2RJCA

Crystal structure of l3mbtl1 protein in complex with mes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
313
structure length
313
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 79
structure length 313
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjcA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjcA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjcA03
3OQ5A 3QKJA 3OB9A 3NTIA 2RI2A 3C4SA 3LGFA 1SSFA 2XK0A 3QJ6A 3BDLA 3ZEHA 4C5HA 2RHXA 5KE3A 4Z02A 3NTHA 3E9FA 4N4GA 2EKOA 2R5AA 3DB3A 2QQSA 2E6NA 3ASKA 4BDZA 3OYKA 5CIUA 3LGLA 3PNWC 3OMCA 1WJRA 4E7KA 4EDUA 3H6ZA 2K3YA 3FLGA 3Q1JA 3OYGA 2L3RA 4BE2A 2LVMA 4BDYA 4FU6A 3OYFA 2L89A 2L8DA 2D9TA 5IN1A 1N27A 3OYHA 3F70A 2IG0A 2BUDA 4UC4A 3FEOA 4E7IA 3LLRA 2RHYA 5M9OA 2O4XA 3PMTA 3L2VA 2MWPA 2X35A 2RHIA 5C0MA 1OI1A 3OYEA 4RG2A 3OYAA 1WGSA 4BACA 3DB4A 3CEYA 4E7HA 3L2QA 2X4XA 5D6WA 5J26A 4II1A 3OS1A 2HQEA 4C5EA 3S3MA 3S3OA 2FHDA 2QQRA 1XNIA 2WACA 2PQWA 4ZTJA 2LDMA 2RI5A 3MO8A 5KH6A 3META 3OYLA 2F5KA 3MEVA 3MEAA 1WJQA 4A4FA 3MP8A 3ME9A 4QQDA 3DLMA 4QW2A 2LCCA 2RO0A 3UT1A 1H3ZA 2GF7A 4L59A 4HCZA 2EQJA 4B9XA 4LD6A 3MP6A 3LYIA 3OYMA 3OYJA 3UWNA 3EAEA 2X4YA 2JZ2A 4IUPA 5C6SA 2R5MA 3P8DA 3OYDA 3S3NA 3OY9A 4ZTFA 2G3RA 2DAQA 2DIQA 4CRIA 3MP1A 3P8HA 3QIIA 1WJSA 5J39A 2E5QA 2RHUA 3GOXA 2JTFA 2M1HA 2R58A 2RJDA 1OYXA 4N4IA 4QQ6A 4BE1A 2BIVA 4IUVA 4NS5A 2VYTA 2LRQA 5D6XA 4IURA 4BE0A 2EQMA 2HQXA 3LH0A 4B9WA 3H8ZA 2B8AA 4OVAA 4IUQA 5D6YA 3OYCA 3MEWA 3OYNA 5FROA 2RHZA 2GFAA 3L2RA 1OZ3A 2O4XB 2RI3A 2M0OA 2R57A 4C5IA 4X34A 4IUTA 3S6WA 4PL6A 3L2WA 4BD3A 3SD4A 4A4HA 2MWOA 3PMIA 1RI0A 2YRVA 4A4GA 4A4EA 4E7LA 3O8VA 3PFSA 4E7JA 3MEUA 4FL6A 4C5GA 3OS0A 4QQGA 5FRNA 2K3XA 1G5VA 1OZ2A 3LX7A 2P0KA 2DIGA 2BKDN 2M16A 3L42A 4PLIA 4IKFA 3FC3A 5FRMA 3OYBA 3NTKA 4PLLA 2EFIA 3M9QA 4Q5WA 4IUUA 2EQUA 4QVZA 5IAYA 5KCOA 4N4HA 2RJCA 2X4WA 3OYIA 5KCHA 3OS2A 2EQKA 3E9GA 1KHCA 2NLUA 2CKKA 3L2UA 2GFUA 2RJFA 3FDRA 3OMGA 4GY5A 2XDPA 2LTOA 3QBYA 2RJEA 5KE2A 3KUFA 3OA6A 1MHNA
chains in the Genus database with same CATH superfamily
3QKJA 2EYXA 5CK9A 2HEQA 2K79A 3NTHA 3BE3A 1KQ1A 2EJGA 1VQ8A 1YJNT 5CQYA 3OMCA 1YJ9A 4AFUC 1SG5A 5A2QE 2P0PA 1QLYA 3F70A 1VQPA 4LXCA 2OJ2A 4M77D 2RQTA 4JZ4A 3JCMc 3TQ7P 3CCUA 2H8HA 2K4YA 2QG9B 2RHYA 2XHCA 3O5ZA 4E2FB 4M7DE 4PJOA 1VQLA 1JJ2S 4XAXB 3QUIA 5CO7A 1Q7YU 2DERA 1R8OB 2FHDA 2KXCA 2LDMA 4KH1B 2LMJA 1SRLA 1VQ5Q 4JLIA 4XK8E 2PZ1A 4R55A 3ME9A 4JRKA 1KQ2A 4DA4A 4X9DA 4CC7A 3MP6A 3RKWA 2EGCA 2HSEB 1ZHIA 4M75A 1MV0B 3BW1A 2X4YA 4EMGA 4M7DF 4J9EA 4M7AB 3G4SA 5I11A 3EG0A 2EYQA 2LC4A 1VQNQ 2DXBA 1EZZB 3SHWA 2HBPA 2IVWA 4Z8AA 2EQMA 2AKKA 3LH0A 5GANd 5HK3A 4PFZA 3PIOA 3MEWA 4QT7A 1SHFA 1VQ5T 4C5IA 2GBQA 4PJLA 2XG8D 2E65A 1RUWA 4ANJA 3VYHB 5D7UA 3QZ9B 1UEBA 3G6EQ 3LX7A 5FLXE 5GAOm 3CC2Q 4GLKA 1VUBA 1VQNT 1BI1A 2EFIA 1PWTA 4OB1B 4E7SA 1K9AA 5GMKj 9ATCB 1C0MA 3X24B 1Z9QA 4RCBA 3BFMA 1K9MU 4RKUE 3QBYA 4B9XA 5GAN6 1M5Q1 1WIEA 2KXDA 5DM7R 3BDLA 1AWOA 1M1FA 2J05A 3EG3A 2EKOA 2D8JA 2K9GA 2FEIA 4FSXA 3GNFB 2CP7A 3CC2T 3H0IA 3HRUA 3KXTA 1KG1A 4M7AD 3CMEQ 1ZSZA 1Q81U 3QZ5B 2AT1B 3G71Q 4KGVB 2MI6A 4M78C 1X6BA 2YLBA 1BCMA 3VS4A 1Q86R 1Z9ZA 1M90R 1G3TA 4L6V5 3UDCA 2X4XA 2EKHA 3M58A 3S3OA 1K73R 3VUBA 1B34A 3META 4XTZA 2LCCA 1YNZA 3JB9D 1Y7XA 3SEMA 2QA4A 3CMET 1W1FA 3VKIA 3CPWP 3M54A 3HFOA 3G71T 3VU3C 5GMKi 2DD4A 4IUPA 2VV5A 1N6AA 2JOYA 1UGPB 2KK4A 5J39A 1I07A 2E5QA 2V1QA 2YRDA 4PNOA 2V8KA 1GBQA 1AOJA 2L2PA 4F14A 4MZPA 1QVGS 1UECA 1JB0E 4L5GA 1I81A 1MV3A 1RI0A 1VIEA 3EFOB 3PVQA 2E12A 1U5SA 1U3OA 2FL7A 2K3XA 1OZ2A 2DM1A 1NE8A 2W10A 4RUGA 3VV0A 2WSEE 3GPLA 3JCMf 4V2SA 2FZCB 5FRMA 1PRMC 2EWNA 1TS9A 4JJBA 3CD6Q 4C8QE 5IAYA 1OPLA 5GAOp 2ZPBB 1RAEB 2LX9A 2XIDA 1JRIA 2ED0A 5KYWB 4GY5A 4TVRA 4F7UG 4D8KA 1SSFA 1QMCA 4F7UA 1Q95G 3CC7Q 1WHGA 2DYBA 1KQSP 2QQBA 4GBQA 2CSQA 4C8QF 2MIOA 1TUCA 1YHQQ 2E5KA 3OYFA 2IG0A 2CP5A 1NYFA 1U06A 1S72Q 1RADB 3E2UA 1KSWA 2JW4A 2YXYA 3H9NA 2LQWA 2LNHB 1JU5C 2WACA 3CC7T 4ZNXA 4BB7A 5KH6A 4HVUA 4M78B 3CC4Q 4QQDA 4OMFB 2JTEA 1YHQT 1UB4A 2F2XA 1SPKA 4HCKA 1GL5A 1BYMA 3NFCA 2CDTA 2Y4YA 1VQLT 1MGQA 1Q7YC 2DAQA 2A7YA 4J6XA 2ESWA 2M1HA 5CR2A 3NMZC 1M1KR 2ED1A 1X01A 3R6OA 4IURA 2JN0A 1AT1B 2DF6A 3CC4T 2GFAA 2HL5C 2PU9B 1OX9A 3KFVA 1NLPC 2K5FA 3RKYA 3L2WA 3I35A 4ORZA 1MUZA 1N9RA 2EAYA 3JB9I 3V7RA 2FYKA 3FJ5A 4WF2A 1M2VB 4FW2A 1Q86U 1TSFA 2RQRA 2BE7D 4ZN3A 5KYUB 5LJ5d 2NUPA 3UA6A 1K73U 2EQUA 4LUDA 3C94A 4OMQA 2CH4A 2OTLT 4M78D 3NTIA 3CXCP 2LQ8A 2LJ0A 1RABB 4M77G 1VQOQ 4AG1C 4LD9K 5GMKe 2DL7A 1GCPA 1B3QA 1ABOA 1YJNA 3RKXA 2P4RA 4BE2A 4XQ3A 2L8DA 2E70A 1K9MC 1XOVA 4CC3A 2OAUA 5GAOq 4KUDK 2FZKB 4AT1B 2NUTA 2KYMA 3RIRA 3A8OB 3D7SB 2FPEA 1VQOT 2RI5A 1I5OB 1JO8A 3EGDB 1Q81C 2XU8A 2XI9A 4EMKC 2FO0A 1WNLA 2CUBA 2BZ8A 2A08A 3QJYA 2LJ1A 2A0FB 1FX7A 4EMHA 1M3AA 3JAME 1PD0A 4C92D 1TXQA 2QGFB 3MHXA 5IHKA 1NYGA 2YUNA 5ECAA 3RR6A 2DXTA 4XU0A 4OVAA 3EHRA 3DKMA 3RUXA 2R57A 2K6DA 4PJNA 1VQ5A 4DBQA 4JJDA 4M77C 1OPKA 3IQLA 1HXDA 3I5SA 3X28B 1VQNA 4QVZA 1X75C 3X26B 4XTUA 5FWBA 3PT9A 4PK4A 2I2LA 1FMVA 3FDRA 3OMGA 1M3CA 4ZGEB 3DB3A 4KBMB 2M0YA 4M7AG 5KE3A 2CT4A 1JJ2P 1M8VA 1XTDA 3E9FA 4N4GA 2R5AA 4ELZC 1IB8A 2HKQB 4N0AA 1H3HA 2K3YA 3FLGA 3CC2A 1M1KU 2LVMA 1YCSB 4LDVA 3RMSA 2OI3A 2L89A 1N27A 4M75E 4RTTA 1NPPA 3FEOA 1X69A 2SRCA 4PJOF 5M9OA 3VS1A 3L2VA 1W70A 5HK0A 1PRLC 3REBB 4XTYA 1U1SA 1WGSA 3VS7A 3JB9G 1BCOA 3E1SA 3REAB 3QDRB 4C5EA 1LNXA 4M7DD 4ZTJA 3LWIA 3OYLA 4QKUA 3MEVA 3OSVA 5GJWB 1LJOA 1G83A 2L3SA 4M75F 5GAN5 2BTTA 3CMEA 1YN8A 2NWMA 2KY9A 1NEGA 3EAEA 3VS3A 1NBEB 3G71A 4FIBA 3HKSA 2QGGA 4EMKB 4Z89A 1VQ6Q 2RJDA 2QEXQ 4NS5A 1C6VX 5FW9A 3DLLA 3ZFJA 4D6WA 1J3TA 2QTXA 4ATOA 5FU6C 1TUGB 3T9NA 4LDUA 3BDUA 4A4HA 3A5ZB 3CBMA 4C5GA 3OS0A 5CKDA 1JBMA 1OULA 4M77B 2MCNA 3TSWA 2DNUA 4ESRA 1YFNA 4PLLA 2QEXT 5L23A 2CKKA 3VRZA 3VS5A 3J81E 3A98A 1MMNA 5GAMd 2RNAA 2YUPA 1W2BA 3VRYA 3WVDB 1Q86C 1M90C 2EBPA 2QQSA 4DQ2A 2EGEA 2KQWA 1HSQA 1YJWQ 1K73C 2YLCA 1WLPB 4EDUA 2E64A 5KYXB 3A8GB 5GAN8 2X9HA 2BUDA 5GJVB 4E7IA 2K3BA 1T3SA 1XJWB 2J6OA 4HVWA 4AFQC 2RQWA 3QDFA 2KNBB 4E7HA 5D6WA 2DL4A 5J26A 2PUOB 3EFOA 1UHCA 1MMGA 3CC7A 1YJWT 3MEAA 4K11A 3HPWA 3C0CA 1VQ7Q 2XDDA 1F1BB 3JCMg 3JV3A 1VQ9T 1YHQA 1QVGP 3UWNA 4JUVA 3INZA 3LH5A 3GP8A 4Y91A 4J83A 2JZ2A 5KYWA 3OYDA 3TU4K 2HL3A 4F16A 4QQ6A 1QVPA 4J9GA 4N4IA 3UATA 1PSEA 2I0NA 3A8MB 2HQXA 1E7OA 1WA7A 4C0GA 3VJPA 3PVLA 3CC4A 2KR3A 3CCRQ 4F04B 2QK0A 3L2ZA 3JCMh 4PJJA 1VQ7T 2MWOA 2FB7A 5KYYB 4F7UE 1V29B 3PFSA 1GRIA 5FU6B 2BKDN 2XMFA 5LJ5f 4M78G 1GBRA 1I1JA 1MNDA 4EPCA 1IZ6A 1D09B 4M78A 3L2UA 3CCRT 2RPNA 4DEYA 2FPDA 2OTLA 1T3LA 2HCKA 