  1T0H A;  1CKB A;  1PWT A;  3CD6 A;  1RL2 A;  3L2V A;  2I2L A;  2L2P A;  2IVW A;  1WJS A;  3FIF A;  1YJN Q;  3EGX B;  1KIK A;  5FRM A;  1J3T A;  1OPL A;  1RI9 A;  4PNO A;  3UWN A;  4BUG A;  2LJ0 A;  5CIU A;  1TWB A;  4JRQ A;  4AMC A;  4OP0 A;  2EGA A;  1YIT T;  1BCM A;  1VQL T;  1Y71 A;  2EGE A;  4ZGD B;  4E7J A;  3VS0 A;  4NOY A;  3CCR A;  2EQM A;  3A8H B;  3JCM e;  2HZY A;  3P8H A;  5GAN 3;  2DVE A;  1M2O A;  2E70 A;  2NUT A;  1X6B A;  3QSU A;  3URG A;  1OV3 A;  4OMN A;  2MWO A;  5HK0 A;  1VYU A;  4E7Z A;  1VIE A;  3I56 A;  4JDS A;  1W2B S;  1UGQ B;  5GAM g;  1F1B B;  1VQ4 T;  2DKG A;  1IGQ A;  1RAD B;  2R58 A;  3EGD B;  1VQ6 T;  1MUZ A;  1H92 A;  1UE9 A;  1VQ5 Q;  2DL7 A;  4J83 A;  1LPL A;  1M8M A;  4LE9 A;  1M30 A;  2VC8 A;  3HPW A;  1RAH B;  2EJ9 A;  5KYW B;  2ED1 A;  4OB1 B;  4A63 B;  5GMK j;  2EW3 A;  3JCM Q;  4CC2 A;  2RK2 A;  2VGN A;  2PUO B;  3V8J A;  3CCV A;  1BI2 A;  2E65 A;  3JCM W;  1Y96 B;  1G3W A;  2XI9 A;  1QVF S;  1YHQ A;  2EYZ A;  2ESW A;  1MHN A;  2L3S A;  3C12 A;  3NGP A;  3PE0 A;  2RO0 A;  1N6A A;  1MMN A;  3OYL A;  2XID A;  2JMA A;  1NEB A;  2RJE A;  3HKS A;  3RDV A;  2F69 A;  3PIP A;  3QZ9 B;  4M7D B;  3WXM B;  1M3B A;  3M0U A;  1NJI C;  3L2Q A;  5FWC A;  3QPH A;  2AZS A;  2KXD A;  5ECA A;  2C0I A;  2E64 A;  3VYG A;  1RAI B;  5L8R E;  3CCS Q;  2M02 A;  2A08 A;  2XIC A;  1QCO A;  2WSF E;  3CCE Q;  2OX7 A;  2J6O A;  1N5Z A;  1E6H A;  2EFI A;  3KUF A;  1MNE A;  2VYT A;  4HT9 A;  3JB9 D;  2DBM A;  3CME A;  4PLI A;  4J6X A;  4C0D C;  3I55 A;  4LUE A;  3CC7 T;  3OW2 P;  3OS2 A;  2KRO A;  3REA B;  1YNZ A;  3SWN C;  1CKA A;  5GMK h;  2PVD B;  3E1S A;  4PFZ A;  1VQ9 A;  1KSW A;  1AWX A;  2NYS A;  1IXD A;  2OJ2 A;  3PNW C;  4FSS A;  2GTO A;  4PJO C;  1PC0 A;  1VQN T;  4FT4 A;  2AKL A;  2HCK A;  2K2M A;  2KRS A;  4VUB A;  3OS0 A;  1VQO T;  3RR6 A;  2M9U A;  2NWM A;  3J7A F;  2HQE A;  3P8B B;  4ELY C;  4UC4 A;  2YRC A;  1ABQ A;  3MHX A;  1U1S A;  1I5O B;  3VS4 A;  4R0K A;  3M57 A;  1U06 A;  3GBQ A;  1KK7 A;  3OYY A;  1WJR A;  5GAM d;  2HQX A;  3JCM d;  4AFS C;  3OYG A;  3JCM h;  4LXC A;  3OS5 A;  4II1 A;  1WHG A;  1NEG A;  2P4T A;  2DK3 A;  4JPB W; 
