2RJZA

Crystal structure of the type 4 fimbrial biogenesis protein pilo from pseudomonas aeruginosa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
b'SLKQQFSTKAFQAANLEAYKAQMKEMEESFGALLRQLPSDTEVPGLLEDITRTGLGSGLEFEEIKLLPEVAQQFYIELPIQISVVGGYHDLATFVSGVSSLPRIVTLHDFEIKPVAPGSTSKLRMSILAKTYRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PilO protein
publication title Periplasmic domains of Pseudomonas aeruginosa PilN and PilO form a stable heterodimeric complex.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 40
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2rjzA01
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rjzA02
3ZZPA 3VQVA 4DR4F 2VQEF 2VQFF 2BVZA 4B3SF 1N33F 2B7CB 4JI1F 2YIBA 1XNQF 2KJWA 3VQYA 1IBMF 3ZEDA 2QJ1A 4CH4A 4KHPF 5AJ3F 1IJFB 1G7CB 1LOUA 4CH5A 4DV5F 1IBLF 1FJGF 2HHHF 4X66F 4OX9F 4JYAF 2RQ6A 4BW9A 3T1HF 4CH6A 4K0KF 4Q6GA 4YY3F 2UU9F 4B3TF 4LFAF 4DR6F 1G1XA 4GKJF 4JI8F 4LF6F 2ZNIA 2ZM6F 1CQNA 4DV1F 1N34F 4LFBF 2ZIMA 4CH3A 4JI3F 5K1PA 4LF9F 5LMNF 1CQMA 1I94F 4X64F 4GKKF 4DUYF 2YI9A 2PGGA 4DR1F 1HR0F 2F4VF 4JI4F 3VQXA 4CS3A 3VQWA 1IBKF 1VMBA 2ZIOA 4JI6F 2UUCF 2E5LF 4NXMF 4TQFA 3QTCA 4ZIBA 2ZINA 1O9HA 2YI8A 4AQYF 1XNRF 1B64A 3T1YF 2E3CA 1HNXF 4DUZF 4DR5F 4LFCF 2UXCF 4JI7F 2ZNJA 1F60B 4LF8F 1HNWF 4DV7F 1XMQF 2R72A 2UUAF 2RJZA 4CS2A 4DV6F 2Q7HA 1QJHA 2YY3A 5LMUF 2UXDF 2UXBF 1O9GA 4CS4A 4B3MF 4TQDA 4B3RF 4YHHF 2YIBD 4DV0F 4BWAA 2HEPA 1HNZF 3BHPA 4X65F 4LF7F 2Q7GA 2PUSA 2B7BB 2KJVA 3R3TA 4LF5F 2JVDA 4JI0F 5BR8F 4DR7F 4JI2F 4NXNF 5IWAF 4DR2F 1FKAF 2BXJA 4DV3F 1IJEB 2Q7EA 2J5AA 1XMOF 2R70A 3DSQA 1N32F 1G6UA 1J5EF 3OTOF 4JI5F 4DV2F 5K1XA 4DR3F 4JV5F 4LF4F 1N36F 1RISA 2YIAA 2UUBF 2ZCEA 4DV4F 1GH8A 4X62F
chains in the Genus database with same CATH superfamily
2H1YA 4ZPWR 6FD1A 4XDDA 1SPBP 1JFFA 4YR0A 3GZ7A 5FLXY 3H2UB 2NYIA 3HSJA 4USUA 5B1NA 2OPSA 4RW8A 3U10A 2LDIA 2FQQB 4ER8A 4DV0O 2VWKA 3L75H 2FL4A 2BOCC 4HYKA 5HLFA 4BW9A 1OV9A 1JNRB 3ENVA 2X7RB 3HDSA 3FBFA 1TKTA 4DV3J 3W7BA 2HS3A 2R7OA 5IM0B 2MKJA 3T3FA 2X51A 2BE2A 2OCHA 2W7AA 3DHWC 3ZO7A 1M1GA 3HHKA 4BHQA 4DV2O 1W26A 3EGNA 1FRMA 4GCZA 3SCJE 2AMCB 2R7UA 4J9RA 4ED2A 1VF6C 3MDFA 3DMJA 4FVCA 4DUTA 2P9GA 3AAWB 4JI1O 3UCZP 1D8ZA 3E8OA 3JARA 4AUKA 3GIKA 2Z2YB 1XWLA 1U6FA 5KFKA 3GILA 3JD4A 3WBZA 2UU9J 1IKYB 2LU1A 3QZ7A 4UOFA 2YWKA 3L70H 5C5JA 5HBMB 2VKZG 2R3VA 4PA6A 5K8NA 2L9NA 2VFVA 2YKNB 2ZJPQ 1R3LC 3LP2A 5LOQA 2BE3A 3M9MB 1X4TA 2KFYA 2Z2LA 2CPIA 2Y0IA 1DLOB 2KM8C 2IM2A 3D3QA 3A1YG 3VQVA 3N6NA 2YX1A 2A3QA 1PJ5A 3F5WC 3PEHA 1KFDA 2WAMA 2BRKA 2QA2A 3TWZA 3K57A 1UWBA 2EG2A 2LFRA 2DYAA 3CCWA 2GDSA 1E1RG 4IYHA 3HKWA 5A0YB 4CH0S 1K33A 4C98A 4ZPCA 1NVPB 4OYWA 2H5JB 1S9FA 2YKOA 2IW5A 1RT3A 5CMUA 3CJKA 2JL9A 3ZHVA 3QT5A 2DYRC 3QO9B 2ZIOA 1F5CA 2KT2A 5LHHA 2QKSA 4C7UA 5KG3A 2A3JA 2G2ZA 3N27A 2FVQA 3UD4P 3L9DA 3HD1A 2DT9A 3KFWX 1SCJB 4JV2A 1F4NA 2A9HA 3FEXB 5KFIA 2ERRA 2DCUB 3D2WA 2RKIA 3SIPB 1U02A 2VICA 1JJOA 3AG1B 5KX5B 5HROB 4NCBA 1F2GA 4PEOA 5AE1A 2MLZA 2YS8A 1JPXA 4P30A 4EYIB 4F4AA 3DLHA 1YJ7A 5LJ5Y 5LOVB 2Y1LB 3K5PA 3E89A 4QWBA 5DDRC 2XQCA 4DV4F 2F93B 1HBOB 4A8QA 1DHMA 1YQHA 2FLLA 2DY9A 2P6JA 1Q7YT 4J91A 2CQ0A 3WX4A 4D3GA 3RVYA 2IJKA 4GKJB 1W0KG 3MMBB 1AFJA 1NTMH 2LMIA 1FXKB 4UQTA 1QNMA 2I6WA 4CC6A 1IVSA 3JASA 1B99A 1I3OB 1KQKA 1AP5A 1RBOB 1N8RW 1NNDA 2C2OB 4CM2A 3VCDA 3MEEB 1CJVA 2UXCB 2W2QP 2PGGA 2X7IA 2LXUA 4L73A 1UEKA 4OXSA 4NXMF 3U0ZA 3OR7C 2HZAA 4YIOA 1MMNA 2VQFJ 2JC0A 1ROPA 3GQCA 5D3GB 1H72C 3RB0A 5LMUF 3I9V9 4WFYA 2CQDA 4J9YB 4OX9J 4BIOA 2J0QD 4JI5B 1QE1A 4DRXB 4DK0A 4YN3B 4LF4B 5BR8F 4O4HA 1IR2A 3KK3B 1VQSA 3DRXA 1FNXH 2CJ9A 5G0RB 3DGVA 3ETMA 2DIVA 3TW0A 2F9DA 1VQMS 1URNA 3NNCA 4V19J 5CYMB 3BEGB 4IR9A 5E7OB 1SC3B 1MMLA 2CG4A 1R3KC 4RW9B 2GS8A 1FRJA 4EK2A 2W0FC 2UUCO 4F02A 4O4RA 4MT8A 3DLGA 8ATCB 3CS5A 4ED4A 3ZS8C 3KG2A 5E3QA 2PDAA 2CYYA 4I5SA 3IFEA 5D15A 2K1RB 3DLKA 2AGAA 2J6SA 1OZ0A 1HKAA 4JTDB 4DSLA 