4F7UF 3M57A 3J80E 2RHXA 1QW1A 2ATCB 4M4ZA 3JCMJ 1KD1R 3PIPA 1ZUUA 1N5ZA 2L3RA 1H92A 1CSKA 2ABLA 2JUFA 3EH1A 1X2QA 2D9TA 2DVJA 1GFDA 3M59A 2E3IA 2AKLA 3JCMP 1KFZA 1RAIB 1Y0MA 3LWHA 1BI2A 1HK9A 1QCNA 3FIFA 5GAOr 2HQEA 2V1RA 4PJOC 3S3MA 3CBOA 3G6ET 1M2VA 4JS5A 1M1KC 1VQOA 5AT1B 3JCMV 5KYUA 4A63B 2V8JA 1CKBA 4A4FA 2H3JA 2EJ9A 2E3HA 4C92G 2XICA 3CCVQ 3HRSA 3L1AA 2YRCA 3GF5A 5CAIA 1VYTA 3CCJQ 2V26A 3PTAA 4OMMA 4BE1A 5CVIA 4HKEA 5GAMh 2F69A 3OS5A 1QCOA 2COWA 2COYA 2J7IA 2O4XB 2DRKA 2V8IA 1BIBA 4J9CA 3CCMQ 3PMIA 3CCVT 3GBQA 3X20B 2LZ6B 2RM4A 3MEUA 4FL6A 5LJ3h 2ENMA 4M77E 4IKFA 2ZCFB 2DVEA 3M9QA 5KCOA 2HNIA 1OEBA 3E9GA 3HP9A 4RG8A 2Z0WA 3G1JA 2BE9B 1E6GA 3G7ZA 2F5TX 4FYXB 2CP6A 5KE2A 4BUGA 2A36A 1Y96B 4C0FA 3A1PA 3RDVA 3ASKA 4BDZA 1IGQA 1HYOA 4FT2A 1D3BB 4C92C 1YITQ 3OYGA 2P4TA 1SSHA 5IN1A 1AZEA 1OU8A 2RQUA 3LLRA 1WYXA 5AYFA 4M7DG 2CP2A 3PMTA 5GAN3 1PG5B 1YP5A 5I2MA 1OI1A 1QVFS 3OSSC 2H3EB 2W0ZA 2DMOA 4QVCA 5A0DA 2VC8A 3VYGA 2DZ9A 1ZBJA 2F5KA 2GTOA 1C1AA 1YITT 3CD6T 4X9CA 4DEXA 4PJOB 1GCQA 1LOJA 2YWWA 4NOYA 2KI7A 1O9SA 2RK1A 5GANh 4KGXB 1NPRA 2AHJB 2M02A 1Q82R 2RHUA 1YJ9Q 4Y92A 2KGTA 2JTFA 2YSQA 1SEMA 2AZSA 3WXMB 1KD1U 1VQPQ 1SRMA 5D6XA 4FCYA 1M27C 3CCUQ 2P0QA 2QDYB 5GANj 3OYNA 5CKEA 5FROA 1OZ3A 4MZTA 2IPOB 4FYYB 4X34A 2FG0A 4PL6A 3SWNA 2J6KA 4R0KA 4A4GA 4E6RA 2EIFA 4E7JA 5FRNA 1UTIA 1S72T 3UPUA 1I0CA 2ECZA 4M7AE 1WXTA 1WHLA 2JMCA 3QYGB 4NL2A 1N8RR 1QKWA 2C0TA 3C12A 4J9HA 1VQ6A 4FYVB 4M7DC 2C0OA 2QEXA 4ZGDB 2VUBA 2J6FA 2NLUA 1Y07A 4KH0B 2RJEA 3KUFA 3UA7A 1MHNA 3OA6A 2E1HA 2ZPGB 4MMLA 3JCMe 1ZA2B 1IRXA 2QI2A 3TREA 2XK0A 3QJ6A 4OMOA 5GAMf 2XDBA 4PJOD 4EMKA 3OYKA 3LGLA 2EQIA 4E7KA 2ZPIB 1IGUA 3H6ZA 4BI4A 1OOTA 5LJ3f 2BZXA 1CKAA 4C92B 2O01E 1B07A 1MMDA 4M75D 4VUBA 1VQ4Q 4BACA 5IH2A 3L2QA 3OS1A 1UG1A 2MOXA 1IREB 2QAZA 5DY9A 2GCXA 3MO8A 1I8FA 1G3SA 4M77A 3CCLQ 1YJWA 3MP8A 2NUZA 1A0NB 4HCZA 1KHIA 3U23A 2YDLA 3LYIA 4PKCC 1VQ9A 1ACMB 1XQHA 4A53A 1BBZA 2OAWA 1VQ4T 3URGA 3E19A 3CPWA 4OGEA 1NZ9A 3V8KA 3RBBB 2QQ9A 2OTJQ 3CCLT 6AT1B 3ER0A 1TH7A 2F1LA 1PKTA 3NPFA 1VQ7A 2KT8A 2D0QB 1D1CA 1YWPA 1M1GA 3H41A 2DBMA 3OW2S 2DBKA 1M3BA 2A28A 3HSBA 1UGQB 5GAN4 2GQIA 3SFMA 1D0ZA 4N4HA 3JSCA 5GANf 2E10A 2A3LA 3CCEQ 2OTJT 2JM8A 2F2WA 4LUEA 2X51A 1AHJB 3CCRA 4M7DB 2DKGA 3LGFA 3FRNA 1RAGB 2X3WD 2CGHA 1Q82U 4JS4A 3N5BB 4XU3A 2JNGA 3GNGA 4OB2B 4KULA 3CPFA 2DL5A 4J9IA 4JRQA 1SHGA 3CCET 3LW5E 2MWPA 1KQSA 2CP3A 5A0LA 1M8MA 2B86A 3DB4A 3CEYA 4Y28E 3MKDA 2JM9A 1N8RU 4M7AA 3G6EA 2DXUA 2JT4A 4J7IA 4J7FA 3UT1A 1H3ZA 3GIBA 1PC0A 3ZBDA 2EQJA 2EJFA 2EVRA 3OBWA 4MMKA 2KROA 4RTXA 3OYJA 3EG9B 1AWXA 1WZOA 1YBYA 2JTMA 3CMAQ 1UGVA 4C8QC 5EG2A 2RK2A 1KC8R 3QIIA 1WJSA 3QSUA 3VS2A 4BE0A 4M78E 1QP2A 2CUDA 3M4YA 1X6GA 3WVEB 2KT1A 1G8XA 2O9VA 2LT4A 2RI3A 1ZSGA 3A8HB 1YIJQ 5LL6S 2VGNA 5LJ5h 1D0YA 1WXUA 2HQHA 1BI3A 5CKFA 3JCMW 3UF4A 3CCVA 4QVDA 4QQGA 3EG2A 2K5LA 1H641 4BI8B 3CMAT 1ZLMA 3VUZA 2ZZDA 1KD1C 3I5RA 2LNVA 2MK5A 4J6WA 5LJ5j 2O31A 4OGCA 1PD1A 2DTOA 5IHNA 1PM3A 1OV3A 3AT1B 4CC4B 2RJCA 5DLOA 3CCQQ 2D6FA 4E7ZA 3MPUB 2ROLA 1BB9A 2VXEA 4C0ZA 3VS0A 5IXBA 3ULRB 1YIJT 3OB9A 1KIKA 2LCLA 5L8RE 4ME7A 2DTHA 3M53A 1ZBXA 1SF9A 3JCMQ 5FU7C 1K1ZA 1AVZC 3VS6A 1K0XA 2WSCE 3PNWC 4BI3A 5GAOn 1VQ6T 1UGRB 2JVVA 2D0NA 1W2BS 1AWJA 3QXEB 1WX6A 3CXCA 2XKOC 2YUOA 1WHHA 4NL3A 4J8OA 3CCQT 2DX1A 2O4XA 2DK3A 2X35A 3OYEA 1VYVA 3HTRA 4C0DC 4HA8A 2HSPA 3FJPA 4RTVA 1H8KA 5GMKl 2RO0A 1ZUYA 5KYNA 1YITA 2EYWA 3CD6A 2K5IA 2BZYA 4DOWA 1NJIR 1M4ZA 2RQVA 3P8DA 3S3NA 4ZTFA 1UHFA 2G3RA 4JJNK 1K8AR 3V7CA 3MP1A 3M0QA 5CCAA 3HHTB 4DOVA 1PNJA 2BIVA 3H0HA 3QO3A 1Y96A 1MNEA 1RAFB 4C8QB 3M5AA 1BKBA 4IUTA 3EG1A 4WCIA 4A54A 2QXFA 1P92A 3FB9A 1TOVA 2DFUA 1S72A 1IHWA 1VYUA 2FRWA 1EIFA 4HXJA 3OYBA 1K4US 4OMLA 4A4KA 2EW3A 4EIKA 4PJOG 4JRIA 3SDZA 2HAXA 3V7SA 1RAAB 3THKA 4JPBW 3OQ5A 4WTOB 4HVVA 3X25B 1QVFP 2HDAA 2M9UA 3PGGA 2CZ7B 2E6NA 2PVOB 1WDXA 1Y71A 1KC8U 2MYSA 2KRMA 8ATCB 2ZPHB 4M75G 1X2KA 2PVDB 1QKXA 2HD0A 3M0UA 4LNPA 2RMOA 1VQMQ 2HZYA 5FU7B 3CCSQ 1JJ2A 3M0RA 2QDLA 1QWEA 2GNCA 1UFFA 1K76A 1RI9A 4OB3B 4C8QD 2RHIA 2CZ1B 3TVTA 1Q82C 2PQWA 1ZA1B 1RAHB 4HCBA 2VGMA 3P8BB 4DBHA 3DLMA 1KK7A 1M30A 2GF7A 3I9QA 2ZAEA 2A37A 4C0DB 1VQMT 1SKUB 1BK2A 2EPDA 1T0HA 3V8JA 3CCST 2VXFA 2JJ9A 3QG1A 4YTLA 1YI2Q 2R5MA 1TG0A 5GMKh 3OYYA 3QWYA 2CZ0B 3P8HA 5A0GA 5EC7A 1N8RC 1OYXA 1VQ4A 3RESA 5GAMg 5D6YA 1M2OA 1UGSB 4D8DA 3CCLA 2WSFE 4JLGA 1KJWA 4RTUA 2M51A 3O8VA 4PFOA 4PJMA 2PTKA 4C92A 1BIAA 5LJ3g 3EGXB 1YI2T 1VOMA 2P0KA 4M75C 1AZGB 4JRPA 4HCCA 2LJ3A 1QP3A 4FSSA 3M0SA 2AK5A 2EQKA 1LVKA 2MAMA 2D1XA 2GQVA 2OTJA 1W6XA 3EFSA 4OB0B 1YCYA 5LJ5e 5GAMj 1NJIU 3ZEHA 3I55Q 1WI7A 2DA9A 1K8AU 4HT8A 2K7AA 2JS0A 3CCJT 2OX7A 1U8RA 1UUEA 1WJRA 2F2VA 3QPHA 1WHKA 2VVKA 4KT0E 2ZPEB 4FU6A 3J7AF 4J6YA 2QQAA 5LJ3j 2PUKB 2RF0A 3EGDA 3I56Q 1MMAA 3CCEA 3OBYA 4J9DA 4RG2A 5DLQE 1WHMA 3OYAA 3CCMT 1IO6A 1TWBA 5IT9E 4II1A 3I55T 2CT3A 4O6JA 4M77F 5GAN2 2E4HA 4LN2A 3JRZA 1VQKQ 1WJQA 1FYNA 4GLMA 2L3PA 1ARKA 2EGAA 3PE0A 2PVGB 2K57A 2DPPB 4RCCA 2KAFA 3OYMA 4B6MA 3MCAB 4KUIA 1ZSZC 3I56T 2ZPFB 1WQWA 1BI0A 5GANg 4OF1A 2LQNA 3TSZA 4M7DA 2DD5A 2JMAA 3GOXA 3OW2P 2R58A 2LX7A 2EYZA 4IUVA 2EYYA 1QVGA 1DJ7B 2YHTA 2KVQG 1TUDA 2O2OA 2Y90A 1VQKT 2M0OA 2CYZB 1IXDA 1PCXA 4BD3A 3SD4A 3SB2A 4A4EA 1EFNA 1VQ8Q 1WXBA 1TTHB 4XU2A 3KBGA 2M16A 4J9BA 4LE9A 3CMAA 1D0XA 4AFSC 2GGRA 3JCMX 3NTKA 3EH2A 4OP0A 1QVFA 3GLXA 4AMCA 3MJXA 4M75B 2RJFA 4ZN1A 3EGUA 1VQLQ 2KRNA 1AD5A 4PLIA 1AWWA 3EFRA 4OMPA 1X27A 4RMOA 2KSSA 1YIJA 2DE0X 3C4SA 4DBFA 3EG9A 4ZGJB 4MDXA 3JB9J 4X1VA 1VQ8T 1RL2A 1D1AA 1LPLA 4XTWA 5CIUA 1YJ9T 2DL3A 1VQPT 5I22A 3OYHA 5HY6A 3CCUT 4UC4A 1N9SA 4BY6C 3CCQA 2XD0A 3JCMb 1ZX6A 1OX8A 3G4SQ 2HKNA 1FMWA 3QWXX 2QYZA 3BY7A 5GMKm 2RA2A 1KC8C 5HCKA 4M7AF 2QQRA 1XNIA 4PFPA 2E41A 4P5NA 2OTLQ 4L59A 5FWCA 1G3WA 4RTZA 1RLQC 2K2MA 4LDYA 5C6SA 4XTXA 1GCQC 2DXCA 2JS2A 3G4ST 3HFNA 1NG2A 4CRIA 1M90U 3M4GA 5J3BA 1QQJA 3JB9F 2DL8A 2VYTA 2LRQA 1ZSZB 1QWFA 1YWOA 2DRMA 3ZL7C 1GFCA 3NHNA 1WPYA 4J5YA 3A8LB 2KYBA 4AFZC 2QTVA 2RD1A 5CKBA 3EHQA 3M56A 2X4JA 3CPWS 2KEAA 3CQTA 2Y4XA 2MPXC 4RTWA 4JDSA 3HL8A 1RLPC 2CZ6B 2DEUA 3HRTA 2KE9A 3SWNC 2LP5A 1B34B 3L42A 1D1BA 4J9FA 4Z88A 4HT9A 1W2BP 1R0CB 4IUUA 2RB6A 3OYIA 5GAOl 1KHCA 2C0IA 2L5QA 2GFUA 5KYXA 1K0SA 2J06A 1ZQ1A 4FYWB 1IHVA 3QYHB 2L0AA 4LDWA 1AEYA 4XTVA 5CKHA 3RMQA 1I4K1 1JXOA 2AIRB 2KBTA 2G6FX 2DTIA 2VB6A 2DILA 1UE9A 4C8QG 2FZGB 2PNIA 2QA4Q 2JXBA 1V1CA 2COZA 3M0PA 5GAMe 4C8QA 3TEEA 4IIMA 1NLOC 2DETA 2VWFA 1NJIC 1E6HA 3AHUA 1U1TA 1K8AC 4IIOA 2DYIA 4BY6B 1TU0B 4ELYC 5LJ3e 1KQSS 4CC2A 2C06A 3M0TA 2HMAA 4JZ3A 2QA4T 4E47A 3JB9H 4LD6A 3OW2A 