#chains in the Genus database with same CATH homology
 2FL7 A;  4BD3 A;  2RHZ A;  3MET A;  4M77 C;  2RI3 A;  4XTU A;  2QI2 A;  5GAO n;  3CCJ T;  3TRE A;  4C8Q C;  1VQO A;  4A4H A;  4N4G A;  1XNI A;  3SB2 A;  3OY9 A;  4JRK A;  3S6W A;  1I5L A;  3RUX A;  3RES A;  5KE2 A;  4PJO D;  2QQA A;  2LQ8 A;  4M7D G;  2VV5 A;  2IG0 A;  2K57 A;  2RM4 A;  2KK4 A;  5C6S A;  5GAN 7;  2LVM A;  2K3Y A;  4IUQ A;  1O9S A;  1WJQ A;  4L6V 5;  2D9T A;  3T9N A;  2DTO A;  5DLQ E;  1U8R A;  4DA4 A;  3KBG A;  1YJ9 A;  2MMP A;  1YJW T;  4RG2 A;  4OGC A;  5J39 A;  4M75 A;  2EWN A;  3JCM g;  1H64 1;  5GMK l;  5KE3 A;  3AHU A;  1Q7Y C;  1DJ7 B;  5CAI A;  2RH2 A;  4OB3 B;  5GAN 5;  4PJO A;  3CBM A;  4HA8 A;  4M75 D;  1VQ6 A;  1OYX A;  3QYG B;  1KQ2 A;  2DPP B;  2NLU A;  3LYI A;  3X20 B;  3CCJ A;  1KG1 A;  3JB9 I;  3OYH A;  4JRI A;  4M78 C;  2P0Q A;  1K73 U;  3CCQ T;  3FB9 A;  3M56 A;  4PKC C;  4NL2 A;  5J26 A;  4OB0 B;  3RMQ A;  3MEW A;  3QJY A;  2LTO A;  3V8L A;  2BKD N;  5GAN d;  1QVG S;  2M1H A;  5GAM j;  4BE2 A;  2HNI A;  1QVG A;  2LCC A;  4M77 E;  2K5F A;  5I21 A;  1X01 A;  1K9M U;  4XTX A;  2QQR A;  1X6O A;  2RJD A;  3JSC A;  4C8Q D;  1M1G A;  1NZ9 A;  5IT9 E;  2CZ0 B;  4RKU E;  2ZPF B;  2DD4 A;  5A0G A;  1KHC A;  3SWN A;  1Q82 C;  4PJO B;  4N0A A;  1B34 B;  5GMK i;  3C94 A;  2ZPB B;  1VQ9 T;  1K8A C;  4IUP A;  3QDR B;  2QTX A;  4M75 B;  3JCM V;  3N5B B;  2CKK A;  4F7U F;  4M78 D;  1MGQ A;  1HXD A;  2JVV A;  2VGM A;  3M4G A;  5LJ3 f;  4EDU A;  1VQ8 T;  3ZEH A;  4XTY A;  3GLX A;  4C92 A;  2PU9 B;  4QQD A;  3OSS C;  4HCC A;  3RKX A;  2QA4 A;  2LRQ A;  3MP8 A;  3QHS A;  2QXF A;  4C5G A;  5LJ3 g;  2VXE A;  2A3L A;  4TVR A;  4C92 B;  4IUT A;  3L2U A;  3UDC A;  5KCO A;  1D3B A;  2DZ9 A;  2KMT A;  3M55 A;  4OGE A;  4A53 A;  5GAN 6;  3HL8 A;  4IKF A;  4O6J A;  2RA2 A;  5GAN g;  3HFO A;  1VQP T;  1XTD A;  2GFA A;  2ZPI B;  5LJ5 j;  3BDL A;  3ZBD A;  3SWN B;  4IUU A;  5CO7 A;  5GAN 2;  2L5Q A;  3MEA A;  3MCA B;  4C5E A;  2XDD A;  