3I0SB 3J80U 1NJYA 2I5JA 2VS0A 1HYSA 1TVKB 3DLBA 4X65O 2DH9A 1LW2B 3CTRA 3S01A 4C8YA 2W25A 1MNEA 2V4JA 5LA6B 4IFVA 4KP4A 3TUPA 3EGVA 4ZI7A 3E51A 3MMCB 4LFCB 4NZ0A 2YDEA 3QYYA 4JI7B 2EPIA 2ILYA 4NZ7A 4BLGA 3RAXA 4DV6B 1A7GE 5I3UB 1FS0G 1B0PA 4B3MB 3H4BA 1N56A 3W63A 4F2RA 4B3OB 2OIHA 2C3YA 1G8MA 5L8RC 5IWAB 4MTXA 1KD1W 1O9GA 2QL7B 5HN0A 2DWDC 2M70A 4F6EA 2L41A 2HEPA 2HWTA 2Q6CA 1Q86T 1T9YA 3KLFA 5FL7G 4ANCA 3CCTA 1U2RA 1WF2A 1TZ0A 5LMNO 4ED3A 1BQZA 1KU9A 2HIQA 2E74B 4USTA 2ZQMA 2XSFA 1R8BA 2QE5A 2Y1JA 4JI6J 3SPIA 2EG1A 2FJDB 3MHYA 5HAOA 2N04A 1A6LA 2QMWA 1H7WA 3NBPA 5KHGA 1GH6A 2YWFA 3EVOA 2WHOA 1ZOTA 3AB2B 4JI8B 1IBMF 3K3WA 2RDIA 3E01B 3FD9A 4MYUA 3CGIA 5IOLA 4A8XA 4GX0A 1M4UA 2ZJRQ 1OCCB 2CQGA 4X66F 3CCSS 4TUYB 4PZVA 4J9MA 3W5YA 2GHWA 2CJYB 3CMES 2M52A 4U67Q 4K8ZA 1QUPA 2QSAA 2ZM6F 2FJAB 2CJQA 3D9BA 3ZMTA 4DUYF 4BWMA 3N79A 1NH2D 1HWKA 1RT2B 4R7CA 2QTOA 2AJ0A 3M2RA 3GIJA 1JJCB 1XJWB 3HJVA 1HMVA 4KAIA 2F65A 4O0IA 1B64A 5LXYA 2CTPA 2QLJB 2YWEA 3KLIB 2A7WA 1FXRA 3D0GE 4R0EA 2RN9A 4PI0A 4PG5A 3DHXA 1I0HA 1YJNS 2DHAA 3VBBA 2HRYA 4FF4A 5IV4A 1SRYA 3ABMB 4ZVTB 4MKAA 4UVCA 1JWWA 1RAEB 2ZNYA 4Y28C 3T1HJ 3H42A 3H1LH 4IG0A 1T0TV 2HHWA 4M5GA 2OMOA 3KXDA 2I9SA 4NOHA 3J7AU 2CQ1A 1WUUA 2JEJA 4HDGA 4EBCA 2M3DA 5J2PA 5B0GA 1QUVA 2F8HA 2MDAA 3NL0A 4FLTA 1GMUA 1JIHA 3NAIA 4F25A 2D74B 4FBUA 2HLDG 1WHYA 2UXBO 2V8DA 1EKRA 1FFGB 3CIZA 3UN2A 5A8WA 3A8IA 2Q73A 2B51A 3MR5A 3MHHC 3C8YA 4NLYA 4JI2O 3LAKA 2V2VA 3D3CJ 3FSYA 2VODA 2HHUA 3C6UA 2F43G 1I6JA 5HATA 4AQYB 3IC9A 1B70B 3DOLA 3TZZA 3CRMA 3S1TA 1NJIT 4DFJA 3GWOA 3DI6A 2XNRA 4DR3O 4KXRA 3MPVA 1QDUB 4MIWA 3ABLC 1X7VA 4DV4B 4IHJB 1RT7A 4DX6A 4LR3A 1YHQS 5BXZA 2FPHX 4DL2A 1HNVB 4QOTA 1LUVA 4K35A 3MI7X 3LW5C 4B3RF 2R8JA 5LYJA 3HPOA 2V9KA 3WB1A 3AG2C 2IMWP 3MUMP 2AHOB 1NZ8A 1FHTA 4ETZA 1JXEA 2Q7EA 4GVLA 2R70A 1FRIA 2QWRB 2B3TB 5C25B 1NPRA 1ZZFA 3KK1A 1S1WA 2BV3A 1R8CA 1CS4B 4PD4F 1SQGA 3IR7B 2DHHA 3FK4A 2OPRA 3OMIB 5DLGA 4KY3A 2WBMA 4LT6A 4LSNA 1FEHA 4NXMB 1K97A 2IBOA 4NL5A 1I1GA 2N05A 2V4RA 5CH7B 4FK5C 1K1QA 2HNYA 2RSQA 2Z0GA 1NR1A 2OMLA 1QLNA 4DV5F 4LF9B 3IS9B 4ECUA 3LP0B 5KMGB 1FI4A 2QV6A 2VG6A 4AHCA 5DG7A 2IYGA 3HO1A 1CQMA 3OXFA 4J90A 4MSWC 1AUSL 2UUBO 3IM8A 2X3GA 2YI8A 4YUDA 5ETPA 4LF7B 1WEYA 2EZOA 4E2LA 4OYIA 2VG7A 1D9FA 2GUZB 4CTAA 2N82B 3GFXA 1Y4ZB 2V50A 4UVBA 2YKQA 2ZBIA 4RX6A 4BC7A 4L3KA 3KMSA 2JS5A 3ZMZA 3QFWA 2W1BA 4NLWA 3VAIA 4FF3A 5ETKA 4F6RB 4QE7A 3FSIA 3LGNA 3QRPA 2F40A 1WHVA 1PIEA 1HPZB 2GA7A 2QLWA 2VPXB 1S72S 5A8RA 1K7DA 3OUSA 2HGLA 3OD4A 5K1XA 1UCNA 4DO2A 1PL4A 3AXKA 4AE5A 4TQSA 4PG7A 2GIRA 2YKMB 3PO4A 5IT0A 2MQPA 3PRDA 3CJRA 1H6KX 1D0EA 3LDDA 2IAJB 4CCHA 4N77A 2DE0X 3M99B 3FGVA 2QE7G 1WHWA 4U7UK 2LDYA 4IG3A 4X4NA 5H9EJ 2EBGA 1PNMA 3RWRD 5LL6Y 2BTOA 3U1MA 5FDLB 2M0GB 5CZXA 3AXMA 1ZYQA 4DEZA 1DZ5A 5BJRA 4X4UA 2MSSA 2FVPA 2HFSA 4K7QA 2RE1A 1C1BA 4ED5A 2HMIA 1KBHA 3GPAA 2KM8B 3MM9A 1PILA 3JQJA 5L1JA 1R8HA 5LP6A 1Q6UA 1UA1A 1M5HA 4LF5B 4NXNB 1S1XA 4F67A 3EE3A 4RBTA 2IVFB 2EC0A 5HVFA 3GLJA 3U27A 3PJXA 3LTOA 4NA3A 2IDEA 2DRBA 4DR6J 5KT6A 1K73T 4CI0B 1N6QB 1NDLA 4I56A 1C1CA 4EWTA 4XBFA 4M5DB 2UUTA 4FMTA 3HKEA 2KRBA 1WORA 1BE4A 3FMBA 1HR0O 2BKNA 2CPYA 2DYRB 3ISNC 5DZ7A 4KV8A 1U0SA 4FIPC 3UW1A 1N36F 5DQIA 1L5UA 1GH8A 2FHKA 4FLZA 1J95A 1R0BG 4DUZO 1QQCA 3UNYA 2XI2A 3K08A 1PC4A 5KFJA 2CK3G 1DK1A 5E0OA 2W9CB 2PYJA 1VQNV 5KG1A 3N5BA 1TKXA 5F9LA 3IGVA 3GP9A 3TETA 2RQ6A 4YFUA 1YRTA 2DWEC 2EFPA 4IYQA 2ZD1B 1S1VA 1S99A 4H54A 4DV1F 3T5LA 1IKVA 4IDKA 2CRLA 1X4BA 1I94F 4DF4A 3CIMA 4ZP9A 1QTMA 2ZZTA 2XZDB 1Y76B 3ZZTA 4YXWG 1K0VA 1ZL8B 5F8GA 2BA9A 4OIXA 3Q8PB 4FJCC 3VHQA 1US6A 1NMEB 2P22C 4EKWA 3CD6V 1YSCA 1U26A 1UEVA 5DETA 4DR4O 2ZOFA 2CQHA 3KJVA 3SCIE 2HFOA 4AFFA 3CCUS 3AK2A 1HLWA 1BCCH 1Y5IB 2A18A 2CA9A 1LR1A 4BAYA 1KUQA 4KE5A 1V55C 4GYCB 4C11B 3GWCA 4LSLA 4N8NA 4P2ZA 3PYDA 1EETB 2DRDA 1IURA 3H8YA 2GJFA 2MJNA 2YVSA 2AYMA 3CC7S 3SR2C 3BH7B 3OMAB 1Y74B 2HFVA 