1VQMA 1R77A 1JQQA 3CCSA 4F7UB 4LDXA 2FRYA 3OY9A 2FPFA 1VIFA 4CI0C 5KYYA 2FVUA 2VASA 1X43A 1HJDA 4B9WA 3H8ZA 1QCFA 2B8AA 2LQKA 2ZGWA 1OU9A 3L2RA 5CQXA 1O75A 4PJOE 2P84A 3S6WA 5LJ5g 1FXXA 1WHJA 1M9SA 2KMTA 4E7LA 1FWZA 4MZMA 2D8HA 2QASA 1Q7YR 1PHTA 1YI2A 3JCMd 4KRTA 5I21A 2CREA 2RH2A 1RACB 3NGPA 3SWNB 3M55A 3V8LA 3OS2A 1BU1A 3TCJA 1ABQA 2KDSA 3RERA 1OQKA 4XU1A 2DEQA 4DBRA 2HBWA 4FM4B 4RTYA 2RI2A 4C5HA 1ZUKA 4Z02A 5GANe 2L3QA 4F17A 1WFWA 3CCJA 5GAN7 1UJ0A 3Q1JA 4M78F 4BDYA 5HKCA 4FW1A 1V76A 1W4SA 1PKSA 4R56A 1PSFA 1Y57A 2YT6A 1EX4A 1FMKA 3CXCS 5C0MA 4AG2C 3H0FA 2KRSA 3CCMA 2NUPB 1JXMA 1LCKA 3QHSA 2CS7A 4O5VA 3I55A 3EGXA 1I5LA 5IHIA 1NM7A 2DJZA 2CH4W 1S1NA 2K2VA 1WQ7A 1R0BG 4QW2A 4N0AC 2MF2A 2CSIA 3R6NA 1K9MR 4M7AC 4MDWA 4C92E 1VA7A 1GXIE 2SEMA 2DO3A 2LT1A 2X3XD 8AT1B 2YUQA 3I56A 2LCSA 4JJCA 2DIQA 1HD3A 1JEGA 3CBPA 4KGZB 2DLPA 1T0JA 4IUQA 3OYCA 1Q81R 2IIMA 2RHZA 1UDLA 1VQKA 1G2BA 2NUTB 4C92F 2YRVA 4FT4A 2O88A 2DJQA 2RN8A 7AT1B 2NYSA 1G5VA 2DZCA 2CP0A 5IXFA 2DIGA 2O9SA 1YJNQ 1X6OA 3FC3A 2E6ZA 5I2SA 1NEBA 2AZVA 2ROTA 2MMPA 4OMNA 4Q5WA 5LJ3d 1VQ9Q 2X4WA 1D3BA 3C95A 5KCHA 1B7TA 2GTJA 2VKNA 3RNJA 1UJYA 1G3YA 2XDPA 2LTOA
chains in the Genus database with same CATH topology
2E1HA 3EFSA 3QKJA 2ZPGB 1YCYA 4MMLA 4KBMB 4OB0B 5CK9A 5LJ5e 3JCMe 2QI2A 3TREA 5GAMf 2XK0A 3QJ6A 3ZEHA 5KE3A 5GAMj 1NJIU 2XDBA 4M7AG 1M8VA 3NTHA 1XTDA 3E9FA 1KQ1A 4N4GA 2R5AA 4ELZC 4PJOD 1K8AU 2EJGA 4HT8A 4N0AA 1VQ8A 4EMKA 3CCJT 1U8RA 3OYKA 1YJNT 5CQYA 3LGLA 3OMCA 1WJRA 2ZPIB 4E7KA 3H6ZA 3QPHA 2K3YA 3FLGA 4BI4A 1M1KU 1YJ9A 4KT0E 2LVMA 3CC2A 2ZPEB 4FU6A 3J7AF 4LDVA 3RMSA 2L89A 5A2QE 4J6YA 1N27A 2P0PA 2QQAA 3F70A 4M75E 5LJ3f 5LJ3j 4M77D 1VQPA 3JCMc 1NPPA 3FEOA 4E7HA 2PUKB 3CCUA 2K4YA 2RHYA 4PJOF 5M9OA 2XHCA 4C92B 3L2VA 4M7DE 5HK0A 3OBYA 3CCEA 4PJOA 2O01E 4RG2A 5DLQE 1VQLA 4M75D 3OYAA 4VUBA 3CCMT 4XTYA 1U1SA 1WGSA 4BACA 5IT9E 4XAXB 3JB9G 3QUIA 5CO7A 3L2QA 1Q7YU 4II1A 3OS1A 3I55T 4O6JA 3E1SA 1IREB 4C5EA 3QDRB 1R8OB 2FHDA 4M77F 5GAN2 1LNXA 4M7DD 5DY9A 2GCXA 2LDMA 1I8FA 3MO8A 3LWIA 4ZTJA 1G3SA 3OYLA 3JRZA 3MEVA 3OSVA 4M77A 1WJQA 4JLIA 4XK8E 1YJWA 3MP8A 3ME9A 4R55A 1LJOA 4JRKA 1KQ2A 4HCZA 4DA4A 4M75F 1KHIA 2PVGB 4X9DA 2K57A 5GAN5 2DPPB 4RCCA 2KAFA 3MP6A 3LYIA 3RKWA 3OYMA 3CMEA 4PKCC 2KY9A 1VQ9A 1ZHIA 4M75A 3EAEA 1XQHA 3MCAB 4KUIA 3BW1A 2X4YA 4EMGA 3I56T 4M7DF 2ZPFB 1WQWA 1BI0A 5GANg 3G71A 4A53A 4FIBA 4OF1A 3HKSA 4EMKB 4M7AB 3G4SA 4M7DA 2DD5A 3GOXA 1VQ4T 2EYQA 2LC4A 2RJDA 2DXBA 2R58A 3URGA 2HBPA 2IVWA 4IUVA 4NS5A 1QVGA 3E19A 3DLLA 1DJ7B 3ZFJA 2EQMA 3LH0A 1NZ9A 2YHTA 4OGEA 2KVQG 3V8KA 4D6WA 5HK3A 5GANd 3PIOA 2QQ9A 2QTXA 3MEWA 4ATOA 1VQ5T 2Y90A 5FU6C 3CCLT 2M0OA 1VQKT 3T9NA 2CYZB 4C5IA 4LDUA 2XG8D 3ER0A 4BD3A 3SD4A 3BDUA 1TH7A 2E65A 3A5ZB 3SB2A 4A4HA 3CBMA 4A4EA 1VQ7A 3VYHB 4C5GA 3OS0A 3QZ9B 1UEBA 2D0QB 4XU2A 1M1GA 3LX7A 3KBGA 5CKDA 2M16A 3OW2S 5FLXE 5GAOm 3CMAA 1JBMA 4GLKA 4M77B 3HSBA 1UGQB 1VUBA 3JCMX 5GAN4 1VQNT 1BI1A 3NTKA 4PLLA 2QEXT 2EFIA 3SFMA 4OB1B 4N4HA 4OP0A 3JSCA 5GANf 3CPWA 5GMKj 1QVFA 3GLXA 2E10A 4M75B 2CKKA 2A3LA 3X24B 2RJFA 4RCBA 3BFMA 4ZN1A 1K9MU 2OTJT 1AHJB 4RKUE 3QBYA 4PLIA 4B9XA 5GAN6 3J81E 3EFRA 3CCRA 4RMOA 4M7DB 2KSSA 1M5Q1 5GAMd 1YIJA 2DKGA 3LGFA 3C4SA 5DM7R 3BDLA 1W2BA 1M1FA 3FRNA 3WVDB 1Q86C 1M90C 4ZGJB 4MDXA 2EKOA 3DB3A 3JB9J 2CGHA 1VQ8T 1RL2A 2QQSA 4DQ2A 2KQWA 1Q82U 4FSXA 3GNFB 1K73C 2YLCA 4XTWA 5CIUA 4JS4A 3OS2A 3CC2T 1YJ9T 3HRUA 3KXTA 4EDUA 2E64A 3N5BB 1KG1A 4XU3A 2JNGA 3GNGA 4OB2B 1VQPT 4M7AD 4KULA 3A8GB 5GAN8 3OYHA 5HY6A 1Q81U 3CPFA 3CCUT 2BUDA 4UC4A 1N9SA 4BY6C 4E7IA 3QZ5B 4JRQA 3CCQA 2XD0A 3JCMb 3CCET 3LW5E 2MI6A 2MWPA 1KQSA 5A0LA 4M78C 2YLBA 3BY7A 3DB4A 2RA2A 1G3TA 3CEYA 4L6V5 2X4XA 4Y28E 5D6WA 2PUOB 5J26A 3M58A 3UDCA 4M7AF 3S3OA 2QQRA 1XNIA 1N8RU 3VUBA 4M7AA 1B34A 3G6EA 3META 2DXUA 3CC7A 1YJWT 3MEAA 4XTZA 2E41A 4J7IA 3HPWA 4J7FA 4P5NA 2LCCA 3UT1A 1H3ZA 3JB9D 1Y7XA 4L59A 3ZBDA 2EQJA 3GIBA 2QA4A 2EJFA 2XDDA 3CMET 1G3WA 3JCMg 1VQ9T 3OBWA 4MMKA 1YHQA 3VKIA 3UWNA 4JUVA 3OYJA 3INZA 3M54A 1YBYA 3HFOA 4Y91A 4J83A 2JTMA 2JZ2A 2DD4A 4IUPA 2VV5A 4LDYA 4XTXA 1N6AA 3VU3C 2DXCA 5C6SA 2JOYA 4C8QC 3OYDA 3G4ST 3HFNA 1UGPB 2KK4A 5EG2A 4CRIA 2RK2A 1M90U 3QIIA 1WJSA 5J39A 2E5QA 3M4GA 5J3BA 3QSUA 4QQ6A 3JB9F 1QVPA 4N4IA 5GMKi 2VYTA 1PSEA 2LRQA 3A8MB 4BE0A 4M78E 2HQXA 1QP2A 4C0GA 3M4YA 4PNOA 3WVEB 2V8KA 3VJPA 1WPYA 4J5YA 3A8LB 2LT4A 3CC4A 2RI3A 3A8HB 4MZPA 3GP8A 2RD1A 5CKBA 5LL6S 1QVGS 2VGNA 3L2ZA 3JCMh 3M56A 2X4JA 1JB0E 5LJ5h 3CPWS 2MWOA 4L5GA 1VQ7T 2FB7A 1I81A 1BI3A 1RI0A 2Y4XA 5CKFA 4F7UE 4JDSA 1VIEA 1V29B 3HL8A 2CZ6B 3CCVA 3PFSA 4E7LA 4QVDA 3JCMW 2E12A 4QQGA 2FL7A 2K3XA 2K5LA 3HRTA 1H641 5FU6B 1OZ2A 3SWNC 4BI8B 3CMAT 1NE8A 1B34B 3L42A 2BKDN 3VUZA 2ZZDA 3VV0A 1KD1C 2WSEE 2LNVA 4J6WA 3GPLA 3JCMf 5LJ5f 5LJ5j 4V2SA 4M78G 5FRMA 4OGCA 2DTOA 2EWNA 4HT9A 4C8QE 4IUUA 2RB6A 5IAYA 4EPCA 1IZ6A 5GAOp 2RJCA 5DLOA 2ZPBB 3OYIA 2D6FA 2LX9A 4M78A 2XIDA 5GAOl 1KHCA 1JRIA 2L5QA 2GFUA 2VXEA 3L2UA 4C0ZA 4GY5A 4TVRA 3CCRT 4F7UG 1ZQ1A 1YIJT 3QYHB 2OTLA 4LDWA 3OB9A 4F7UF 4XTVA 5CKHA 2LCLA 5L8RE 3RMQA 1SSFA 3M57A 4ME7A 1I4K1 2DTHA 2RHXA 3M53A 1ZBXA 3J80E 4F7UA 1QW1A 3JCMQ 5FU7C 3JCMJ 2DTIA 3PIPA 2QQBA 2WSCE 3PNWC 4BI3A 5GAOn 4C8QG 1UGRB 2JVVA 1VQ6T 1W2BS 2L3RA 4C8QF 2JUFA 3QXEB 3CXCA 3OYFA 2XKOC 2D9TA 3M59A 2IG0A 5GAMe 4NL3A 4C8QA 3TEEA 4J8OA 3CCQT 3JCMP 2O4XA 2DK3A 1NJIC 2X35A 3OYEA 3AHUA 3LWHA 1U1TA 1K8AC 1BI2A 1HK9A 3FIFA 4BY6B 5GAOr 2HQEA 4C0DC 4PJOC 3S3MA 4ELYC 3CBOA 5LJ3e 3G6ET 1KQSS 2WACA 4HA8A 4JS5A 3CC7T 1M1KC 1VQOA 3JCMV 4BB7A 5KH6A 4M78B 3FJPA 2C06A 2V8JA 4A4FA 2H3JA 5GMKl 4QQDA 2EJ9A 4OMFB 2QA4T 2RO0A 4E47A 3JB9H 1YITA 4C92G 4LD6A 2XICA 1UB4A 1YHQT 3CD6A 3OW2A 2K5IA 1VQMA 4DOWA 3HRSA 3CCSA 3L1AA 3NFCA 4F7UB 1M4ZA 1BYMA 2Y4YA 1VQLT 4LDXA 3P8DA 1MGQA 3S3NA 3OY9A 3GF5A 4ZTFA 5CAIA 2G3RA 4JJNK 1VIFA 1Q7YC 2DAQA 4CI0C 3V7CA 2A7YA 3MP1A 3PTAA 2FVUA 5CCAA 3HHTB 4J6XA 2M1HA 4DOVA 4BE1A 5CR2A 2BIVA 5CVIA 3QO3A 4HKEA 1Y96A 1X01A 3R6OA 4IURA 4B9WA 2JN0A 5GAMh 2F69A 3H8ZA 2B8AA 2LQKA 2ZGWA 4C8QB 3OS5A 3M5AA 3CC4T 2GFAA 2PU9B 3L2RA 1BKBA 5CQXA 2O4XB 1O75A 4PJOE 4IUTA 3S6WA 2V8IA 2K5FA 3RKYA 1BIBA 3L2WA 5LJ5g 1FXXA 3PMIA 3CCVT 1N9RA 3X20B 4A54A 2KMTA 1M9SA 2EAYA 1P92A 2QXFA 3FB9A 3JB9I 2RM4A 3V7RA 1FWZA 2FYKA 3MEUA 4FL6A 3TU4K 4MZMA 5LJ3h 1S72A 4WF2A 1YI2A 1Q86U 4M77E 3JCMd 4ZN3A 5LJ5d 4IKFA 5I21A 1EIFA 2ZCFB 3OYBA 1K73U 2RH2A 2DVEA 3M9QA 2EQUA 4A4KA 5KCOA 3SWNB 2HNIA 3M55A 4PJOG 3V8LA 3C94A 3E9GA 5GMKm 4JRIA 3SDZA 3HP9A 4RG8A 3TCJA 3V7SA 1KC8C 2HAXA 2KDSA 3G7ZA 2F5TX 3RERA 2OTLT 1JJ2S 4M78D 5KE2A 4XU1A 3OQ5A 2DEQA 3X25B 3NTIA 4FM4B 