1OI1 A;  2LCL A;  4CRI A;  3OYD A;  3VKI A;  3FEO A;  4KUL A;  3OSV A;  2K2V A;  4P5N A;  3HHT B;  4LDX A;  4JLI A;  5D6W A;  2MWP A;  3VV0 A;  5J3B A;  5GAN j;  3NFC A;  3WVE B;  1N9R A;  3QKJ A;  3ME9 A;  5CKD A;  1IZ6 A;  3NTH A;  3JCM f;  4M7D C;  2KVQ G;  5GAM f;  1UGR B;  5LJ3 h;  3H8Z A;  3VJP A;  2EAY A;  2RK1 A;  1BKB A;  3M59 A;  4A4K A;  1YJN T;  1YBY A;  1NE8 A;  3OBW A;  1VQ4 A;  1VIF A;  1N8R U;  4LDV A;  1FX7 A;  4M78 B;  4DOW A;  2HBP A;  5GAM e;  5GMK e;  5GAO r;  3CCL A;  4PL6 A;  1G5V A;  4C0D B;  3LGF A;  3HRU A;  1I4K 1;  1KQS A;  5CQX A;  2BIV A;  4A4F A;  2Y90 A;  1BI1 A;  2AHJ B;  1W2B A;  1Y96 A;  4MML A;  3GIB A;  4J6Y A;  3CCS A;  1H3Z A;  3DKM A;  4BI3 A;  2ZGW A;  2E5Q A;  4OB2 B;  5DLO A;  3JCM X;  1OZ3 A;  3EFR A;  3CCM A;  2EJG A;  2GF7 A;  3L1A A;  2R5M A;  4C92 D;  1U1T A;  2DEQ A;  3EAE A;  4O5V A;  4XK8 E;  2XD0 A;  3QO3 A;  1FWZ A;  3RKY A;  1KD1 C;  3CC4 A;  3GNF B;  3JCM J;  4E7H A;  4M77 G;  4J7F A;  2LT4 A;  1W4S A;  2WAC A;  4BY6 B;  5D6Y A;  1D3B B;  3DLM A;  4M7A F;  3G71 T;  3X28 B;  2RJC A;  5KH6 A;  4BI8 B;  3J80 E;  3LW5 E;  2GQV A;  3UT1 A;  1K8A U;  4XU2 A;  3DLL A;  2RI2 A;  4NL3 A;  2LDM A;  5GMK m;  2KQW A;  2JUF A;  3HRS A;  2PVG B;  4L59 A;  4LD6 A;  5FU6 B;  3GPL A;  5FU7 C;  4J7I A;  3X25 B;  1IRE B;  1WQW A;  3A8M B;  4HCB A;  2P0K A;  4FU6 A;  2RB6 A;  4M77 A;  5LJ5 g;  4V2S A;  3OYE A;  1M90 C;  2EQJ A;  4R55 A;  3CMA T;  3LGL A;  3OB9 A;  4EMK B;  2E1H A;  3MEU A;  3JCM b;  4F7U E;  2MAM A;  4QVD A;  3OW2 A;  2OTL T;  4GLK A;  2RHY A;  4MDX A;  1Y7X A;  3OBY A;  1SSF A;  4XTV A;  4YTL A;  5IN1 A;  3OW2 S;  4XTW A;  2K4Y A;  2CZ1 B;  3QJ6 A;  2ZCF B;  4EMK A;  1VQM T;  3MO8 A;  4KBM B;  2X4X A;  1YJW A;  4Y28 E;  4CI0 C;  1X75 C;  3G4S A;  3V7S A;  2O4X A;  4XQ3 A;  4JS4 A;  4ME7 A;  4C0Z A;  4JJN K;  3PGG A;  5CCA A;  2JZ2 A;  3BW1 A;  2FB7 A;  1UB4 A;  4M7D A;  5A2Q E;  1KD1 U;  5DY9 A;  3SDZ A;  3O8V A;  4C92 G;  3SFM A;  4F7U G;  2QEX T;  1KQS S;  1VQ7 A;  1R8O B;  2R5A A;  3S3M A;  2DXT A;  3NTK A;  5LJ3 d;  4E7K