5IYZB 1S59A 3RR7A 5KG7A 5L3BA 3CPWU 2DPIA 4QIWD 2FTKA 4O4GA 5LXTA 3ASNC 4BDPA 4MTGA 5B09A 4LFBO 3EFFK 2VFSA 2F4FA 2UXDJ 2FHJA 3RBXA 1UJ5A 3H5XA 3GG1A 3R2DJ 2DHGA 1Y3KA 1KQSU 3DGPB 1Q1KA 3PG9A 4NI2B 3CX5F 3L72H 3LOUA 1FJEB 2YSUB 3PO5A 4FM1A 1CPYA 4DZ6A 5A8KB 5LT5A 1ELOA 2GVDA 4MK8A 2R42A 3PHEA 2LEAA 3DXSX 1MU2B 5IT4A 2KSDA 1U7LA 3DLEB 2YC0A 2LQ8A 2DW4A 2XWXA 2KDOA 2YWHA 2VZ9A 1PKUA 4X62J 3NXSA 3PJSK 3GR0A 2KHDA 2W9AA 3QNWB 5D0RA 1Y5NB 3M2UA 1XUQA 1XNQJ 1APSA 3TCUA 1IKYA 4H33A 3QATA 2VFUA 4TLQA 4LBPA 3RTVA 1OPZA 2BJ8A 4ZP6A 1X4GA 4YHHF 5HBMA 4M5JA 1HDJA 3OXLA 2WLLA 3DOKB 4B3TJ 3ZHTA 2MW2B 1Q8LA 5D77A 4UB6Z 1SC6A 1MSDA 1H73A 3EUNA 2HNZB 4X64J 1OS5A 1FDDA 1J5EF 4MKYA 1NBEB 1JCHA 2H48B 1RWNB 2DGVA 4MTFA 1UVMA 3OTFA 1VCTA 5KFZA 4YJ3A 2VC0A 2W9BB 1XNRO 4CLFA 1KVJA 1CJTB 3G82A 2LQJA 4ID8A 1WACA 3OW2U 2P9CA 2OEMA 5A0YA 2NXEA 1NM2A 4ZOLA 2G9OA 1LEOA 2Q9LA 4GUNA 2KH9A 3QWUA 5CABA 1TK8A 4CP5A 4JYYA 4ECSA 3DYAB 5I3PA 5F8MA 4ZKAA 2ASDA 2FLNA 2HQDA 1Q81W 3BSAA 3TI0A 1YZ6A 5JH7A 4LFBF 4LNUA 1WPXA 1NKBA 1N32O 1R6TA 2WA3A 3G67A 3OTOO 3GONA 2CTWA 3MPUB 4LF2A 5ETLA 2NXCA 4LIWA 4FM0A 4MH8A 1JVMA 1IX9A 4RBVA 2JJ4D 3VR1A 3U11A 4G1QB 1Y6XA 4CLTA 4Q8FA 1YBAA 2CIMA 4DSJA 1SJFA 3SSSA 4W90B 4DR7B 2CJXB 1ZM9A 1JLBB 3CB2A 3H1IH 1XDCA 1YG0A 2PA3A 2CJAA 1KQFB 3W60A 3W9JA 1S76D 5LOVA 3CUNA 4L72B 4NCGB 3RYLA 2WSSG 4I7ZB 1OYDA 3CCRV 1HBOA 4QPTA 4OHXA 1DQAA 3ZZ0A 5HP1A 2Y4TA 2MQMA 2VQEB 2LECA 3CPWR 1CVJA 1AP6A 4JOUA 5L1IA 3GYXB 5J2UB 4D7SA 4QWDA 4ZJLA 3OGIB 3D0HE 1VBYA 1FXKA 1PBUA 3MM8B 1KQSR 1Q8KA 3DGEA 3TQ1A 2KZMA 1U1KA 3ZMUA 2JEGA 3B6BA 2IJIA 3GJSB 2Y69C 2ZE6A 3CC2S 4GKKB 1RUSA 2YEVA 4QR0A 2G0JA 4I67A 2W4CA 4DFKA 4F7VA 4PXBA 4GZRB 4DV3O 2LP4A 3HSZA 2V2KA 3IC7A 4HI2A 1UZDA 1YX2A 3JQKA 2ZH7A 4GX5A 2LW1A 1Z4UA 4K8RA 1T8EA 5D3GA 5KFAA 1S0MA 1X4FA 3CWBH 3JSBA 1T11A 4CT8A 4X9QA 1ZAUA 4NRUA 5CA1A 2LP7A 2P4KA 4ECRA 5B1BC 2XC9A 2WBRA 5IJ9A 5CA0B 5GAGU 1Z2GA 2OPQA 1HNZF 4TV9B 2H4YB 4R50A 1S9GA 1FX4A 5CYMA 3E2EA 2YNGA 5TISZ 4JV5B 4FS1A 2UU9O 4DR2F 3NGKA 4ELVA 2YXHA 1R3JC 5D0GA 2VB6A 3BAAA 2MZJA 4DV1B 2NZCA 3Q8QB 2RQCA 1R0AA 2FLPA 1I94B 3QG5A 4O3QA 2H54B 3OW2R 4LJMA 3AD9C 2HJFC 2XM3A 3T6BA 4JYAB 4NYOA 4C8NA 3PCOB 3J81Y 2FJXA 3VQYA 3QO7A 1LW2A 4PYAA 2PI4A 1Y66A 5LA6A 4JI3B 2IJRA 1NZ6A 3CCES 4ED7A 4YEAA 1WG1A 4QR2A 1ZBTA 5ETOA 2E5IA 4EB6A 1RFYA 4K0KF 3RJMB 4LCUC 3AG2B 4CO3A 4FLUA 1PD3A 1TUGB 5I3UA 5KG0A 2Z56B 3P96A 2MQOA 3LGMA 2I1RA 3FB8C 2C3UA 3HT0A 1M9NA 4M94A 4OMFG 1X0FA 4RU2A 3T1YF 1SQQH 1YJWV 4DI6A 9ATCB 3RUBL 4LF8F 4U7CA 3Q8SB 4EFAC 1G4CA 3W5ZA 3TP2A 1F5BA 1E6VB 1HWLA 3G4SV 3Q2SC 2PIIA 1UP1A 3VALA 3D4JA 3HM9A 3PDNA 1X60A 1C2PA 5C2CA 1D5NA 1MNGA 2XMVA 5KG4A 3E01A 1TFYA 1GTHA 1N5TA 3NAHA 4F4XA 1AJQA 4K2JA 4DPWA 1TL7B 1WNEA 2YX7A 2NNUA 1RHQB 1M57C 5IC6B 2HG4A 1UPGA 4DW1A 3D36C 2R9RB 2QX0A 2OI2A 3BREA 2ZBQA 4DZDA 4ZVHA 4IIJB 1JLGA 5AG2A 3J7YU 2G2YA 2XTAA 2UXCJ 2JGUA 4UTGA 3V6DB 4PA4A 3CRRA 1R7IA 4FKYA 1VFJA 1W2IA 2DNZA 2DNGA 3Q2TC 3KLIA 1VBKA 2UUAB 1CSJA 1T9XA 1FKOB 1IBKF 4CLLA 3K8WA 1QHTA 2ZKOA 3BDEA 2OO4A 4X20A 4N56A 2KKHA 2VQFO 3CE8A 2ZNJA 1YCIA 4I2PB 4I4TB 4O4JB 2YY3A 3P49B 3I82A 3SI8A 4JI5J 1S9EB 4GC6A 4TV8B 1G1XB 4OX9O 4RW6A 3OEHG 4F8RA 2OIGA 5J1EB 4O3RA 5J2QB 1JJ4A 2HRTA 1JLEB 5F8HA 3W9IA 4JV1A 1S0NA 5GTHZ 4MFBB 4RUCA 5HQLA 1BQXA 1Q90D 1MN7A 4M5LA 2YH1A 2X6BA 3FVYA 1EARA 3G6XA 3PIOQ 3ZBHA 1NHVA 2AEMA 1VMGA 3CCVS 1KP3A 2NZ4A 4P6QA 2ZBPA 1U4BA 3FB6C 3SJCC 2GGPB 1U8WA 1NZAA 2QFJA 2E5HA 4LFAF 1FRLA 1YIJS 3CVKA 1XMOO 3D67A 3T5JA 5JQGA 2DXFA 3MHSC 5E3AA 4IHJA 1XMQB 2XEXA 2HIYA 5E79Z 3DRSB 1ZZNA 2LGWA 1GMWA 2E5LF 1EZZB 3C46A 3TR5A 3BCCH 3W2VB 2GQQA 1HNXF 2MKHA 5IWAJ 2KYZA 4NYPA 4DCOB 1JLCA 2HFZA 1H2NA 5B0FA 4FF1A 3CD5A 2A2CA 1L3TA 2YKAA 1I5YA 5C25A 3NGDA 1S5ZA 4F50A 3ZRXA 1HL6A 3ZZRA 1RBLA 1CS4A 3OJUA 1T9VA 2IA0A 1AR1B 3CP1A 3W62A 4OGQB 1VQ6V 3CJ4A 2EIKC 2XMJA 2NSCA 3GMGA 1ROFA 3P3DA 3VGTA 1YTFB 1KEKA 1P9YA 3RB4A 