4BUGA 2RI2A 4C5HA 2LQ8A 4Z02A 2M9UA 1Y96B 4M77G 3PGGA 2CZ7B 4C0FA 5GANe 3G71T 2E6NA 2PVOB 1Y71A 3ASKA 5GMKe 4BDZA 1KC8U 4LD9K 4FT2A 1D3BB 4C92C 5GAN7 3CCJA 1YJNA 3RKXA 3OYGA 3Q1JA 4BE2A 2ZPHB 4M78F 4M75G 5HKCA 2P4TA 4BDYA 1W4SA 2PVDB 2HD0A 4XQ3A 2L8DA 5IN1A 2E70A 4R56A 1K9MC 5FU7B 1JJ2A 1XOVA 1PSFA 3LLRA 2OAUA 5AYFA 4M7DG 5GAOq 4KUDK 3PMTA 4OB3B 4C8QD 5GAN3 2RHIA 5I2MA 5C0MA 1OI1A 3CXCS 2CZ1B 1QVFS 3RIRA 3CCMA 3OSSC 1Q82C 3A8OB 3QHSA 4QVCA 2CS7A 4O5VA 5A0DA 2VC8A 3VYGA 3I55A 1VQOT 2DJZA 2DZ9A 1I5LA 2PQWA 2RI5A 2F5KA 4HCBA 2VGMA 2K2VA 3P8BB 1WQ7A 4QW2A 1Q81C 2XU8A 3DLMA 1YITT 2XI9A 4N0AC 2GF7A 4EMKC 3CD6T 2MF2A 4M7AC 4X9CA 4C0DB 4PJOB 1WNLA 4MDWA 1VQMT 1LOJA 4C92E 4NOYA 3V8JA 3CCST 1GXIE 2VXFA 2DO3A 1O9SA 3QG1A 2LT1A 2RK1A 4YTLA 3QJYA 5GANh 2R5MA 5GMKh 3I56A 1NPRA 3OYYA 2AHJB 1FX7A 4EMHA 2CZ0B 2DIQA 3JAME 3P8HA 5A0GA 2RHUA 4C92D 1N8RC 2JTFA 3MHXA 1OYXA 3CBPA 3WXMB 1VQ4A 3RESA 1KD1U 5D6XA 2DXTA 4XU0A 5GAMg 2P0QA 2QDYB 4IUQA 4OVAA 5D6YA 3OYCA 5GANj 3OYNA 5CKEA 5FROA 2RHZA 3DKMA 3RUXA 1OZ3A 4MZTA 1UGSB 2R57A 4X34A 1VQ5A 1VQKA 3CCLA 4PL6A 2WSFE 4JLGA 4M77C 3SWNA 4C92F 2YRVA 4A4GA 4FT4A 3O8VA 2EIFA 4E7JA 5FRNA 1S72T 1G5VA 4C92A 3UPUA 1BIAA 2DZCA 5LJ3g 4M7AE 1YI2T 3QYGB 4NL2A 2P0KA 2DIGA 4M75C 1HXDA 4JRPA 1X6OA 4HCCA 3C12A 3FC3A 2E6ZA 5I2SA 3X28B 1QP3A 1VQ6A 1VQNA 4Q5WA 2MMPA 4QVZA 4M7DC 1X75C 5LJ3d 2QEXA 3X26B 4XTUA 2X4WA 1D3BA 3C95A 4ZGDB 2VUBA 3PT9A 5KCHA 2EQKA 2I2LA 2NLUA 1Y07A 2MAMA 3FDRA 3OMGA 4ZGEB 1G3YA 2GQVA 2LTOA 2XDPA 2OTJA 2RJEA 3KUFA 3OA6A 1MHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OQ5 A;  3QKJ A;  3OB9 A;  3NTI A;  2RI2 A;  3C4S A;  3LGF A;  1SSF A;  2XK0 A;  3QJ6 A;  3BDL A;  3ZEH A;  4C5H A;  2RHX A;  5KE3 A;  4Z02 A;  3NTH A;  3E9F A;  4N4G A;  2EKO A;  2R5A A;  3DB3 A;  2QQS A;  2E6N A;  3ASK A;  4BDZ A;  3OYK A;  5CIU A;  3LGL A;  3PNW C;  3OMC A;  1WJR A;  4E7K A;  4EDU A;  3H6Z A;  2K3Y A;  3FLG A;  3Q1J A;  3OYG A;  2L3R A;  4BE2 A;  2LVM A;  4BDY A;  4FU6 A;  3OYF A;  2L89 A;  2L8D A;  2D9T A;  5IN1 A;  1N27 A;  3OYH A;  3F70 A;  2IG0 A;  2BUD A;  4UC4 A;  3FEO A;  4E7I A;  3LLR A;  2RHY A;  5M9O A;  2O4X A;  3PMT A;  3L2V A;  2MWP A;  2X35 A;  2RHI A;  5C0M A;  1OI1 A;  3OYE A;  4RG2 A;  3OYA A;  1WGS A;  4BAC A;  3DB4 A;  3CEY A;  4E7H A;  3L2Q A;  2X4X A;  5D6W A;  5J26 A;  4II1 A;  3OS1 A;  2HQE A;  4C5E A;  3S3M A;  3S3O A;  2FHD A;  2QQR A;  1XNI A;  2WAC A;  2PQW A;  4ZTJ A;  2LDM A;  2RI5 A;  3MO8 A;  5KH6 A;  3MET A;  3OYL A;  2F5K A;  3MEV A;  3MEA A;  1WJQ A;  4A4F A;  3MP8 A;  3ME9 A;  4QQD A;  3DLM A;  4QW2 A;  2LCC A;  2RO0 A;  3UT1 A;  1H3Z A;  2GF7 A;  4L59 A;  4HCZ A;  2EQJ A;  4B9X A;  4LD6 A;  3MP6 A;  3LYI A;  3OYM A;  3OYJ A;  3UWN A;  3EAE A;  2X4Y A;  2JZ2 A;  4IUP A;  5C6S A;  2R5M A;  3P8D A;  3OYD A;  3S3N A;  3OY9 A;  4ZTF A;  2G3R A;  2DAQ A;  2DIQ A;  4CRI A;  3MP1 A;  3P8H A;  3QII A;  1WJS A;  5J39 A;  2E5Q A;  2RHU A;  3GOX A;  2JTF A;  2M1H A;  2R58 A;  2RJD A;  1OYX A;  4N4I A;  4QQ6 A;  4BE1 A;  2BIV A;  4IUV A;  4NS5 A;  2VYT A;  2LRQ A;  5D6X A;  4IUR A;  4BE0 A;  2EQM A;  2HQX A;  3LH0 A;  4B9W A;  3H8Z A;  2B8A A;  4OVA A;  4IUQ A;  5D6Y A;  3OYC A;  3MEW A;  3OYN A;  5FRO A;  2RHZ A;  2GFA A;  3L2R A;  1OZ3 A;  2O4X B;  2RI3 A;  2M0O A;  2R57 A;  4C5I A;  4X34 A;  4IUT A;  3S6W A;  4PL6 A;  3L2W A;  4BD3 A;  3SD4 A;  4A4H A;  2MWO A;  3PMI A;  1RI0 A;  2YRV A;  4A4G A;  4A4E A;  4E7L A;  3O8V A;  3PFS A;  4E7J A;  3MEU A;  4FL6 A;  4C5G A;  3OS0 A;  4QQG A;  5FRN A;  2K3X A;  1G5V A;  1OZ2 A;  3LX7 A;  2P0K A;  2DIG A;  2BKD N;  2M16 A;  3L42 A;  4PLI A;  4IKF A;  3FC3 A;  5FRM A;  3OYB A;  3NTK A;  4PLL A;  2EFI A;  3M9Q A;  4Q5W A;  4IUU A;  2EQU A;  4QVZ A;  5IAY A;  5KCO A;  4N4H A;  2RJC A;  2X4W A;  3OYI A;  5KCH A;  3OS2 A;  2EQK A;  3E9G A;  1KHC A;  2NLU A;  2CKK A;  3L2U A;  2GFU A;  2RJF A;  3FDR A;  3OMG A;  4GY5 A;  2XDP A;  2LTO A;  3QBY A;  2RJE A;  5KE2 A;  3KUF A;  3OA6 A;  1MHN A; 
#chains in the Genus database with same CATH topology
 3QKJ A;  2EYX A;  5CK9 A;  2HEQ A;  2K79 A;  3NTH A;  3BE3 A;  1KQ1 A;  2EJG A;  1VQ8 A;  1YJN T;  5CQY A;  3OMC A;  1YJ9 A;  4AFU C;  1SG5 A;  5A2Q E;  2P0P A;  1QLY A;  3F70 A;  1VQP A;  4LXC A;  2OJ2 A;  4M77 D;  2RQT A;  4JZ4 A;  3JCM c;  3TQ7 P;  3CCU A;  2H8H A;  2K4Y A;  2QG9 B;  2RHY A;  2XHC A;  3O5Z A;  4E2F B;  4M7D E;  4PJO A;  1VQL A;  1JJ2 S;  4XAX B;  3QUI A;  5CO7 A;  1Q7Y U;  2DER A;  1R8O B;  2FHD A;  2KXC A;  2LDM A;  4KH1 B;  2LMJ A;  1SRL A;  1VQ5 Q;  4JLI A;  4XK8 E;  2PZ1 A;  4R55 A;  3ME9 A;  4JRK A;  1KQ2 A;  4DA4 A;  4X9D A;  4CC7 A;  3MP6 A;  3RKW A;  2EGC A;  2HSE B;  1ZHI A;  4M75 A;  1MV0 B;  3BW1 A;  2X4Y A;  4EMG A;  4M7D F;  4J9E A;  4M7A B;  3G4S A;  5I11 A;  3EG0 A;  2EYQ A;  2LC4 A;  1VQN Q;  2DXB A;  1EZZ B;  3SHW A;  2HBP A;  2IVW A;  4Z8A A;  2EQM A;  2AKK A;  3LH0 A;  5GAN d;  5HK3 A;  4PFZ A;  3PIO A;  3MEW A;  4QT7 A;  1SHF A;  1VQ5 T;  4C5I A;  2GBQ A;  4PJL A;  2XG8 D;  2E65 A;  1RUW A;  4ANJ A;  3VYH B;  5D7U A;  3QZ9 B;  1UEB A;  3G6E Q;  3LX7 A;  5FLX E;  5GAO m;  3CC2 Q;  4GLK A;  1VUB A;  1VQN T;  1BI1 A;  2EFI A;  1PWT A;  4OB1 B;  4E7S A;  1K9A A;  5GMK j;  9ATC B;  1C0M A;  3X24 B;  1Z9Q A;  4RCB A;  3BFM A;  1K9M U;  4RKU E;  3QBY A;  4B9X A;  5GAN 6;  1M5Q 1;  1WIE A;  2KXD A;  5DM7 R;  3BDL A;  1AWO A;  1M1F A;  2J05 A;  3EG3 A;  2EKO A;  2D8J A;  2K9G A;  2FEI A;  4FSX A;  3GNF B;  2CP7 A;  3CC2 T;  3H0I A;  3HRU A;  3KXT A;  1KG1 A;  4M7A D;  3CME Q;  1ZSZ A;  1Q81 U;  3QZ5 B;  2AT1 B;  3G71 Q;  4KGV B;  2MI6 A;  4M78 C;  1X6B A;  2YLB A;  1BCM A;  3VS4 A;  1Q86 R;  1Z9Z A;  1M90 R;  1G3T A;  4L6V 5;  3UDC A;  2X4X A;  2EKH A;  3M58 A;  3S3O A;  1K73 R;  3VUB A;  1B34 A;  3MET A;  4XTZ A;  2LCC A;  1YNZ A;  3JB9 D;  1Y7X A;  3SEM A;  2QA4 A;  3CME T;  1W1F A;  3VKI A;  3CPW P;  3M54 A;  3HFO A;  3G71 T;  3VU3 C;  5GMK i;  2DD4 A;  4IUP A;  2VV5 A;  1N6A A;  2JOY A;  1UGP B;  2KK4 A;  5J39 A;  1I07 A;  2E5Q A;  2V1Q A;  2YRD A;  4PNO A;  2V8K A;  1GBQ A;  1AOJ A;  2L2P A;  4F14 A;  4MZP A;  1QVG S;  1UEC A;  1JB0 E;  4L5G A;  1I81 A;  1MV3 A;  1RI0 A;  1VIE A;  3EFO B;  3PVQ A;  2E12 A;  1U5S A;  1U3O A;  2FL7 A;  2K3X A;  1OZ2 A;  2DM1 A;  1NE8 A;  2W10 A;  4RUG A;  3VV0 A;  2WSE E;  3GPL A;  3JCM f;  4V2S A;  2FZC B;  5FRM A;  1PRM C;  2EWN A;  1TS9 A;  4JJB A;  3CD6 Q;  4C8Q E;  5IAY A;  1OPL A;  5GAO p;  2ZPB B;  1RAE B;  2LX9 A;  2XID A;  1JRI A;  2ED0 A;  5KYW B;  4GY5 A;  4TVR A;  4F7U G;  