A;  1VQK A;  4M7A G;  1V29 B;  4N4I A;  2E6Z A;  3CPW S;  3KXT A;  2YLC A;  1VUB A;  1VQN A;  2BUD A;  1BI0 A;  3LWI A;  5LJ5 h;  5DM7 R;  3EFS A;  2WSE E;  1M9S A;  3CPW A;  4RCC A;  4QW2 A;  3OYJ A;  1OZ2 A;  3TEE A;  4IUR A;  5CKE A;  4C0G A;  4R56 A;  3M4Y A;  4EMG A;  3INZ A;  3X26 B;  3CC7 A;  1YHQ T;  1QP2 A;  3CCU T;  3OMC A;  3RKW A;  1VQM A;  2MF2 A;  3OYB A;  1QW1 A;  3CCS T;  4ZTF A;  1BYM A;  5A0D A;  3CCE A;  3CEY A;  3GNG A;  1FXX A;  3VUZ A;  1M8V A;  3M53 A;  3HFN A;  3CCL T;  3QG1 A;  3BDU A;  3OS1 A;  2K3X A;  5HY6 A;  3G6E A;  4M78 A;  2V8J A;  3C4S A;  1WGS A;  3E9F A;  4MDW A;  4OMF B;  2E6N A;  2PUK B;  2XG8 D;  2CS7 A;  2X4J A;  3PMT A;  4JLG A;  1M1K C;  4ZN3 A;  2EQU A;  2VXF A;  4JUV A;  5GAO p;  2DTI A;  2K5I A;  2EJF A;  2DIQ A;  1N9S A;  1WQ7 A;  1Y07 A;  5I2M A;  3QZ5 B;  2V8K A;  3BY7 A;  2QQ9 A;  3M9Q A;  4OVA A;  3X24 B;  3CBO A;  4DQ2 A;  4D6W A;  2ZPG B;  3I56 T;  4FIB A;  3SD4 A;  1EIF A;  5GAN h;  2DXB A;  4M78 G;  1QP3 A;  3QUI A;  4M7A C;  3MP6 A;  3QXE B;  4M78 F;  3CBP A;  1YCY A;  4RMO A;  4ZGE B;  3DB3 A;  1UGS B;  2LC4 A;  2R57 A;  4QQ6 A;  3CME T;  2OAU A;  1P92 A;  2LT1 A;  3L42 A;  5FRN A;  3S3N A;  2X4W A;  3ASK A;  2DTH A;  2FVU A;  3FRN A;  2HD0 A;  1M1F A;  2KY9 A;  3OYI A;  4M75 G;  1YJ9 T;  1ZHI A;  4KT0 E;  2P0P A;  2QQB A;  5LL6 S;  3JB9 G;  1YJN A;  5FU7 B;  4QVC A;  4N0A C;  2HAX A;  5GAN 4;  3M5A A;  3A5Z B;  4M78 E;  1S72 A;  2XDB A;  4PJO E;  1PSE A;  2E12 A;  2EKO A;  3HP9 A;  5A0L A;  2ZPE B;  4DOV A;  4JRP A;  4E7L A;  4A4E A;  3QII A;  2RJF A;  1G3Y A;  4MMK A;  3OYF A;  2VUB A;  1JBM A;  3V7R A;  2OTJ A;  1BIB A;  2F5T X;  5CQY A;  1VQ7 T;  1Q86 U;  4BY6 C;  5GAO m;  1VQK T;  3MP1 A;  2FYK A;  4J6W A;  4BDY A;  2JOY A;  1S72 T;  4EPC A;  3WVD B;  1M90 U;  2RI5 A;  3G7Z A;  4M7D F;  3CCE T;  4C8Q E;  5LJ5 d;  4BI4 A;  2L89 A;  1RL2 A;  3L2V A;  3CD6 A;  2I2L A;  4EMH A;  2DXU A;  2IVW A;  3JRZ A;  3DB4 A;  1N8R C;  3VUB A;  1AHJ B;  1LNX A;  1WJS A;  2DIG A;  2H3J A;  3FIF A;  3PFS A;  2LX9 A;  2DD5 A;  3CCV T;  