2J8AA 4JI6O 4UOGA 3RG6A 4KB7A 3CMAS 3HFZB 3SV3A 4RWWA 3ETGA 3C6TB 3IS9A 1LNQA 4JI8J 2OYQA 3BN7A 1RYRA 2P67A 4A48A 4X4SA 3MDSA 2KJWA 3CXCR 3DRPA 1Y9OA 4O2AA 2EFQA 2ADBA 4ES1A 3WC2A 3TA0A 2I38A 3UVJB 3P8BB 4GVBA 3HP6A 4DR1B 1B4SA 3G6YA 2YNIA 1QR8A 2WONA 4F4ZA 2LFVA 4C8ZA 4LF6F 1NDKA 4F36A 4HT5A 3UO2A 2MKCA 1WA8A 5KUMA 5EIBD 2CQIA 3KNAA 3MEKA 1T7PA 4Q0BA 2V6AA 1PAEX 2YI9A 4ERDA 3S3WA 2F9JA 1XBWA 1RE1B 3D6FB 1CXZB 4DV0B 4AL6A 3C19A 4B7KA 1RT5B 3ASNB 3DOMB 2DPJA 4ILLA 1BSMA 3CSXA 5F8LA 2HLUA 1TMJA 2B43A 4QPJA 5J1NA 4AYBD 5KTQA 2ASLA 3IM9A 1UVLA 1L8DA 4DV2B 4DXWA 3T1HO 3EX7B 3VV2B 5IYCO 3SV4A 2QL5B 3PFEA 5SZTA 4HDHA 3TA1A 2ZZMA 5IQ6A 4TVAB 2EEYA 1SL1A 2RILA 2NPFA 3IRXA 2ZVSA 4PELA 4OZLA 3CE2A 4JI1B 3KNGA 4F3MA 3JSMA 4C8KA 2IBKA 1S5HC 2IBZH 3KCYA 1U25A 2BX6A 2D3ZA 1THZA 4TN2A 1RCOB 3M6VA 1EIYB 5GW7A 2QM8A 1GXLA 5D4PA 2KHCA 4B3SF 2YIBA 3C3TA 5D5QA 3PW2A 1FNMA 2MQLA 4MVMA 2VPWB 1QR9A 2AHYA 1SJ4P 4QCLA 2UUWA 4QR1A 2H65B 3AH6A 3QFHA 2YNHB 3TXSA 3DDKA 2Z0AA 5H5NA 4ECZA 4FFBB 5FIIA 4B08A 4CO0A 4RW4A 1N34F 2Y8WA 3FB7C 2R8GA 4E98A 3GIRA 2HJDA 4JI4F 3QBCA 3TUIC 4ZOSA 2YPYA 4DV4J 1EQ0A 2IU3A 3DM2B 1O9HA 3BKUA 4ECVA 3F0NA 4OHVA 4DR5F 3ADAC 3GU0A 3ILIA 1AI4A 1SZTA 3BO2A 1XOUA 3BKTA 5DN6G 3AODA 1TL4A 3SJAC 5CQGA 2V67A 1KYOF 3PKMA 4KR0B 4ZVQB 3MM7A 3TYTA 5DO2A 4M5DA 3FBBA 4QW9A 1S6PA 3MMAA 2GV1A 3ZZOA 5DLFA 3M8WA 4N5SA 4KKOB 1MABG 3DXRB 3N2KB 1VQ9V 5A6WA 1FE4A 2CVIA 2DO0A 3C14B 3RB6A 4FZ0A 2XHBA 1NH8A 4DCJB 2X0LA 1FKPB 5KFGA 4WP9A 4UY85 2X6CA 4OPAA 4NXMJ 2W9CA 4CDIA 2DNQA 4UCSA 3GVMA 1N33F 3D1QA 4LF9J 5LMUJ 1FAFA 4X88A 2MKIA 4ZPTR 5CBHA 3D6TB 3HPLC 4FLYA 4E2FB 1IBLF 2HHHF 5HJYA 3WDOA 3ILLA 4MMOA 5KT4A 3EDRB 4J9LA 4JAUA 5BR8J 4X4PA 2AYBA 2WW4A 1ZAWA 3QSIA 3GYGA 4MW3A 1OSDA 5KFNA 3W8GA 5LBQA 2M8HA 2GV9A 2E75B 3H9VA 2RQKA 2E44A 1AR4A 1FDBA 2E1AA 4HTJA 4LIRA 3FNNA 2MKYA 1SZXA 4F0KA 1YI2S 2Y69B 1EETA 3CF5Q 4WF9Q 2ZHAA 4LWSB 1Q7YW 5JVDB 2FJVA 5D5PA 4JI0F 1Y74A 1B04A 2E7XA 2ZR2A 2M7SA 3HULA 3KG0A 4EZ9A 3FKSG 5E2QA 3L74H 3RYFB 4MK7A 4XPEA 4LFAB 1JXLA 1F1BB 2FGCA 2VL1A 3EVMA 5A2QU 5HFLA 3V6HA 3IC1A 2ATKC 4DPYA 1AZSA 1HP8A 4XAKA 4R5PB 4CT9A 5GADI 1FA0A 1MG7A 2YX4A 2UV8G 5KT3A 4G65A 1GM8A 1WP8A 4CH7A 4PDMA 1N52B 1HNXB 3L9ZA 2G4BA 2NR0A 4WFGA 3Q89A 2EJ7A 4L74A 5B1BB 1D2DA 3MEDA 4JBCA 2UXXA 2DK2A 3WB2A 1BGXT 1MU2A 3PNIA 5AT1B 3DLEA 3V4MA 2ZH3A 5IXUA 3K9SA 2EULA 4PR6A 1RTDA 3RFRA 4PJ0Z 1YJVA 1WOPA 5B7WA 2DITA 1NPPA 3MCMA 1GO3F 4IOBA 2Q0OC 4UZCA 2Y8YA 1XI1A 3LUTB 1ZM2A 3OFGA 3TJ9A 3AT1B 1RP5A 2JK5C 2CNLB 1DTQB 1FWLA 1ORQC 5EBMC 2YWGA 4X65B 1HNWF 3G71V 4HH1A 2W8KA 4ID5B 1IBMJ 1P7GA 4OI3A 1CBKA 2MSTA 5LXRA 2NLJC 4I55B 3UCSC 2YIBD 3A0BZ 1QLEB 3CC4V 2HNZA 2F1MA 1DRZA 5BYSA 1HHQA 4EI2A 1WAZA 3JB9k 4DR6O 4TNOA 3QVNA 1IWAA 2ZM6J 4PPDA 3NNAA 3UO0A 2DGWA 4A4JA 4DUYJ 5EN1A 4O44B 5KAFZ 1SQPH 4RNOA 1AJPA 3VZHA 4Q2MA 5BXIA 1VP7A 5F0UA 4ILRA 4ZVFA 3RBDA 4O4LA 3LWLA 3UCGA 1ZX3A 4J7ZA 4ES3A 1VYAA 3H4DA 4A8KA 2HBZB 1SL0A 1VGYA 4PQUB 3M32B 2FC8A 1Z1ZA 3K59A 1IJFB 5LMNB 3BF4A 4UOCA 3MECA 1N48A 4ECTA 3OVBA 3UN3A 3APQA 1TFWA 2QGNA 5GMDA 4FBTA 4ITSA 1GNKA 1SV5A 2QEXV 4H13B 2ZNIA 1FFWB 4OLOA 1QU7A 1X9MA 4G1QA 2WVEA 4CLPA 4UVAA 4EZ6A 3SYOA 1H0HB 2YKPA 1Q86W 1U0HB 1QAJA 2B5UA 1JLBA 4O3SA 1AI7A 4G28B 3TJAA 2X1FA 3R5BA 1JMKC 1U09A 2JX2A 2ZKUA 5DQHA 3V4IB 3LF0A 4FZ1A 2FTRA 4CS2A 1F3FA 2P9EA 1HNIB 4NCGA 2ZHBA 1M57B 2OFGX 2NN4A 3U1LA 2D3O1 3NS7B 2J0WA 4QPXA 1W2BU 1HIYA 2WLMA 2BJEA 2ASYA 2O5DA 2GAGC 5KT5A 4NTXA 2BDPA 4HLBA 4MVZA 2G1DA 4KYZA 5L3CA 1N34B 1K8AW 3FCHA 3CCMV 4UV9A 5ETNA 4LC1A 1AXQA 2FY1A 4S0MA 3UNGC 4ZJQA 1NEEA 4ZVSB 2FB0A 2XZWA 1ZPVA 4D7TA 4HHHA 3QRQA 4MYTA 2JVOA 4M1KA 5M2UA 1T05B 4WBNA 4I6WA 4ZA1A 1RJJA 2KT5A 4OI6A 2UXDO 2QWPB 2WWWA 1F3VA 3VAKA 2K06A 5G4DA 2PMHA 4B3RJ 2AZ1A 1ZUQA 2IFXA 4MS2A 3OTBA 4O23A 1SUQB 2OCCC 2OEKA 4YY3F 2GMJA 1OYEA 2FDNA 3HFVA 4LBHA 1FDNA 3DDIA 3AG3B 3I56V 2D9OA 3BVOA 3SSRA 1XL6A 3JD2A 3PRBA 4AXIA 2UXBB 