4D8K A;  1SSF A;  1QMC A;  4F7U A;  1Q95 G;  3CC7 Q;  1WHG A;  2DYB A;  1KQS P;  2QQB A;  4GBQ A;  2CSQ A;  4C8Q F;  2MIO A;  1TUC A;  1YHQ Q;  2E5K A;  3OYF A;  2IG0 A;  2CP5 A;  1NYF A;  1U06 A;  1S72 Q;  1RAD B;  3E2U A;  1KSW A;  2JW4 A;  2YXY A;  3H9N A;  2LQW A;  2LNH B;  1JU5 C;  2WAC A;  3CC7 T;  4ZNX A;  4BB7 A;  5KH6 A;  4HVU A;  4M78 B;  3CC4 Q;  4QQD A;  4OMF B;  2JTE A;  1YHQ T;  1UB4 A;  2F2X A;  1SPK A;  4HCK A;  1GL5 A;  1BYM A;  3NFC A;  2CDT A;  2Y4Y A;  1VQL T;  1MGQ A;  1Q7Y C;  2DAQ A;  2A7Y A;  4J6X A;  2ESW A;  2M1H A;  5CR2 A;  3NMZ C;  1M1K R;  2ED1 A;  1X01 A;  3R6O A;  4IUR A;  2JN0 A;  1AT1 B;  2DF6 A;  3CC4 T;  2GFA A;  2HL5 C;  2PU9 B;  1OX9 A;  3KFV A;  1NLP C;  2K5F A;  3RKY A;  3L2W A;  3I35 A;  4ORZ A;  1MUZ A;  1N9R A;  2EAY A;  3JB9 I;  3V7R A;  2FYK A;  3FJ5 A;  4WF2 A;  1M2V B;  4FW2 A;  1Q86 U;  1TSF A;  2RQR A;  2BE7 D;  4ZN3 A;  5KYU B;  5LJ5 d;  2NUP A;  3UA6 A;  1K73 U;  2EQU A;  4LUD A;  3C94 A;  4OMQ A;  2CH4 A;  2OTL T;  4M78 D;  3NTI A;  3CXC P;  2LQ8 A;  2LJ0 A;  1RAB B;  4M77 G;  1VQO Q;  4AG1 C;  4LD9 K;  5GMK e;  2DL7 A;  1GCP A;  1B3Q A;  1ABO A;  1YJN A;  3RKX A;  2P4R A;  4BE2 A;  4XQ3 A;  2L8D A;  2E70 A;  1K9M C;  1XOV A;  4CC3 A;  2OAU A;  5GAO q;  4KUD K;  2FZK B;  4AT1 B;  2NUT A;  2KYM A;  3RIR A;  3A8O B;  3D7S B;  2FPE A;  1VQO T;  2RI5 A;  1I5O B;  1JO8 A;  3EGD B;  1Q81 C;  2XU8 A;  2XI9 A;  4EMK C;  2FO0 A;  1WNL A;  2CUB A;  2BZ8 A;  2A08 A;  3QJY A;  2LJ1 A;  2A0F B;  1FX7 A;  4EMH A;  1M3A A;  3JAM E;  1PD0 A;  4C92 D;  1TXQ A;  2QGF B;  3MHX A;  5IHK A;  1NYG A;  2YUN A;  5ECA A;  3RR6 A;  2DXT A;  4XU0 A;  4OVA A;  3EHR A;  3DKM A;  3RUX A;  2R57 A;  2K6D A;  4PJN A;  1VQ5 A;  4DBQ A;  4JJD A;  4M77 C;  1OPK A;  3IQL A;  1HXD A;  3I5S A;  3X28 B;  1VQN A;  4QVZ A;  1X75 C;  3X26 B;  4XTU A;  5FWB A;  3PT9 A;  4PK4 A;  2I2L A;  1FMV A;  3FDR A;  3OMG A;  1M3C A;  4ZGE B;  3DB3 A;  4KBM B;  2M0Y A;  4M7A G;  5KE3 A;  2CT4 A;  1JJ2 P;  1M8V A;  1XTD A;  3E9F A;  4N4G A;  2R5A A;  4ELZ C;  1IB8 A;  2HKQ B;  4N0A A;  1H3H A;  2K3Y A;  3FLG A;  3CC2 A;  1M1K U;  2LVM A;  1YCS B;  4LDV A;  3RMS A;  2OI3 A;  2L89 A;  1N27 A;  4M75 E;  4RTT A;  1NPP A;  3FEO A;  1X69 A;  2SRC A;  4PJO F;  5M9O A;  3VS1 A;  3L2V A;  1W70 A;  5HK0 A;  1PRL C;  3REB B;  4XTY A;  1U1S A;  1WGS A;  3VS7 A;  3JB9 G;  1BCO A;  3E1S A;  3REA B;  3QDR B;  4C5E A;  1LNX A;  4M7D D;  4ZTJ A;  3LWI A;  3OYL A;  4QKU A;  3MEV A;  3OSV A;  5GJW B;  1LJO A;  1G83 A;  2L3S A;  4M75 F;  5GAN 5;  2BTT A;  3CME A;  1YN8 A;  2NWM A;  2KY9 A;  1NEG A;  3EAE A;  3VS3 A;  1NBE B;  3G71 A;  4FIB A;  3HKS A;  2QGG A;  4EMK B;  4Z89 A;  1VQ6 Q;  2RJD A;  2QEX Q;  4NS5 A;  1C6V X;  5FW9 A;  3DLL A;  3ZFJ A;  4D6W A;  1J3T A;  2QTX A;  4ATO A;  5FU6 C;  1TUG B;  3T9N A;  4LDU A;  3BDU A;  4A4H A;  3A5Z B;  3CBM A;  4C5G A;  3OS0 A;  5CKD A;  1JBM A;  1OUL A;  4M77 B;  2MCN A;  3TSW A;  2DNU A;  4ESR A;  1YFN A;  4PLL A;  2QEX T;  5L23 A;  2CKK A;  3VRZ A;  3VS5 A;  3J81 E;  3A98 A;  1MMN A;  5GAM d;  2RNA A;  2YUP A;  1W2B A;  3VRY A;  3WVD B;  1Q86 C;  1M90 C;  2EBP A;  2QQS A;  4DQ2 A;  2EGE A;  2KQW A;  1HSQ A;  1YJW Q;  1K73 C;  2YLC A;  1WLP B;  4EDU A;  2E64 A;  5KYX B;  3A8G B;  5GAN 8;  2X9H A;  2BUD A;  5GJV B;  4E7I A;  2K3B A;  1T3S A;  1XJW B;  2J6O A;  4HVW A;  4AFQ C;  2RQW A;  3QDF A;  2KNB B;  4E7H A;  5D6W A;  2DL4 A;  5J26 A;  2PUO B;  3EFO A;  1UHC A;  1MMG A;  3CC7 A;  1YJW T;  3MEA A;  4K11 A;  3HPW A;  3C0C A;  1VQ7 Q;  2XDD A;  1F1B B;  3JCM g;  3JV3 A;  1VQ9 T;  1YHQ A;  1QVG P;  3UWN A;  4JUV A;  3INZ A;  3LH5 A;  3GP8 A;  4Y91 A;  4J83 A;  2JZ2 A;  5KYW A;  3OYD A;  3TU4 K;  2HL3 A;  4F16 A;  4QQ6 A;  1QVP A;  4J9G A;  4N4I A;  3UAT A;  1PSE A;  2I0N A;  3A8M B;  2HQX A;  1E7O A;  1WA7 A;  4C0G A;  3VJP A;  3PVL A;  3CC4 A;  2KR3 A;  3CCR Q;  4F04 B;  2QK0 A;  3L2Z A;  3JCM h;  4PJJ A;  1VQ7 T;  2MWO A;  2FB7 A;  5KYY B;  4F7U E;  1V29 B;  3PFS A;  1GRI A;  5FU6 B;  2BKD N;  2XMF A;  5LJ5 f;  4M78 G;  1GBR A;  1I1J A;  1MND A;  4EPC A;  1IZ6 A;  1D09 B;  4M78 A;  3L2U A;  3CCR T;  2RPN A;  4DEY A;  2FPD A;  2OTL A;  1T3L A;  2HCK A;  4F7U F;  3M57 A;  3J80 E;  2RHX A;  1QW1 A;  2ATC B;  4M4Z A;  3JCM J;  1KD1 R;  3PIP A;  1ZUU A;  1N5Z A;  2L3R A;  1H92 A;  1CSK A;  2ABL A;  2JUF A;  3EH1 A;  1X2Q A;  2D9T A;  2DVJ A;  1GFD A;  3M59 A;  2E3I A;  2AKL A;  3JCM P;  1KFZ A;  1RAI B;  1Y0M A;  3LWH A;  1BI2 A;  1HK9 A;  1QCN A;  3FIF A;  5GAO r;  2HQE A;  2V1R A;  4PJO C;  3S3M A;  3CBO A;  3G6E T;  1M2V A;  4JS5 A;  1M1K C;  1VQO A;  5AT1 B;  3JCM V;  5KYU A;  4A63 B;  2V8J A;  1CKB A;  4A4F A;  2H3J A;  2EJ9 A;  2E3H A;  4C92 G;  2XIC A;  3CCV Q;  3HRS A;  3L1A A;  2YRC A;  3GF5 A;  5CAI A;  1VYT A;  3CCJ Q;  2V26 A;  3PTA A;  4OMM A;  4BE1 A;  5CVI A;  4HKE A;  5GAM h;  2F69 A;  3OS5 A;  1QCO A;  2COW A;  2COY A;  2J7I A;  2O4X B;  2DRK A;  2V8I A;  1BIB A;  4J9C A;  3CCM Q;  3PMI A;  3CCV T;  3GBQ A;  3X20 B;  2LZ6 B;  2RM4 A;  3MEU A;  4FL6 A;  5LJ3 h;  2ENM A;  4M77 E;  4IKF A;  2ZCF B;  2DVE A;  3M9Q A;  5KCO A;  2HNI A;  1OEB A;  3E9G A;  3HP9 A;  4RG8 A;  2Z0W A;  3G1J A;  2BE9 B;  1E6G A;  3G7Z A;  2F5T X;  4FYX B;  2CP6 A;  5KE2 A;  4BUG A;  2A36 A;  1Y96 B;  4C0F A;  3A1P A;  3RDV A;  3ASK A;  4BDZ A;  1IGQ A;  1HYO A;  4FT2 A;  1D3B B;  4C92 C;  1YIT Q;  3OYG A;  2P4T A;  1SSH A;  5IN1 A;  1AZE A;  1OU8 A;  2RQU A;  3LLR A;  1WYX A;  5AYF A;  4M7D G;  2CP2 A;  3PMT A;  5GAN 3;  1PG5 B;  1YP5 A;  5I2M A;  1OI1 A;  1QVF S;  3OSS C;  2H3E B;  2W0Z A;  2DMO A;  4QVC A;  5A0D A;  2VC8 A;  3VYG A;  2DZ9 A;  1ZBJ A;  2F5K A;  2GTO A;  1C1A A;  1YIT T;  3CD6 T;  4X9C A;  4DEX A;  4PJO B;  1GCQ A;  1LOJ A;  2YWW A;  4NOY A;  2KI7 A;  1O9S A;  2RK1 A;  5GAN h;  4KGX B;  1NPR A;  2AHJ B;  2M02 A;  1Q82 R;  2RHU A;  1YJ9 Q;  4Y92 A;  2KGT A;  2JTF A;  2YSQ A;  1SEM A;  2AZS A;  3WXM B;  1KD1 U;  1VQP Q;  1SRM A;  5D6X A;  4FCY A;  1M27 C;  3CCU Q;  2P0Q A;  2QDY B;  5GAN j;  3OYN A;  5CKE A;  5FRO A;  1OZ3 A;  4MZT A;  2IPO B;  4FYY B;  4X34 A;  2FG0 A;  4PL6 A;  3SWN A;  2J6K A;  4R0K A;  4A4G A;  4E6R A;  2EIF A;  4E7J A;  5FRN A;  1UTI A;  1S72 T;  3UPU A;  1I0C A;  2ECZ A;  4M7A E;  1WXT A;  1WHL A;  2JMC A;  3QYG B;  4NL2 A;  1N8R R;  1QKW A;  2C0T A;  3C12 A;  4J9H A;  1VQ6 A;  4FYV B;  4M7D C;  2C0O A;  2QEX A;  4ZGD B;  2VUB A;  2J6F A;  2NLU A;  1Y07 A;  4KH0 B;  2RJE A;  3KUF A;  3UA7 A;  1MHN A;  3OA6 A;  2E1H A;  2ZPG B;  