2RD1 A;  4RG8 A;  5FLX E;  5FRM A;  2V8I A;  1O75 A;  4PNO A;  3UWN A;  4BUG A;  3CXC S;  4HT8 A;  5CIU A;  3VU3 C;  4OF1 A;  4C8Q F;  1HK9 A;  4JRQ A;  1NPR A;  3CXC A;  4OP0 A;  3OYA A;  4M77 F;  4GY5 A;  1YIT T;  1WPY A;  5LJ3 j;  1VQL T;  3FJP A;  1KHI A;  3VYH B;  1Y71 A;  4KUD K;  2EIF A;  4C0F A;  4ZGD B;  3LLR A;  4E7J A;  4BB7 A;  4NOY A;  3CCR A;  2EQM A;  4X9D A;  4A4G A;  3A8H B;  4KUI A;  1KQ1 A;  3JCM e;  3L2R A;  2YHT A;  3CC4 T;  2RHU A;  2DAQ A;  4M7A A;  3G6E T;  3P8H A;  5GAN 3;  1JJ2 A;  2QQS A;  2DVE A;  2E70 A;  3RER A;  5KCH A;  3QSU A;  3URG A;  2O01 E;  3HRT A;  2JNG A;  3H6Z A;  4LD9 K;  2MWO A;  5HK0 A;  3C95 A;  1BI3 A;  4L5G A;  1VIE A;  3ER0 A;  5CK9 A;  3I56 A;  3OYK A;  4JDS A;  2YLB A;  3P8D A;  2ZPH B;  3OMG A;  1B34 A;  3A8L B;  4XTZ A;  1UGQ B;  1W2B S;  1KC8 U;  5GAM g;  1JB0 E;  3CMA A;  1VQ4 T;  4BE1 A;  3TU4 K;  2DKG A;  2CGH A;  3CC2 A;  2XHC A;  5IAY A;  2Y4Y A;  2R58 A;  5CKF A;  3BFM A;  2CZ6 B;  2XKO C;  3F70 A;  1VQ6 T;  4E47 A;  2M0O A;  2RHI A;  1I81 A;  4J83 A;  4QVZ A;  3CCQ A;  3OYN A;  2OTJ T;  1Q82 U;  2VC8 A;  3HPW A;  4M7A E;  1ZBX A;  3GOX A;  3JAM E;  5LJ5 f;  4PJO G;  2E10 A;  3CC2 T;  3E19 A;  2EJ9 A;  1VQ5 T;  4X9C A;  4OB1 B;  3L2W A;  4IUV A;  2K5L A;  2YRV A;  1QVP A;  5GMK j;  2EYQ A;  5CKH A;  3JCM Q;  2RK2 A;  2PVO B;  3CPF A;  5LJ3 e;  2X35 A;  1N27 A;  2VGN A;  4XAX B;  3TCJ A;  1PSF A;  2KSS A;  2PUO B;  4PLL A;  4C92 C;  2CZ7 B;  5GAO q;  3V8J A;  3CCV A;  3PMI A;  4HCZ A;  4LDW A;  1BI2 A;  2B8A A;  2E65 A;  1VQP A;  3CCR T;  3RIR A;  3JCM W;  4M77 B;  1Y96 B;  1G3W A;  2DZC A;  2KDS A;  4C8Q G;  4F7U B;  2XI9 A;  4MZT A;  4XU1 A;  4ZGJ B;  5GAN e;  1QVF S;  1YHQ A;  1BIA A;  5HKC A;  2QEX A;  1M4Z A;  4C92 E;  1MHN A;  3FDR A;  1YIT A;  3C12 A;  2Y4X A;  5FU6 C;  1G3S A;  2RO0 A;  4ZTJ A;  3GP8 A;  1VQL A;  1N6A A;  5HK3 A;  3FLG A;  1G3T A;  1LJO A;  4C5H A;  3OYL A;  1Q81 U;  2C06 A;  2O4X B;  2XID A;  3HKS A;  2RJE A;  3A8G B;  3OQ5 A;  2F69 A;  4C92 F;  3PIP A;  4C8Q A;  3MEV A;  3G4S T;  2DJZ A;  3Q1J A;  