3BA9A 4X62O 3HHDA 1RTIB 1TV6A 1KONA 1O0PA 3ZIAG 2RDJA 3DLJA 4TV9A 3DRRB 2GAHC 1XNQO 4JI2B 4J9NA 1N33B 1ZH5A 2WW8A 3I5DA 4DV5J 3D66A 3EJMA 2QT7A 4OL8A 2IY5B 4BW5A 3ZX6A 1N54B 4IQMA 1IBLB 2A0FB 4DR3B 3EPIA 4DX7A 4NMXA 4B3TO 1RWOB 4DL0C 1LXNA 4NVPA 1GN2A 1ULRA 2EKNA 1TKDA 1E1QG 2UVWA 4X64O 5KG5A 2HVJC 2HRUA 4X1YB 2VKRA 3V2UC 4B02A 2AGOA 3MCNA 4HZ3A 3W9HA 3A8EA 4WP8A 2EK1A 2BM0A 4I1TA 3QJPA 2Z57B 5DGBA 2U1AA 1KLMA 1NJIW 4FVMA 4A8MP 3DC5A 1OIAA 4WZQA 2GMHA 1VBXA 1GRJA 2B4UA 2BSKA 1FE0A 2D3UA 1VQOS 1FJGF 2IC3A 2XY6A 2WSFC 5EK0A 2EFVA 4PWDB 4RUFA 4MT1A 4ZS6A 4C4WA 2JFDA 3EGZA 4DF8A 5IT9U 5HSPA 3FYIB 4UV8A 4JI0B 3OHBA 5A9GA 4G6VB 2FLOA 4BIZA 1XQIA 1WC1A 4ZN1A 1EN5A 2MEWA 1UVIA 4H4KC 3MPDA 2LVWA 3ZZZA 4QJFB 2Q69A 2HHPA 4B9LA 1XILA 4PG4A 1W2BR 3SPHA 1E6VA 2C2RA 2HS0A 5GAEI 2F3JA 2VU5A 1RQ0A 1TU0B 4OX8A 1D1UA 2GBOA 1LK5A 1NB7A 2AXTZ 4O4IB 3BGRB 2Q3PA 2J0SD 1NB2A 1C0TB 4C8MA 4LSZB 3SZ2A 2UUBB 2V2ZA 4CNYA 1C4AA 5D6GA 1IJEB 2F63A 2JS3A 4URSA 5IC4B 3I31A 4RUBA 1VJQA 3M30B 1NSAA 1K1SA 2QRRA 2CQPA 4C2MA 4CIOA 3N6MA 3R66A 1JQGA 2CVEA 3PW7A 3BDPA 3K58A 5ETTA 4ALZA 3N2GA 3A0RA 1ZA1B 2B5JA 4I6AA 1T02A 4IIJA 2DH8A 1FTCA 1FK9B 2EILC 4GKKJ 4DW0A 4ED8A 4KHPF 1HNWB 1KB9F 5U47A 1KSPA 4LR8A 4W4KA 4XDLA 2GTSA 3K7RA 1QVGU 2C3MA 5AE2A 1WN7A 2KQXA 2RRBA 3I0RB 1FKOA 3TZXA 4Q45A 4HNAB 2JRIA 4UXNA 2JIZG 1NU1H 2B0GA 3NWRA 3QSYB 4ZK7M 2MKKA 4DSKA 2F4VF 2MGZA 3TAMB 4I2PA 4I4TA 2ZHOA 4O4JA 2NXUA 2FJWA 4ICGA 1DQ9A 1UTAA 4TV8A 2EZPA 4WWSA 3SYPA 2IJHA 1DARA 2A79B 2W6IG 3IBCB 3KJNB 3QRRA 1UPMB 1ZAVA 2QLFB 1NSPA 5HQMA 1JKHB 5BY1A 1RBAA 2PUSA 4NLTA 2VG5B 1REVA 4DV1J 3OTEA 2OLWA 5EC1C 1IR0A 2QA4G 1I94J 2AYEA 1ZTTA 4QU6A 2PN6A 4OI4A 2ADQB 1Y3JA 3CJ0A 3HVRA 4HAMA 3JALA 4DN0A 3PV8A 1T3OA 3CJHB 1VR6A 3UDLA 2BANA 5CZVA 3OFHA 2I0XA 2PMWA 9RUBA 4CC5A 3AOAA 3DC6A 3JCZA 2EBEA 1WC3A 2Q5ZA 4M5IA 1MA1A 2VRZA 4I0WA 3KK2A 1S48A 1EHWA 3SPJA 3DRSA 2Y0BB 4CYUB 1MROB 8RUCA 2FY8A 1KS2A 3VVUA 1RKIA 3W2VA 5LSLA 4AD6A 2DQ0A 3AA9A 1QVFU 1N5YA 1SVDA 2EWHA 4ZJOA 1S4FA 4U8VA 2V0NA 4K4YA 2P4VA 1YVWA 2XYPB 2JHEA 4KBIA 4U3FH 3OV7A 3CCSV 2WVFA 4CLZA 1AUDA 4Y2MA 4DV7F 3FRYA 3MEGB 3VTIA 2GNKA 1M5KC 4ZPDA 1B0VA 3HJFA 2QGFB 3GSDA 3HVWA 2BOPA 2JDJA 2BW7A 1JQ0A 2I2YA 1RWKB 1BHNA 4C9DA 3R97A 4ICLB 1PGZA 2C2MB 3W7SA 2CPFA 4DR4B 1QSYA 3C6TA 4D6TH 2MY7A 2RUSA 1VQLS 3J7Z5 1X5SA 4WPAA 1E6YB 2L48A 3D68A 2Q67A 1YJNV 4WIQA 5LM7E 1VQKV 3UVJA 2MQ8A 3LDCA 3LAMA 2VC1A 1QVGR 1VQ8S 3BQ0A 3D1OA 3T41A 2XLKA 2HVZA 2UVVA 4ZHQA 3KLHA 3GFYA 2DBBA 4CH4A 1BUXA 3KLEB 1UPPA 4YHHJ 4LUBA 4JV0A 4X1KB 1LKZA 2XGQA 4OV1A 1BHAA 2Z2MA 1TVRB 1XMBA 1ZTEA 2XBPA 1FKAO 3LO3A 3F5TA 3CJSA 2HNDB 4Y0FA 1V9PA 1J5EJ 4L75A 2VBZA 3ZTOA 3HHLD 3M7MX 5KFQA 5B0CA 2XNQA 4FKXA 3VQWA 4Y34A 2VBYA 5BMVA 4HACA 4Z2XA 5K14B 3G6ES 4K5SA 3BGOP 1U2CA 2QA4S 3ABTA 1XHZA 3HF5A 1UZHA 1JLAA 3BQ2A 3WG7C 3N9UC 1K92A 4FXWA 4PDVA 2RF2B 2GW8A 3SDEA 3GV8B 2HBRB 4FXDA 1FFTB 1FJGB 1N0NA 3WZ0A 1PYTA 1YDXA 1HW9A 3UD3P 3W1YC 3D3IA 4O2BB 3MPWA 4A5UB 1YHQV 1NT2B 1ZPWX 3DU5A 3JAKA 3ZHRA 1KLNA 1V6HA 1CULB 3IMQJ 2FZKB 2IM0A 4P75A 1H2KA 1MZEA 4P2SA 2J0XA 2HVHA 4FYVB 3V6KA 3G6BA 2IRUA 4Q6GA 4GKJF 2POKA 1KC8W 1BE3H 1RSCA 2F8EX 1XNRB 3DM2A 1VIXA 2R8KA 3GE9A 4PDLA 3NWGA 3N5FA 4M5MA 4K4ZA 1BLUA 2EIMC 2R7RA 5JVGQ 3U1NA 2V68A 5LHIA 3KOAA 2E5GA 4LBEC 4ZLNA 2BR0A 2UXCF 4J42A 3FC9A 3R1HA 1E79G 3ML0A 5JUMA 1QJHA 4F3OA 3R5JB 1R73A 3DXRA 3CO0P 1N32B 4IFYB 1NDPA 3T9NA 3OTOB 1KOHA 1ZM4A 4U7NA 1C0UB 2BW2A 2DKOB 2EKYA 2QTWA 2CQBA 1S3JA 2J6UA 3RZAA 2X1BA 5KFVA 5IQQA 2D69A 4C0HA 5GTIZ 4JI5F 2K9PA 1WOSA 1S5LZ 2CTQA 5F8IA 4LF4F 3MAHA 2J9DA 3CJ3A 5F3ZA 1FPOA 1GTEA 4HT7A 3W8PA 4EBDA 2GX8A 4ZIVA 3CD0A 3MAAB 3CJQA 1OPIA 3EXCX 2QWNB 2PI5A 2DEJA 4TLRA 3LNNA 1Y4MA 4H4MB 2B9EA 7FD1A 3OD2A 1F9FA 2ZD9A 1HNZJ 3WHIA 4CRJA 5C42B 1S72V 1IXBA 4DU8A 1QTNB 5IY5C 4P9SA 4WFBQ 2OJ3A 2LO1A 2RNBA 5FPOA 4DR2J 1HBUB 2RMLA 4I0XA 4TYAA 3CDAA 4B9MA 2JWNA 2DJVA 4KUMA 1WWHA 2V69A 2MQNA 