4MML A;  3JCM e;  1ZA2 B;  1IRX A;  2QI2 A;  3TRE A;  2XK0 A;  3QJ6 A;  4OMO A;  5GAM f;  2XDB A;  4PJO D;  4EMK A;  3OYK A;  3LGL A;  2EQI A;  4E7K A;  2ZPI B;  1IGU A;  3H6Z A;  4BI4 A;  1OOT A;  5LJ3 f;  2BZX A;  1CKA A;  4C92 B;  2O01 E;  1B07 A;  1MMD A;  4M75 D;  4VUB A;  1VQ4 Q;  4BAC A;  5IH2 A;  3L2Q A;  3OS1 A;  1UG1 A;  2MOX A;  1IRE B;  2QAZ A;  5DY9 A;  2GCX A;  3MO8 A;  1I8F A;  1G3S A;  4M77 A;  3CCL Q;  1YJW A;  3MP8 A;  2NUZ A;  1A0N B;  4HCZ A;  1KHI A;  3U23 A;  2YDL A;  3LYI A;  4PKC C;  1VQ9 A;  1ACM B;  1XQH A;  4A53 A;  1BBZ A;  2OAW A;  1VQ4 T;  3URG A;  3E19 A;  3CPW A;  4OGE A;  1NZ9 A;  3V8K A;  3RBB B;  2QQ9 A;  2OTJ Q;  3CCL T;  6AT1 B;  3ER0 A;  1TH7 A;  2F1L A;  1PKT A;  3NPF A;  1VQ7 A;  2KT8 A;  2D0Q B;  1D1C A;  1YWP A;  1M1G A;  3H41 A;  2DBM A;  3OW2 S;  2DBK A;  1M3B A;  2A28 A;  3HSB A;  1UGQ B;  5GAN 4;  2GQI A;  3SFM A;  1D0Z A;  4N4H A;  3JSC A;  5GAN f;  2E10 A;  2A3L A;  3CCE Q;  2OTJ T;  2JM8 A;  2F2W A;  4LUE A;  2X51 A;  1AHJ B;  3CCR A;  4M7D B;  2DKG A;  3LGF A;  3FRN A;  1RAG B;  2X3W D;  2CGH A;  1Q82 U;  4JS4 A;  3N5B B;  4XU3 A;  2JNG A;  3GNG A;  4OB2 B;  4KUL A;  3CPF A;  2DL5 A;  4J9I A;  4JRQ A;  1SHG A;  3CCE T;  3LW5 E;  2MWP A;  1KQS A;  2CP3 A;  5A0L A;  1M8M A;  2B86 A;  3DB4 A;  3CEY A;  4Y28 E;  3MKD A;  2JM9 A;  1N8R U;  4M7A A;  3G6E A;  2DXU A;  2JT4 A;  4J7I A;  4J7F A;  3UT1 A;  1H3Z A;  3GIB A;  1PC0 A;  3ZBD A;  2EQJ A;  2EJF A;  2EVR A;  3OBW A;  4MMK A;  2KRO A;  4RTX A;  3OYJ A;  3EG9 B;  1AWX A;  1WZO A;  1YBY A;  2JTM A;  3CMA Q;  1UGV A;  4C8Q C;  5EG2 A;  2RK2 A;  1KC8 R;  3QII A;  1WJS A;  3QSU A;  3VS2 A;  4BE0 A;  4M78 E;  1QP2 A;  2CUD A;  3M4Y A;  1X6G A;  3WVE B;  2KT1 A;  1G8X A;  2O9V A;  2LT4 A;  2RI3 A;  1ZSG A;  3A8H B;  1YIJ Q;  5LL6 S;  2VGN A;  5LJ5 h;  1D0Y A;  1WXU A;  2HQH A;  1BI3 A;  5CKF A;  3JCM W;  3UF4 A;  3CCV A;  4QVD A;  4QQG A;  3EG2 A;  2K5L A;  1H64 1;  4BI8 B;  3CMA T;  1ZLM A;  3VUZ A;  2ZZD A;  1KD1 C;  3I5R A;  2LNV A;  2MK5 A;  4J6W A;  5LJ5 j;  2O31 A;  4OGC A;  1PD1 A;  2DTO A;  5IHN A;  1PM3 A;  1OV3 A;  3AT1 B;  4CC4 B;  2RJC A;  5DLO A;  3CCQ Q;  2D6F A;  4E7Z A;  3MPU B;  2ROL A;  1BB9 A;  2VXE A;  4C0Z A;  3VS0 A;  5IXB A;  3ULR B;  1YIJ T;  3OB9 A;  1KIK A;  2LCL A;  5L8R E;  4ME7 A;  2DTH A;  3M53 A;  1ZBX A;  1SF9 A;  3JCM Q;  5FU7 C;  1K1Z A;  1AVZ C;  3VS6 A;  1K0X A;  2WSC E;  3PNW C;  4BI3 A;  5GAO n;  1VQ6 T;  1UGR B;  2JVV A;  2D0N A;  1W2B S;  1AWJ A;  3QXE B;  1WX6 A;  3CXC A;  2XKO C;  2YUO A;  1WHH A;  4NL3 A;  4J8O A;  3CCQ T;  2DX1 A;  2O4X A;  2DK3 A;  2X35 A;  3OYE A;  1VYV A;  3HTR A;  4C0D C;  4HA8 A;  2HSP A;  3FJP A;  4RTV A;  1H8K A;  5GMK l;  2RO0 A;  1ZUY A;  5KYN A;  1YIT A;  2EYW A;  3CD6 A;  2K5I A;  2BZY A;  4DOW A;  1NJI R;  1M4Z A;  2RQV A;  3P8D A;  3S3N A;  4ZTF A;  1UHF A;  2G3R A;  4JJN K;  1K8A R;  3V7C A;  3MP1 A;  3M0Q A;  5CCA A;  3HHT B;  4DOV A;  1PNJ A;  2BIV A;  3H0H A;  3QO3 A;  1Y96 A;  1MNE A;  1RAF B;  4C8Q B;  3M5A A;  1BKB A;  4IUT A;  3EG1 A;  4WCI A;  4A54 A;  2QXF A;  1P92 A;  3FB9 A;  1TOV A;  2DFU A;  1S72 A;  1IHW A;  1VYU A;  2FRW A;  1EIF A;  4HXJ A;  3OYB A;  1K4U S;  4OML A;  4A4K A;  2EW3 A;  4EIK A;  4PJO G;  4JRI A;  3SDZ A;  2HAX A;  3V7S A;  1RAA B;  3THK A;  4JPB W;  3OQ5 A;  4WTO B;  4HVV A;  3X25 B;  1QVF P;  2HDA A;  2M9U A;  3PGG A;  2CZ7 B;  2E6N A;  2PVO B;  1WDX A;  1Y71 A;  1KC8 U;  2MYS A;  2KRM A;  8ATC B;  2ZPH B;  4M75 G;  1X2K A;  2PVD B;  1QKX A;  2HD0 A;  3M0U A;  4LNP A;  2RMO A;  1VQM Q;  2HZY A;  5FU7 B;  3CCS Q;  1JJ2 A;  3M0R A;  2QDL A;  1QWE A;  2GNC A;  1UFF A;  1K76 A;  1RI9 A;  4OB3 B;  4C8Q D;  2RHI A;  2CZ1 B;  3TVT A;  1Q82 C;  2PQW A;  1ZA1 B;  1RAH B;  4HCB A;  2VGM A;  3P8B B;  4DBH A;  3DLM A;  1KK7 A;  1M30 A;  2GF7 A;  3I9Q A;  2ZAE A;  2A37 A;  4C0D B;  1VQM T;  1SKU B;  1BK2 A;  2EPD A;  1T0H A;  3V8J A;  3CCS T;  2VXF A;  2JJ9 A;  3QG1 A;  4YTL A;  1YI2 Q;  2R5M A;  1TG0 A;  5GMK h;  3OYY A;  3QWY A;  2CZ0 B;  3P8H A;  5A0G A;  5EC7 A;  1N8R C;  1OYX A;  1VQ4 A;  3RES A;  5GAM g;  5D6Y A;  1M2O A;  1UGS B;  4D8D A;  3CCL A;  2WSF E;  4JLG A;  1KJW A;  4RTU A;  2M51 A;  3O8V A;  4PFO A;  4PJM A;  2PTK A;  4C92 A;  1BIA A;  5LJ3 g;  3EGX B;  1YI2 T;  1VOM A;  2P0K A;  4M75 C;  1AZG B;  4JRP A;  4HCC A;  2LJ3 A;  1QP3 A;  4FSS A;  3M0S A;  2AK5 A;  2EQK A;  1LVK A;  2MAM A;  2D1X A;  2GQV A;  2OTJ A;  1W6X A;  3EFS A;  4OB0 B;  1YCY A;  5LJ5 e;  5GAM j;  1NJI U;  3ZEH A;  3I55 Q;  1WI7 A;  2DA9 A;  1K8A U;  4HT8 A;  2K7A A;  2JS0 A;  3CCJ T;  2OX7 A;  1U8R A;  1UUE A;  1WJR A;  2F2V A;  3QPH A;  1WHK A;  2VVK A;  4KT0 E;  2ZPE B;  4FU6 A;  3J7A F;  4J6Y A;  2QQA A;  5LJ3 j;  2PUK B;  2RF0 A;  3EGD A;  3I56 Q;  1MMA A;  3CCE A;  3OBY A;  4J9D A;  4RG2 A;  5DLQ E;  1WHM A;  3OYA A;  3CCM T;  1IO6 A;  1TWB A;  5IT9 E;  4II1 A;  3I55 T;  2CT3 A;  4O6J A;  4M77 F;  5GAN 2;  2E4H A;  4LN2 A;  3JRZ A;  1VQK Q;  1WJQ A;  1FYN A;  4GLM A;  2L3P A;  1ARK A;  2EGA A;  3PE0 A;  2PVG B;  2K57 A;  2DPP B;  4RCC A;  2KAF A;  3OYM A;  4B6M A;  3MCA B;  4KUI A;  1ZSZ C;  3I56 T;  2ZPF B;  1WQW A;  1BI0 A;  5GAN g;  4OF1 A;  2LQN A;  3TSZ A;  4M7D A;  2DD5 A;  2JMA A;  3GOX A;  3OW2 P;  2R58 A;  2LX7 A;  2EYZ A;  4IUV A;  2EYY A;  1QVG A;  1DJ7 B;  2YHT A;  2KVQ G;  1TUD A;  2O2O A;  2Y90 A;  1VQK T;  2M0O A;  2CYZ B;  1IXD A;  1PCX A;  4BD3 A;  3SD4 A;  3SB2 A;  4A4E A;  1EFN A;  1VQ8 Q;  1WXB A;  1TTH B;  4XU2 A;  3KBG A;  2M16 A;  4J9B A;  4LE9 A;  3CMA A;  1D0X A;  4AFS C;  2GGR A;  3JCM X;  3NTK A;  3EH2 A;  4OP0 A;  1QVF A;  3GLX A;  4AMC A;  3MJX A;  4M75 B;  2RJF A;  4ZN1 A;  3EGU A;  1VQL Q;  2KRN A;  1AD5 A;  4PLI A;  1AWW A;  3EFR A;  4OMP A;  1X27 A;  4RMO A;  2KSS A;  1YIJ A;  2DE0 X;  3C4S A;  4DBF A;  3EG9 A;  4ZGJ B;  4MDX A;  3JB9 J;  4X1V A;  1VQ8 T;  1RL2 A;  1D1A A;  1LPL A;  4XTW A;  5CIU A;  1YJ9 T;  2DL3 A;  1VQP T;  5I22 A;  3OYH A;  5HY6 A;  3CCU T;  4UC4 A;  1N9S A;  4BY6 C;  3CCQ A;  2XD0 A;  3JCM b;  1ZX6 A;  1OX8 A;  3G4S Q;  2HKN A;  1FMW A;  3QWX X;  2QYZ A;  3BY7 A;  5GMK m;  2RA2 A;  1KC8 C;  5HCK A;  4M7A F;  2QQR A;  1XNI A;  4PFP A;  2E41 A;  4P5N A;  2OTL Q;  4L59 A;  5FWC A;  1G3W A;  4RTZ A;  1RLQ C;  2K2M A;  4LDY A;  5C6S A;  4XTX A;  1GCQ C;  2DXC A;  2JS2 A;  3G4S T;  3HFN A;  1NG2 A;  4CRI A;  1M90 U;  3M4G A;  5J3B A;  1QQJ A;  3JB9 F;  2DL8 A;  2VYT A;  2LRQ A;  1ZSZ B;  1QWF A;  1YWO A;  2DRM A;  3ZL7 C;  1GFC A;  3NHN A;  1WPY