1GXI E;  3GF5 A;  3QZ9 B;  4M7D B;  3WXM B;  5CVI A;  1YIJ A;  3OYC A;  4J5Y A;  4F7U A;  4X34 A;  2ZZD A;  1NJI C;  1RI0 A;  3L2Q A;  2DXC A;  2L8D A;  1YI2 T;  2OTL A;  5CR2 A;  4N4H A;  4MZM A;  1VQ8 A;  2G3R A;  2XK0 A;  2QDY B;  3QPH A;  3L2Z A;  3PIO A;  5CKB A;  1I8F A;  2E64 A;  3VYG A;  5L8R E;  5AYF A;  4M7D D;  3JB9 F;  2D0Q B;  4QQG A;  2JTF A;  4C8Q B;  1VQ5 A;  4M7D E;  5EG2 A;  3G71 A;  2QA4 T;  4FL6 A;  2A7Y A;  3CD6 T;  3M54 A;  4NS5 A;  2XIC A;  3HSB A;  4J8O A;  4ZN1 A;  1TH7 A;  2WSF E;  4HKE A;  1NJI U;  4XU3 A;  3R6O A;  1JJ2 S;  3LX7 A;  2EFI A;  2L3R A;  3KUF A;  5GAN f;  2VYT A;  2JN0 A;  3QBY A;  3JCM c;  1M5Q 1;  3FC3 A;  4HT9 A;  2GFU A;  2CYZ B;  4B9W A;  2LNV A;  4LDU A;  3JB9 D;  4C5I A;  1WNL A;  4Q5W A;  5M9O A;  3CME A;  4PJO F;  4M75 C;  4ATO A;  4PLI A;  4J6X A;  2KAF A;  1YI2 A;  4LDY A;  4C0D C;  5I2S A;  5GAN 8;  1ZQ1 A;  2MI6 A;  3I55 A;  1Q81 C;  4M75 F;  1QVF A;  1Q86 C;  3E9G A;  3CC7 T;  5C0M A;  3ZFJ A;  4FM4 B;  3RMS A;  4Z02 A;  3OS2 A;  4FSX A;  3CCU A;  2GCX A;  3OA6 A;  1UEB A;  3SWN C;  5GMK h;  2PVD B;  3E1S A;  1VQ9 A;  3V8K A;  4FT2 A;  3CCM T;  1NPP A;  2F5K A;  4XU0 A;  5LJ5 e;  1XQH A;  3NTI A;  4WF2 A;  1JRI A;  3I55 T;  3PNW C;  4BAC A;  1LOJ A;  4BE0 A;  3LWH A;  2JTM A;  4RCB A;  4PJO C;  4ELZ C;  4BDZ A;  1VQN T;  4FT4 A;  4M7A B;  4JS5 A;  2WSC E;  4VUB A;  3PT9 A;  1XOV A;  3PTA A;  2X4Y A;  2XDP A;  4M77 D;  1K9M C;  3OS0 A;  5FRO A;  1VQO T;  3M58 A;  2M9U A;  3QYH B;  3J7A F;  2HQE A;  2LQK A;  3P8B B;  4ELY C;  4M7A D;  3S3O A;  4UC4 A;  3MHX A;  3A8O B;  4MZP A;  1U1S A;  1UGP B;  4E7I A;  2E41 A;  3LH0 A;  4A54 A;  3M57 A;  5GAO l;  1K73 C;  3UPU A;  2FHD A;  5D6X A;  3OYY A;  2D6F A;  1WJR A;  5GAM d;  2HQX A;  2DO3 A;  3JCM d;  5GAM h;  4M75 E;  3J81 E;  3OYM A;  3OYG A;  1M1K U;  3JCM h;  2XU8 A;  3JCM P;  3JB9 J;  3JB9 H;  2RHX A;  3OS5 A;  4Y91 A;  4II1 A;  4EMK C;  3V7C A;  2M16 A;  4B9X A;  1YIJ T;  1Q7Y U;  2P4T A;  1KC8 C;  2DK3 A;  2EQK A;  2PQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...