5J2NB 2IH1C 1R31A 2MZ1A 3P45B 4DV0J 3HVTB 2OEJA 5CN0A 4NMLA 3NS6A 1PKXA 4LFCF 2C2DA 3G96A 3UM7A 4JI7F 1BT8A 2Q68A 4LWSA 2JLEA 3NOGA 2FJBB 3KWMA 5JVDA 4DV6F 1RGVA 1VDHA 4B3MF 4JYBA 1MWQA 4DV2J 3RYFA 2U2FA 4IOAQ 3FDSA 2WAQD 3OL6A 4ED0A 4K0KJ 2HVIA 3O65A 2GIFA 2OCCB 5IWAF 1MSWD 1K47A 2VPZB 2LQTA 3OHAA 5FLXN 1LWFB 2G38A 1Y11A 2H3EB 2BABA 1H2LA 4LRDA 3EPGA 2FYXA 4QQBA 5LGTA 5KA5A 3T1YJ 5C7PA 4NR1A 3KUEA 3Q8YA 3DRYA 4LF8J 5J2MB 3CSKA 2UU9B 2K7KA 5K8PA 2CZ4A 3UQ8A 4DV7B 3M8AA 3JYCA 2QO3A 4EEQA 2AW0A 2YWWA 3FBEA 3F73A 1HHSA 2OELA 4JI8F 3HI9A 4RUHA 3VAJA 4AL7A 1DTQA 1S79A 3VWSA 3OT9A 5C93A 5HVHA 3EGWB 2CUGA 1RA7A 3JATA 5B1OA 5T7LB 1IDSA 4DV4O 2XMMA 2DR5A 1P49A 4DPUA 1J5OB 2HYIB 1B0TA 2MYFA 3BZQA 3DXBA 4Y2CA 1VQ7S 5I42B 1N88A 3P3NA 3PR5B 4H0LB 1BQMB 2AZ0A 1SH0A 5DM6Q 1FFXA 2N7YA 2ZWOA 4O44A 1U1RA 5KG2A 1U1QA 1T94A 4LH6A 2HW3A 3W2WB 4KIAA 1L0LH 1HBMB 6FDRA 3A4TA 3MGJA 4N23A 1FRHA 1S97A 1NKEA 3MPYA 4PG8A 1IBKJ 4J7CA 2SXLA 1F9EB 4OHZA 4NXMO 3M32A 4PQUA 4K8XA 4B9NA 2ZC4A 4R8CA 3I5AA 3M05A 3SQGB 3LALA 5T41A 1PJ6A 2BVZA 3IAS9 1IM6A 4F3QA 3SEOA 3L09A 4FPIA 3HKCB 1S49A 5LMUO 5AJ3F 3AOBA 4FP9A 2FVCA 3O2IA 5IJ0B 1R3IC 3X3UA 2OSQA 1YRUA 2DR6A 5BR8O 2CH7A 4LP8A 1BMFG 1B7FA 4FPPA 2FIUA 5CYQA 1NTZH 2BUNA 3PJ9A 3B09A 3CDWA 5KFHA 3VQXA 3V4IA 1R1BA 1Q95G 2ZDIC 2DNHA 2WZ1A 1GX6A 2DR9A 1S12A 1IXMA 4AQYF 3EMTA 4K59A 4RW8B 1EX8A 3D36A 3LP1A 1V3RA 3H5UA 4H37A 2B1GA 2WOMB 3ENAA 4Z1MG 2EILB 3N0VA 2QLXA 3LA0A 3ZC4A 1TKTB 2ZVIA 3T5HA 1YTYA 4RNNA 1NK4A 1WTBA 2CPXA 2YBVA 3R3TA 3RYHA 2BE2B 4LFAJ 2Q8VA 2QWQB 4E0DA 4AT1B 3NCPA 2UVUA 3UO3A 3U7JA 3T5KA 2VQFB 4DL6A 1NDCA 2RB7A 2N74A 1HWJA 1WPBA 3GIMA 2JGDA 4N47A 1T05A 5B1AC 3DMJB 3KDNA 1X4HA 2E5LJ 3BBCA 1VIBA 4DSIA 2C2KB 2ZE2B 2HZVA 2XCPA 2MQQA 1HNXJ 1MMMA 3LSUA 1Z2ZA 1U24A 1UFLA 3EVKA 5ETQA 3BO3A 4LF1A 2ZITA 2XY7A 1PJ7A 1NSQA 1T3NA 2HQCA 3EVWA 4F4WA 4ZITA 2RDCA 2QYGA 3MTKA 4TY8B 3EXYA 4OI1A 4ABMA 3OUYB 2Q4PA 4PV1B 5CB4A 4ZCMA 2VDIA 1VQPS 3W3SA 3LP2B 1BS3A 1T9WA 2ZIMA 3K5OA 1VQ4S 1JK9B 2KRRA 4ZMMA 4LF9F 3L71H 4PAAA 2ZXWC 2RS8A 1QAIA 4LQ3A 3RYCB 4ETXA 2XMTA 1AT1B 1VRUB 3UKMA 1YBTA 3PJWA 5HK4A 1KMIZ 2CAZC 5J2TB 4CLYA 2XO7A 2J6TA 5HVGA 4A8YA 2MZRA 1WEZA 1GK8A 1PG5B 4DK1A 5MLCV 2XAHA 1UWBB 1VRTA 2OGUA 1FXHA 1BZKA 1PSDA 1MG1A 1IBMO 1U2FA 2D3OW 1HARA 1XMOB 1GMVA 2ZR3A 2HWIA 5CCMA 2EXUA 4QYZK 2KFNA 4X66O 4ZP8A 2E1MC 4LF7F 4DDFA 3E8FA 4J9ZB 4LF6J 1RT3B 3CJKB 3ZNUA 2V2QA 2ZM6O 1K4CC 1G6BA 2DGUA 4JYCA 5JJJB 1IKWA 4DUYO 3LSSA 2VA3A 2PEBA 2GHYA 3JSNA 4CO2A 3W7WA 1ZSPA 1HQUA 1GM7A 1JNZB 3OR6C 2BTQA 2ZUAA 3IFXA 1AI6A 1YITS 3H40A 4W98A 2YNFA 5ETMA 3AA8A 3QGHA 2AJ2A 1O6XA 4ZHRA 4PWDA 2ZC3A 1OJHA 4BS2A 3MCOA 2GVZA 2Y9HA 3PACA 5IZHA 5L9NA 2RKIB 4J5OA 2EK6A 1NH2B 2E1RA 1X4CA 4R6ZA 2HVKC 1IKXA 1UL3A 4YB6A 3DKDA 1SC1B 1NJXA 3STZC 4F0HA 5GONA 2YQ3A 2MXYA 2DYSC 2OTLS 4OYOA 2ZE5A 1X5TA 3KZIZ 1B3TA 3K5MA 3CC2V 4GO7X 5KLVH 1NSKL 3ETOA 5ETVA 2IDLA 1O5JA 4B3SJ 2R9AA 2G2OA 1C0TA 3JASB 3G4SS 2D1CA 2V8PA 3HHNB 3ZFVA 2ZT9B 3K0GA 3KMQA 3O1LA 3QGGA 1F6TA 3I55S 4LF5F 3BFRA 4NLPA 4QWCA 4NXNF 2VUGA 1CJVB 3E86A 3PM9A 1N34J 4C48A 3AFGA 1DTTB 2XAGA 5F3TA 3OR1A 3KUGA 3W66A 1UJ4A 3J7A1 3AQPA 5I3QA 2O67A 3J80Y 3LPEA 2BOBC 3HKDA 4JI4J 1NK8A 3IGNA 3R65A 2LA6A 4DQPA 3J80N 3QF7A 2J7KA 1FXDA 4M5NA 1ZM3A 5J1PA 4DR5J 2BJDA 4CQ1A 3SQOP 3T1HB 4NKGB 1VLYA 2O01C 4WKYA 3L3CA 2ABYA 2A2DA 3WG7B 1QE1B 2MY8A 4B3RO 3OPKA 1WB7A 3R5DA 4XPCA 2EIJC 3BYRA 3IP0A 3KHLA 3TAMA 2B6AB 2ITDC 2UXBJ 1LUWA 1GEHA 3G8SA 3DLGB 2WTFA 1WB8A 2VD3A 3QTCA 2AJ4A 1VF7A 5E3PA 1N33J 2FJEB 2RJZA 4O0NA 1HYSB 2BMBA 3NEKA 2CZ9A 3A8KA 1XHXA 1IBLJ 1R6KA 1Z5WA 4DV5O 4NEZA 2HHHJ 1D09B 4WF9V 4K5RA 1Q7LB 1S6QA 2NR5A 4DFMA 4ZI7B 4F4LA 4U3JB 3F41A 3B8HA 3MM5A 2PE8A 2K3IA 4FYYB 4UQGA 3CJHA 3W65A 5CBFA 1LWCA 1QCEA 2EIMB 2XHWA 5MAOA 2V8VA 2ODMA 3IAM9 2WLJA 3OL7A 5D0HA 2ZUGA 2JFKA 3PX0A 1C4CA 4RQFA 4KGXB 3JSYA 2B7CB 3ZRVA 3BPDA 2P90A 2IJNA 4CYUA 2M8DB 2W24A 3TEHB 2KG7A 