A;  4J5Y A;  3A8L B;  2KYB A;  4AFZ C;  2QTV A;  2RD1 A;  5CKB A;  3EHQ A;  3M56 A;  2X4J A;  3CPW S;  2KEA A;  3CQT A;  2Y4X A;  2MPX C;  4RTW A;  4JDS A;  3HL8 A;  1RLP C;  2CZ6 B;  2DEU A;  3HRT A;  2KE9 A;  3SWN C;  2LP5 A;  1B34 B;  3L42 A;  1D1B A;  4J9F A;  4Z88 A;  4HT9 A;  1W2B P;  1R0C B;  4IUU A;  2RB6 A;  3OYI A;  5GAO l;  1KHC A;  2C0I A;  2L5Q A;  2GFU A;  5KYX A;  1K0S A;  2J06 A;  1ZQ1 A;  4FYW B;  1IHV A;  3QYH B;  2L0A A;  4LDW A;  1AEY A;  4XTV A;  5CKH A;  3RMQ A;  1I4K 1;  1JXO A;  2AIR B;  2KBT A;  2G6F X;  2DTI A;  2VB6 A;  2DIL A;  1UE9 A;  4C8Q G;  2FZG B;  2PNI A;  2QA4 Q;  2JXB A;  1V1C A;  2COZ A;  3M0P A;  5GAM e;  4C8Q A;  3TEE A;  4IIM A;  1NLO C;  2DET A;  2VWF A;  1NJI C;  1E6H A;  3AHU A;  1U1T A;  1K8A C;  4IIO A;  2DYI A;  4BY6 B;  1TU0 B;  4ELY C;  5LJ3 e;  1KQS S;  4CC2 A;  2C06 A;  3M0T A;  2HMA A;  4JZ3 A;  2QA4 T;  4E47 A;  3JB9 H;  4LD6 A;  3OW2 A;  1VQM A;  1R77 A;  1JQQ A;  3CCS A;  4F7U B;  4LDX A;  2FRY A;  3OY9 A;  2FPF A;  1VIF A;  4CI0 C;  5KYY A;  2FVU A;  2VAS A;  1X43 A;  1HJD A;  4B9W A;  3H8Z A;  1QCF A;  2B8A A;  2LQK A;  2ZGW A;  1OU9 A;  3L2R A;  5CQX A;  1O75 A;  4PJO E;  2P84 A;  3S6W A;  5LJ5 g;  1FXX A;  1WHJ A;  1M9S A;  2KMT A;  4E7L A;  1FWZ A;  4MZM A;  2D8H A;  2QAS A;  1Q7Y R;  1PHT A;  1YI2 A;  3JCM d;  4KRT A;  5I21 A;  2CRE A;  2RH2 A;  1RAC B;  3NGP A;  3SWN B;  3M55 A;  3V8L A;  3OS2 A;  1BU1 A;  3TCJ A;  1ABQ A;  2KDS A;  3RER A;  1OQK A;  4XU1 A;  2DEQ A;  4DBR A;  2HBW A;  4FM4 B;  4RTY A;  2RI2 A;  4C5H A;  1ZUK A;  4Z02 A;  5GAN e;  2L3Q A;  4F17 A;  1WFW A;  3CCJ A;  5GAN 7;  1UJ0 A;  3Q1J A;  4M78 F;  4BDY A;  5HKC A;  4FW1 A;  1V76 A;  1W4S A;  1PKS A;  4R56 A;  1PSF A;  1Y57 A;  2YT6 A;  1EX4 A;  1FMK A;  3CXC S;  5C0M A;  4AG2 C;  3H0F A;  2KRS A;  3CCM A;  2NUP B;  1JXM A;  1LCK A;  3QHS A;  2CS7 A;  4O5V A;  3I55 A;  3EGX A;  1I5L A;  5IHI A;  1NM7 A;  2DJZ A;  2CH4 W;  1S1N A;  2K2V A;  1WQ7 A;  1R0B G;  4QW2 A;  4N0A C;  2MF2 A;  2CSI A;  3R6N A;  1K9M R;  4M7A C;  4MDW A;  4C92 E;  1VA7 A;  1GXI E;  2SEM A;  2DO3 A;  2LT1 A;  2X3X D;  8AT1 B;  2YUQ A;  3I56 A;  2LCS A;  4JJC A;  2DIQ A;  1HD3 A;  1JEG A;  3CBP A;  4KGZ B;  2DLP A;  1T0J A;  4IUQ A;  3OYC A;  1Q81 R;  2IIM A;  2RHZ A;  1UDL A;  1VQK A;  1G2B A;  2NUT B;  4C92 F;  2YRV A;  4FT4 A;  2O88 A;  2DJQ A;  2RN8 A;  7AT1 B;  2NYS A;  1G5V A;  2DZC A;  2CP0 A;  5IXF A;  2DIG A;  2O9S A;  1YJN Q;  1X6O A;  3FC3 A;  2E6Z A;  5I2S A;  1NEB A;  2AZV A;  2ROT A;  2MMP A;  4OMN A;  4Q5W A;  5LJ3 d;  1VQ9 Q;  2X4W A;  1D3B A;  3C95 A;  5KCH A;  1B7T A;  2GTJ A;  2VKN A;  3RNJ A;  1UJY A;  1G3Y A;  2XDP A;  2LTO A; 
#chains in the Genus database with same CATH homology
 2E1H A;  3EFS A;  3QKJ A;  2ZPG B;  1YCY A;  4MML A;  4KBM B;  4OB0 B;  5CK9 A;  5LJ5 e;  3JCM e;  2QI2 A;  3TRE A;  5GAM f;  2XK0 A;  3QJ6 A;  3ZEH A;  5KE3 A;  5GAM j;  1NJI U;  2XDB A;  4M7A G;  1M8V A;  3NTH A;  1XTD A;  3E9F A;  1KQ1 A;  4N4G A;  2R5A A;  4ELZ C;  4PJO D;  1K8A U;  2EJG A;  4HT8 A;  4N0A A;  1VQ8 A;  4EMK A;  3CCJ T;  1U8R A;  3OYK A;  1YJN T;  5CQY A;  3LGL A;  3OMC A;  1WJR A;  2ZPI B;  4E7K A;  3H6Z A;  3QPH A;  2K3Y A;  3FLG A;  4BI4 A;  1M1K U;  1YJ9 A;  4KT0 E;  2LVM A;  3CC2 A;  2ZPE B;  4FU6 A;  3J7A F;  4LDV A;  3RMS A;  2L89 A;  5A2Q E;  4J6Y A;  1N27 A;  2P0P A;  2QQA A;  3F70 A;  4M75 E;  5LJ3 f;  5LJ3 j;  4M77 D;  1VQP A;  3JCM c;  1NPP A;  3FEO A;  4E7H A;  2PUK B;  3CCU A;  2K4Y A;  2RHY A;  4PJO F;  5M9O A;  2XHC A;  4C92 B;  3L2V A;  4M7D E;  5HK0 A;  3OBY A;  3CCE A;  4PJO A;  2O01 E;  4RG2 A;  5DLQ E;  1VQL A;  4M75 D;  3OYA A;  4VUB A;  3CCM T;  4XTY A;  1U1S A;  1WGS A;  4BAC A;  5IT9 E;  4XAX B;  3JB9 G;  3QUI A;  5CO7 A;  3L2Q A;  1Q7Y U;  4II1 A;  3OS1 A;  3I55 T;  4O6J A;  3E1S A;  1IRE B;  4C5E A;  3QDR B;  1R8O B;  2FHD A;  4M77 F;  5GAN 2;  1LNX A;  4M7D D;  5DY9 A;  2GCX A;  2LDM A;  1I8F A;  3MO8 A;  3LWI A;  4ZTJ A;  1G3S A;  3OYL A;  3JRZ A;  3MEV A;  3OSV A;  4M77 A;  1WJQ A;  4JLI A;  4XK8 E;  1YJW A;  3MP8 A;  3ME9 A;  4R55 A;  1LJO A;  4JRK A;  1KQ2 A;  4HCZ A;  4DA4 A;  4M75 F;  1KHI A;  2PVG B;  4X9D A;  2K57 A;  5GAN 5;  2DPP B;  4RCC A;  2KAF A;  3MP6 A;  3LYI A;  3RKW A;  3OYM A;  3CME A;  4PKC C;  2KY9 A;  1VQ9 A;  1ZHI A;  4M75 A;  3EAE A;  1XQH A;  3MCA B;  4KUI A;  3BW1 A;  2X4Y A;  4EMG A;  3I56 T;  4M7D F;  2ZPF B;  1WQW A;  1BI0 A;  5GAN g;  3G71 A;  4A53 A;  4FIB A;  4OF1 A;  3HKS A;  4EMK B;  4M7A B;  3G4S A;  4M7D A;  2DD5 A;  3GOX A;  1VQ4 T;  2EYQ A;  2LC4 A;  2RJD A;  2DXB A;  2R58 A;  3URG A;  2HBP A;  2IVW A;  4IUV A;  4NS5 A;  1QVG A;  3E19 A;  3DLL A;  1DJ7 B;  3ZFJ A;  2EQM A;  3LH0 A;  1NZ9 A;  2YHT A;  4OGE A;  2KVQ G;  3V8K A;  4D6W A;  5HK3 A;  5GAN d;  3PIO A;  2QQ9 A;  2QTX A;  3MEW A;  4ATO A;  1VQ5 T;  2Y90 A;  5FU6 C;  3CCL T;  2M0O A;  1VQK T;  3T9N A;  2CYZ B;  4C5I A;  4LDU A;  2XG8 D;  3ER0 A;  4BD3 A;  3SD4 A;  3BDU A;  1TH7 A;  2E65 A;  3A5Z B;  3SB2 A;  4A4H A;  3CBM A;  4A4E A;  1VQ7 A;  3VYH B;  4C5G A;  3OS0 A;  3QZ9 B;  1UEB A;  2D0Q B;  4XU2 A;  1M1G A;  3LX7 A;  3KBG A;  5CKD A;  2M16 A;  3OW2 S;  5FLX E;  5GAO m;  3CMA A;  1JBM A;  4GLK A;  4M77 B;  3HSB A;  1UGQ B;  1VUB A;  3JCM X;  5GAN 4;  1VQN T;  1BI1 A;  3NTK A;  4PLL A;  2QEX T;  2EFI A;  3SFM A;  4OB1 B;  4N4H A;  4OP0 A;  3JSC A;  5GAN f;  3CPW A;  5GMK j;  1QVF A;  3GLX A;  2E10 A;  4M75 B;  2CKK A;  2A3L A;  3X24 B;  2RJF A;  4RCB A;  3BFM A;  4ZN1 A;  1K9M U;  2OTJ T;  1AHJ B;  4RKU E;  3QBY A;  4PLI A;  4B9X A;  5GAN 6;  3J81 E;  3EFR A;  3CCR A;  4RMO A;  4M7D B;  2KSS A;  1M5Q 1;  5GAM d;  1YIJ A;  2DKG A;  3LGF A;  3C4S A;  5DM7 R;  3BDL A;  1W2B A;  1M1F A;  3FRN A;  3WVD B;  1Q86 C;  1M90 C;  4ZGJ B;  4MDX A;  2EKO A;  3DB3 A;  3JB9 J;  2CGH A;  1VQ8 T;  1RL2 A;  2QQS A;  4DQ2 A;  2KQW A;  1Q82 U;  4FSX A;  3GNF B;  1K73 C;  2YLC A;  4XTW A;  5CIU A;  4JS4 A;  3OS2 A;  3CC2 T;  1YJ9 T;  3HRU A;  3KXT A;  4EDU A;  2E64 A;  3N5B B;  1KG1 A;  4XU3 A;  2JNG A;  3GNG A;  4OB2 B;  1VQP T;  4M7A D;  4KUL A;  3A8G B;  5GAN 8;  3OYH A;  5HY6 A;  1Q81 U;  3CPF A;  3CCU T;  2BUD A;  4UC4 A;  1N9S A;  4BY6 C;  4E7I A;  3QZ5 B;  4JRQ A;  3CCQ A;  2XD0 A;  3JCM b;  3CCE T;  3LW5 E;  2MI6 A;  2MWP A;  1KQS A;  5A0L A;  4M78 C;  2YLB A;  3BY7 A;  3DB4 A;  2RA2 A;  1G3T A;  3CEY A;  4L6V 5;  2X4X A;  4Y28 E;  5D6W A;  2PUO B;  5J26 A;  3M58 A;  3UDC A;  4M7A F;  3S3O A;  2QQR A;  1XNI A;  1N8R U;  3VUB A;  4M7A A;  