5DECA 2VV5A 2FGOA 4JI0J 2F1FA 5DZ6A 4TSFG 2WA4A 5ITZA 3OXGA 4N8OA 1K5SA 2P6SA 4WYWA 3LANA 4KO0B 2BYCA 2PYLA 2W2PP 3CMQA 2DNKA 2BRLA 4MIBA 4U96A 3A3PB 1VC6A 3MMJA 5GAHI 4U8YA 4PI2A 2VA2A 2FVRA 2L9DA 4X4TA 2R9IA 2FMLA 3CNQP 4DSEA 2HFUA 2CKWA 2C2EA 1TA8A 4KL1A 4HEA9 2NQPA 2IH3C 3M6XA 1SQEA 4K4WA 1SI9A 4JUZA 1VJWA 2DMXA 2EW9A 4NYZA 4Q20A 3T19A 4M5KA 2L9WA 5IY5B 4J9QA 3CCJS 2D3OR 4KTQA 2AT1B 2EINC 3S3XA 4KRWA 4EYHB 1E6YA 4RW7A 3M2RB 3B78A 4A8FA 4OX7A 1AB3A 3D0IE 3T9ZA 2R7WA 3HFKA 1AR5A 2ZCEA 2HHVA 3ZZPA 4UFZA 3BA8A 1CLFA 3POTA 1HNWJ 1R6YA 1TVRA 2XT9A 4AXJA 1S6UA 4GKKO 2LLZA 1WHXA 2Z3YA 4IG0B 1L3VA 5BYRA 4ZDNA 5EGYA 2OD6A 2OIEA 4J9UE 2CWXA 1YVFA 3QLHA 4OPHA 2B8QA 4GRSA 2XSJA 2HZCA 3C16A 5J2PB 4DQIA 4J9PA 2XS5A 1TAQA 4CS3A 1JJ2U 1N36O 3D6MB 1UA0A 1OY6A 2ZINA 3UDCA 3SFGA 2RF2A 3VZIA 2KB2A 4F26A 3B4SA 3CCQS 2CDQA 3EZOA 2R72A 2OFHX 3ZTSA 2VFTA 5GVQA 3OLAA 3NKYA 1TKZA 2V7QG 4YDXA 1FF2A 1YIJV 2QL9B 2AX1A 1EP4B 1BWEA 1RADB 3UQSA 4K3AA 4TT3G 4DR7F 4C0BA 3CCLV 2E29A 3B8NA 5KHIA 1NK5A 4DV1O 1RTJB 1I94O 2ZDOA 1T9UA 3L4BC 4WU3A 1RYSA 5EBLC 1CEZA 4NTWA 4MKVA 1W25A 3Q0AA 3TAPA 1RT7B 3FFIA 5K8MA 1HWYA 3HHEA 5K20B 3M9OB 2VQEF 3U02A 5KFUA 4P2FA 1RU2A 3JAMU 5GADU 3BSOA 3RYIA 1HBNB 3OL8A 3OSPA 3H5SA 3UDEA 2GFFA 3ZZYA 1P6TA 3H25A 4HVZA 4CH6A 1FXVA 2R7SA 2IPOB 3UT5A 3KK1B 2E1CA 1S1WB 3ZTQA 3KHGA 1PNLA 5CHCB 4J7KA 5L9XA 5SUHA 3C3LA 2VHGA 4GKKF 2D9PA 2DCLA 1JMTA 4U7UD 3O44A 2UXNA 3PYEA 4ATNA 4QWAA 1DFDA 5ETRA 2C1EB 4XIUA 3RAMA 4ZIBA 1XBLA 1P4RA 3E83A 3DLLQ 4C3KA 1RHKB 2ZJQQ 2DEIA 2VF3A 4IFYA 3PFOA 3TUZC 2DTJA 1SXLA 4X1IA 1BQNA 4A8SA 4PQAA 4USMA 1NHKL 3HZGA 5EIBC 4XTTA 1CJKB 4ZVUB 4HHUA 4CNZA 1TL1A 4KGMA 2B8PA 1ENVA 2LXFA 2VG6B 3H2LA 1VQ9S 3GJQB 4YY3J 4ZCKA 3TO8A 1FD2A 3H7HB 5EUHA 3ILJA 1PP9H 4USJC 1RAOA 4DX5A 2R7VA 2B1IA 3NS5A 3R7BB 2KXHA 3V6JA 4MW8A 2LFSA 3MAAA 3KLGB 4JV5F 2PSZA 1RSOB 1OQ3A 1LFPA 3R7SB 2VG7B 3Q4HB 3JTNA 4M8LA 4CTAB 1AJNA 4FPRA 2NS1B 4OJGA 1SERA 1WJZA 3PRVA 1V5IB 1NKDA 5L39A 3ILOA 3OL9A 2RRNA 2DGTA 3Q83A 1XR7A 1R6VA 3ET6B 2PEHA 4DXLA 4YHHO 2R2SA 3MWBA 4JYAF 4OX6A 2WVCA 1SQVH 2E7VA 1IQZA 2DXEA 5A8RB 5H6RA 3HVTA 2EC2A 1JJ2R 1XQ8A 1VBZA 4JI3F 1VOMA 3B54A 5EWEA 1Q5YA 3IR6B 1J5EO 1Q5OA 3O6QA 5I4MA 2WLIA 2UXDB 5B1AB 3AY0A 2R2TA 4WJBA 3ZHSA 1TUBA 2BE7D 3TA2A 3PIPQ 2KVQE 4HR2A 4IG3B 2CQ3A 4DFPA 3NXZA 4BCAA 1FJGJ 5EBWC 4QIGA 4MVUA 3QIPB 3B4MA 2B7BB 1YEWA 2DQ3A 4X62B 4P9PA 1KHVA 2HMIB 3BO4A 1FO1A 1IXKA 1AROP 1SC5B 1HQEB 1KNZA 3JD0A 2ZXWB 5IM0A 1UJWB 1XNQB 4PUOB 5IFMA 3MM9B 3ETEA 4PYDA 5LP6B 2H94A 3EICA 3M8YA 2G0CA 2XUMA 2ASJA 5L3DA 1S1XB 4OLPA 1RU1A 1WELA 2Z30B 3K04A 3L73H 4IKAA 1PPJH 4RUAA 4NEYA 1Y5LB 4RNFA 4RQEA 1P9QC 1QSLA 2CQCA 3VGSA 2C2ZB 4X64B 3SYQA 2M4MA 3I4HX 1C1CB 1XNRJ 4YIPA 3GB7C 3TVZA 4RO2A 3HKEB 3KDOA 2B9ZA 5T7LA 5FLXU 5DRKA 3D8CA 4KV8B 1J5OA 1IM4A 1NUEA 2HHTA 3SJBC 2J7WA 2NXNA 2YKNA 3JD1A 3G6VA 5KT2A 2XAFA 3G71S 1D5AA 3RW6A 2DOSA 1DLOA 2QN6B 3IJ4A 1Z2LA 2UUAF 1WC5A 3PR4A 3BJYA 4KHPJ 3C15B 3OTOJ 3W2WA 2R2UA 1GTOA 2BKPA 3BB5A 1IUJA 4MJKA 3L95X 5B08A 1HBMA 1S1VB 2FD2A 2BJ9A 3AD7C 4EFEA 1IKVB 3FSXA 4IDKB 3Q24A 1OCRC 4D3HA 2GC8A 2JEFA 3OFEA 2BE9B 1N0JA 1M1KW 3QAUA 3D5MA 4HH0A 2BQ3A 3CEIA 2HWHA 2W01A 2DYSB 4CLWA 3K79A 2F4VJ 3AJ2A 1Q43A 2MZSA 2AHZA 3TOQA 1WJ9A 3QO9A 1RAAB 1U1NA 1XREA 3H90A 2IM1A 4R8UB 4Y3CA 2WB4A 1FWKA 5HMZA 4XDCA 3P32A 3R5AA 2QJ1A 2VBXA 3AK1A 3A8TA 4CO4A 3GTYX 2LW7A 3HT3A 2LXIA 5IE9A 4NE9C 2JSXA 5FD1A 2QEXS 4LSLB 1HNZO 4HHJA 4FS2A 2XWYA 4LRBA 3KLVA 1Q82W 3UR3C 2DGSA 2CNKB 2ZEJA 5AE3A 4DR2O 2DGOA 4NWBA 3MFIA 4FFKA 1BWVA 1MW7A 5KX5A 5HROA 4E4EA 1BXNA 3GG0A 3BYPA 2E5JA 1Q6HA 2CPJA 2WOMA 2VJUA 2XHCA 4O4GB 5LXTB 3M2VB 4NLQA 1P7BA 3C90A 1LXJA 1XMQF 5KFXA 2EVZA 3ISZA 1RP3B 2IJJA 1GX5A 2OTJV 3VAHA 4C6AA 5CYJA 2MB0B 4DSFA 2A6OA 3QIDA 4W4MA 4WE1B 4IL6Z 3MMBA 4ZVEA 2GVDB 4K0KO 5GAEU 3SPGA 1WD6A 2EIJB 1KRPA 2O1PA 3CCMS 1NK7A 2ROPA 2FB5A 2ZE2A 3B40A 2WK4A 4KH0B 3G9CA 5HFMA 1KTVA 