1B34 A;  3G6E A;  3MET A;  2DXU A;  3CC7 A;  1YJW T;  3MEA A;  4XTZ A;  2E41 A;  4J7I A;  3HPW A;  4J7F A;  4P5N A;  2LCC A;  3UT1 A;  1H3Z A;  3JB9 D;  1Y7X A;  4L59 A;  3ZBD A;  2EQJ A;  3GIB A;  2QA4 A;  2EJF A;  2XDD A;  3CME T;  1G3W A;  3JCM g;  1VQ9 T;  3OBW A;  4MMK A;  1YHQ A;  3VKI A;  3UWN A;  4JUV A;  3OYJ A;  3INZ A;  3M54 A;  1YBY A;  3HFO A;  4Y91 A;  4J83 A;  2JTM A;  2JZ2 A;  2DD4 A;  4IUP A;  2VV5 A;  4LDY A;  4XTX A;  1N6A A;  3VU3 C;  2DXC A;  5C6S A;  2JOY A;  4C8Q C;  3OYD A;  3G4S T;  3HFN A;  1UGP B;  2KK4 A;  5EG2 A;  4CRI A;  2RK2 A;  1M90 U;  3QII A;  1WJS A;  5J39 A;  2E5Q A;  3M4G A;  5J3B A;  3QSU A;  4QQ6 A;  3JB9 F;  1QVP A;  4N4I A;  5GMK i;  2VYT A;  1PSE A;  2LRQ A;  3A8M B;  4BE0 A;  4M78 E;  2HQX A;  1QP2 A;  4C0G A;  3M4Y A;  4PNO A;  3WVE B;  2V8K A;  3VJP A;  1WPY A;  4J5Y A;  3A8L B;  2LT4 A;  3CC4 A;  2RI3 A;  3A8H B;  4MZP A;  3GP8 A;  2RD1 A;  5CKB A;  5LL6 S;  1QVG S;  2VGN A;  3L2Z A;  3JCM h;  3M56 A;  2X4J A;  1JB0 E;  5LJ5 h;  3CPW S;  2MWO A;  4L5G A;  1VQ7 T;  2FB7 A;  1I81 A;  1BI3 A;  1RI0 A;  2Y4X A;  5CKF A;  4F7U E;  4JDS A;  1VIE A;  1V29 B;  3HL8 A;  2CZ6 B;  3CCV A;  3PFS A;  4E7L A;  4QVD A;  3JCM W;  2E12 A;  4QQG A;  2FL7 A;  2K3X A;  2K5L A;  3HRT A;  1H64 1;  5FU6 B;  1OZ2 A;  3SWN C;  4BI8 B;  3CMA T;  1NE8 A;  1B34 B;  3L42 A;  2BKD N;  3VUZ A;  2ZZD A;  3VV0 A;  1KD1 C;  2WSE E;  2LNV A;  4J6W A;  3GPL A;  3JCM f;  5LJ5 f;  5LJ5 j;  4V2S A;  4M78 G;  5FRM A;  4OGC A;  2DTO A;  2EWN A;  4HT9 A;  4C8Q E;  4IUU A;  2RB6 A;  5IAY A;  4EPC A;  1IZ6 A;  5GAO p;  2RJC A;  5DLO A;  2ZPB B;  3OYI A;  2D6F A;  2LX9 A;  4M78 A;  2XID A;  5GAO l;  1KHC A;  1JRI A;  2L5Q A;  2GFU A;  2VXE A;  3L2U A;  4C0Z A;  4GY5 A;  4TVR A;  3CCR T;  4F7U G;  1ZQ1 A;  1YIJ T;  3QYH B;  2OTL A;  4LDW A;  3OB9 A;  4F7U F;  4XTV A;  5CKH A;  2LCL A;  5L8R E;  3RMQ A;  1SSF A;  3M57 A;  4ME7 A;  1I4K 1;  2DTH A;  2RHX A;  3M53 A;  1ZBX A;  3J80 E;  4F7U A;  1QW1 A;  3JCM Q;  5FU7 C;  3JCM J;  2DTI A;  3PIP A;  2QQB A;  2WSC E;  3PNW C;  4BI3 A;  5GAO n;  4C8Q G;  1UGR B;  2JVV A;  1VQ6 T;  1W2B S;  2L3R A;  4C8Q F;  2JUF A;  3QXE B;  3CXC A;  3OYF A;  2XKO C;  2D9T A;  3M59 A;  2IG0 A;  5GAM e;  4NL3 A;  4C8Q A;  3TEE A;  4J8O A;  3CCQ T;  3JCM P;  2O4X A;  2DK3 A;  1NJI C;  2X35 A;  3OYE A;  3AHU A;  3LWH A;  1U1T A;  1K8A C;  1BI2 A;  1HK9 A;  3FIF A;  4BY6 B;  5GAO r;  2HQE A;  4C0D C;  4PJO C;  3S3M A;  4ELY C;  3CBO A;  5LJ3 e;  3G6E T;  1KQS S;  2WAC A;  4HA8 A;  4JS5 A;  3CC7 T;  1M1K C;  1VQO A;  3JCM V;  4BB7 A;  5KH6 A;  4M78 B;  3FJP A;  2C06 A;  2V8J A;  4A4F A;  2H3J A;  5GMK l;  4QQD A;  2EJ9 A;  4OMF B;  2QA4 T;  2RO0 A;  4E47 A;  3JB9 H;  1YIT A;  4C92 G;  4LD6 A;  2XIC A;  1UB4 A;  1YHQ T;  3CD6 A;  3OW2 A;  2K5I A;  1VQM A;  4DOW A;  3HRS A;  3CCS A;  3L1A A;  3NFC A;  4F7U B;  1M4Z A;  1BYM A;  2Y4Y A;  1VQL T;  4LDX A;  3P8D A;  1MGQ A;  3S3N A;  3OY9 A;  3GF5 A;  4ZTF A;  5CAI A;  2G3R A;  4JJN K;  1VIF A;  1Q7Y C;  2DAQ A;  4CI0 C;  3V7C A;  2A7Y A;  3MP1 A;  3PTA A;  2FVU A;  5CCA A;  3HHT B;  4J6X A;  2M1H A;  4DOV A;  4BE1 A;  5CR2 A;  2BIV A;  5CVI A;  3QO3 A;  4HKE A;  1Y96 A;  1X01 A;  3R6O A;  4IUR A;  4B9W A;  2JN0 A;  5GAM h;  2F69 A;  3H8Z A;  2B8A A;  2LQK A;  2ZGW A;  4C8Q B;  3OS5 A;  3M5A A;  3CC4 T;  2GFA A;  2PU9 B;  3L2R A;  1BKB A;  5CQX A;  2O4X B;  1O75 A;  4PJO E;  4IUT A;  3S6W A;  2V8I A;  2K5F A;  3RKY A;  1BIB A;  3L2W A;  5LJ5 g;  1FXX A;  3PMI A;  3CCV T;  1N9R A;  3X20 B;  4A54 A;  2KMT A;  1M9S A;  2EAY A;  1P92 A;  2QXF A;  3FB9 A;  3JB9 I;  2RM4 A;  3V7R A;  1FWZ A;  2FYK A;  3MEU A;  4FL6 A;  3TU4 K;  4MZM A;  5LJ3 h;  1S72 A;  4WF2 A;  1YI2 A;  1Q86 U;  4M77 E;  3JCM d;  4ZN3 A;  5LJ5 d;  4IKF A;  5I21 A;  1EIF A;  2ZCF B;  3OYB A;  1K73 U;  2RH2 A;  2DVE A;  3M9Q A;  2EQU A;  4A4K A;  5KCO A;  3SWN B;  2HNI A;  3M55 A;  4PJO G;  3V8L A;  3C94 A;  3E9G A;  5GMK m;  4JRI A;  3SDZ A;  3HP9 A;  4RG8 A;  3TCJ A;  3V7S A;  1KC8 C;  2HAX A;  2KDS A;  3G7Z A;  2F5T X;  3RER A;  2OTL T;  1JJ2 S;  4M78 D;  5KE2 A;  4XU1 A;  3OQ5 A;  2DEQ A;  3X25 B;  3NTI A;  4FM4 B;  4BUG A;  2RI2 A;  4C5H A;  2LQ8 A;  4Z02 A;  2M9U A;  1Y96 B;  4M77 G;  3PGG A;  2CZ7 B;  4C0F A;  5GAN e;  3G71 T;  2E6N A;  2PVO B;  1Y71 A;  3ASK A;  5GMK e;  4BDZ A;  1KC8 U;  4LD9 K;  4FT2 A;  1D3B B;  4C92 C;  5GAN 7;  3CCJ A;  1YJN A;  3RKX A;  3OYG A;  3Q1J A;  4BE2 A;  2ZPH B;  4M78 F;  4M75 G;  5HKC A;  2P4T A;  4BDY A;  1W4S A;  2PVD B;  2HD0 A;  4XQ3 A;  2L8D A;  5IN1 A;  2E70 A;  4R56 A;  1K9M C;  5FU7 B;  1JJ2 A;  1XOV A;  1PSF A;  3LLR A;  2OAU A;  5AYF A;  4M7D G;  5GAO q;  4KUD K;  3PMT A;  4OB3 B;  4C8Q D;  5GAN 3;  2RHI A;  5I2M A;  5C0M A;  1OI1 A;  3CXC S;  2CZ1 B;  1QVF S;  3RIR A;  3CCM A;  3OSS C;  1Q82 C;  3A8O B;  3QHS A;  4QVC A;  2CS7 A;  4O5V A;  5A0D A;  2VC8 A;  3VYG A;  3I55 A;  1VQO T;  2DJZ A;  2DZ9 A;  1I5L A;  2PQW A;  2RI5 A;  2F5K A;  4HCB A;  2VGM A;  2K2V A;  3P8B B;  1WQ7 A;  4QW2 A;  1Q81 C;  2XU8 A;  3DLM A;  1YIT T;  2XI9 A;  4N0A C;  2GF7 A;  4EMK C;  3CD6 T;  2MF2 A;  4M7A C;  4X9C A;  4C0D B;  4PJO B;  1WNL A;  4MDW A;  1VQM T;  1LOJ A;  4C92 E;  4NOY A;  3V8J A;  3CCS T;  1GXI E;  2VXF A;  2DO3 A;  1O9S A;  3QG1 A;  2LT1 A;  2RK1 A;  4YTL A;  3QJY A;  5GAN h;  2R5M A;  5GMK h;  3I56 A;  1NPR A;  3OYY A;  2AHJ B;  1FX7 A;  4EMH A;  2CZ0 B;  2DIQ A;  3JAM E;  3P8H A;  5A0G A;  2RHU A;  4C92 D;  1N8R C;  2JTF A;  3MHX A;  1OYX A;  3CBP A;  3WXM B;  1VQ4 A;  3RES A;  1KD1 U;  5D6X A;  2DXT A;  4XU0 A;  5GAM g;  2P0Q A;  2QDY B;  4IUQ A;  4OVA A;  5D6Y A;  3OYC A;  5GAN j;  3OYN A;  5CKE A;  5FRO A;  2RHZ A;  3DKM A;  3RUX A;  1OZ3 A;  4MZT A;  1UGS B;  2R57 A;  4X34 A;  1VQ5 A;  1VQK A;  3CCL A;  4PL6 A;  2WSF E;  4JLG A;  4M77 C;  3SWN A;  4C92 F;  2YRV A;  4A4G A;  4FT4 A;  3O8V A;  2EIF A;  4E7J A;  5FRN A;  1S72 T;  1G5V A;  4C92 A;  3UPU A;  1BIA A;  2DZC A;  5LJ3 g;  4M7A E;  1YI2 T;  3QYG B;  4NL2 A;  2P0K A;  2DIG A;  4M75 C;  1HXD A;  4JRP A;  1X6O A;  4HCC A;  3C12 A;  3FC3 A;  2E6Z A;  5I2S A;  3X28 B;  1QP3 A;  1VQ6 A;  1VQN A;  4Q5W A;  2MMP A;  4QVZ A;  4M7D C;  1X75 C;  5LJ3 d;  2QEX A;  3X26 B;  4XTU A;  2X4W A;  1D3B A;  3C95 A;  4ZGD B;  2VUB A;  3PT9 A;  5KCH A;  2EQK A;  2I2L A;  2NLU A;  1Y07 A;  2MAM A;  3FDR A;  3OMG A;  4ZGE B;  1G3Y A;  2GQV A;  2LTO A;  2XDP A;  2OTJ A;  2RJE A;  3KUF A;  3OA6 A;  1MHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...