2MZTA 5KFDA 3M2UB 3MEEA 3ETQA 4TY8A 3OUFA 2ITCC 1JX9A 2IVMA 3JSRA 3OUYA 3FQLA 3T1YO 1SJ3P 1QM9A 4DV7J 4LF8O 1F5AA 3BV8A 2ROGA 2WLLB 1RACB 2P5OA 4CH5A 1H2TZ 1KDNA 1I51B 4U95A 4OFZA 3VAGA 3CHXA 2RHSB 4N41A 3RYCA 1S0VA 2PTMA 1VRUA 3TX8A 1SBRA 3I56S 4Z1VA 2EBOA 1WTFA 5J2TA 4DRXA 1CQNA 3UD5A 3KK3A 1M5PC 4DR1F 4YJ3B 1H2VZ 2UZAA 5G0RA 2FHJD 1LV5A 3FMWA 3G82B 2JDIG 1QY7A 4IO1A 2Y48A 4RW9A 4WFNQ 4ZOLB 1W59A 3AB4B 4OI0A 3CCZA 1WC4A 5JJBA 3BBFA 3K2YA 1BD6A 3HD2A 3FAVB 2XZTB 1PYOB 2O3DA 1SF9A 1TGOA 2P5VA 4WFAQ 4DV0F 1M90W 2K1RA 1W0JG 3H2VE 4JAAA 3G8QA 2AZ3A 5JH7B 3O5TB 2K1EA 3SFUA 4LNUB 1PBAA 2IRYA 3I0SA 2KTQA 3BSNA 2W0XA 1TVKA 4OYBA 3R7NB 1KECA 3NR7A 2HQFA 3JYTB 4HKQA 1Y7PA 2IA6A 3MOZA 3J81N 2FHMA 4NLUA 1QLEC 4DV2F 1DY3A 4I50B 1IBKO 3MMCA 1B06A 2K7JA 3V81B 4MVRA 1RAFB 5JVHQ 3CDBA 2AX0A 1EN4A 4JI1F 1X59A 2GO9A 5H6QA 1Q78A 4C8OA 2Z4PA 4GO5X 4B3OA 5JCOC 1EFRG 3I32A 2HBQB 3L7PA 5DGAA 3T1CA 3CULA 1YJ9S 3NP5A 1KVIA 1X0PA 5HP1B 1M93A 2MJUA 3MM6B 1DF5A 3Q86A 3TZYA 2LJ2A 1RWMB 3QT7A 3M8ZA 2EINB 4P74A 3ZN1A 4FXVA 4QYRA 3IO1A 3QGPA 1N4LA 5H1SV 1KFSA 3ZN0A 2ZDPA 2J9CA 3ZTPA 4U6PA 3OEEG 1WI8A 2DGXA 3ETDA 1JLQB 1NVPD 2N7CA 2RDDA 1WP7A 2YEVB 1JOYA 4FZVA 1K9MW 3F7VC 1JLFB 3ZJZA 1OMSA 1S7HA 1WG5A 1D8YA 1DTTA 4AILC 4USWA 1HWUA 2OHDA 3TEGA 2PF4E 1YSJA 3MR2A 4GKJJ 4TUYA 4LFAO 3D6HB 5HJXA 4ANEA 3FKBA 3GB0A 5M2RA 2PY5A 7AT1B 2V4QA 4NTYA 2YIAA 3CXCU 2E5LO 1RT2A 5CA1B 5KUKA 1HNXO 2ETNA 1X4EA 2RIJA 4PDRA 5IJ9B 3P30A 1YXBA 2HAIA 1Q16B 1T9TA 2OPQB 1OCOB 4WK1A 1O8BA 1S9GB 2XS7A 1RDRA 2B6AA 3OFNG 2YNGB 3HXMA 5F2VO 3SDLA 4G3IA 2AKWB 2YPZA 1PNKA 4Y6IA 3BGFA 3CJ8A 3I5CA 2P8IA 5THWA 3ENWA 4CM0A 4WFBV 4MAKA 2YXYA 2B9YA 2Y4UA 1PC5A 1R0AB 4C7QA 2CXEA 5CA3A 3BQ1A 3O8WA 3EYZA 4OZ2A 4DBQA 3B4DA 5ITHA 3C66A 2DNOA 3A8JA 1S1UB 4LF4J 4KPCA 4DJBA 2MKSA 3M8PB 4WFZA 1VLOA 2BJ7A 1VQOV 3ASOC 3GYNA 1XMOJ 3CDEA 3AG3C 4U3JA 4YJ2B 2XTJP 3PX4A 1VQ5V 2LKZA 4EB6B 3W5XA 3UDVA 2BJ1A 2GO8A 2BKOA 5HANA 4XDKA 1P1LA 5ADZA 4N7TA 2GTAA 2AV5A 2LQBA 3ZZUA 4LF6O 2CUYA 1UFIA 2QYCA 3JS9A 2M7WA 3A0HZ 1RHRB 4CBCA 3RGIA 2IHR1 3PZPA 1RB0A 3QQCD 4IH6A 2IIHA 3CWJA 2KI2A 2R8IA 2W7PA 1S1TB 3UWTA 1Q53A 4LFCJ 5FNVB 4JI7J 1VK8A 5JWPA 3FZBA 4DV6J 4UOHA 5LSRA 5JXSA 1TUEB 3IBFB 4B3MJ 5B3SB 4UUXA 1J2VA 1KBRA 4KO0A 1HNVA 1FWPA 5DQGA 4TOIA 5L1KA 2VWJA 3CXHF 3VOUA 3I96A 1NR7A 4OHWA 5AXMA 1ICEB 2F8MA 1K8AT 2P2CB 1H8HG 2UUCF 3T1AA 1NKCA 2L3MA 2ACYA 1F0XA 2R8HA 2W6JG 4B3SO 1EB0A 4TKTA 3ICXA 1JLGB 4HI1A 2J9DE 1WLEA 2E66A 5DM6V 3MR6A 4X65F 4JTCB 2DB1A 2CQ2A 5D0EA 1XTZA 3LP0A 2CTRA 1UAWA 3UR0A 5KMGA 5EWFA 4C3LA 4WCEQ 4LRFA 2GHPA 4P7VA 1N34O 3M8RA 5B5EZ 3VVTA 1L3SA 3LGHA 4J80A 1YGYA 4JI4O 1X9WA 1VQKS 4X20B 3A3OB 3HX9A 5HO4A 1CJUB 1AILA 2IRXA 4UZBA 1FEEA 4DR5O 1S6OA 2DR8A 2BOAA 2AGPA 2GCFA 2P7TC 1ZS6A 1UWAA 4RW6B 1ZA2B 1SA0B 1SH2A 1R89A 3LDEA 3DTUB 4UUJC 2HK2A 3OE7G 3ZXWA 2OSRA 1T95A 2GUZA 1R3NA 5KFRA 5EX3A 3CRQA 1ZTWA 2C28A 4RKUC 4Q5VA 3FB5C 2ATLA 5LMNF 1TELA 4F6RA 4I4BA 3NMAA 4OYMA 1K34A 1HPZA 3LSQA 4GMKA 3R8YA 1GAOA 2ZOMA 4WTOB 4NASA 1Z5VA 1U1PA 1EP4A 2HBYB 5IS2A 2ZE7A 5AXNA 3EZ5A 1N33O 1F60B 1GXTA 1OHHG 1RHJB 5IV3A 1VF6A 2CNNB 2N3LA 2YKMA 2DHSA 5AJ3J 3NY0A 3DC2A 1VS3A 3M8QB 3Q8UA 1IBLO 1NBMG 1RTJA 2HHHO 4FM2A 3BHPA 2IAJA 1CPZA 4RZRA 5JQGB 4UY8T 2DNPA 1RAHB 4ZVGA 1R8PA 5DG9A 3VF0B 1F9HA 4RR5A 1LFWA 3PN1A 5FDLA 5L1LA 2DGQA 3PXGa 1NLKL 2ZH9A 2E76B 2K3KA 3MUVP 1RWWB 1H8EG 4TU7A 1JLCB 4GC7A 4AQYJ 5DM7Q 2HKEA 2ALYB 2HFEC 1HBNA 2V4DA 1SB6A 4I69A 4B7EA 4F2SA 1NAQA 2KG1A 3Q8RB 3GV5B 2OKQA 3MD0A 1RT6B 2JRSA 3FEYB 2MMYA 3N4WA 1WSRA 2JEXA 1URRA 4ES2A 7FDRA 4JI0O 1HHTP 1OCRB 2F23A 5CXTA 1VQLV 1HW7A 4X4RA 2HQIA 4I7FB 2W2NP 2XGPA 4R0JA 1N6QA 2RHQB 3RT3C 5LMUB 2PA8D 1N5SA 1VQ8V 4PABA 1FERA 1REGX 4P73A 3T4DA 1CJKA 2PFFB 2RQ4A 3DRPB 1LWEB 1U47A 4CZZA 2VH7A 2KL8A 2FKXA 2AU0A 4O2AB 3EZUA 4FF2A 2AWZA 5BR8B 2DNYA 2UXBF 4GVBB 4JF3A 2YNIB 3RAQA 2WONB 2KYXA 1AB8A 4L76A 3HHLC 1WA8B 3P5BP 1WC6A 1BC6A 3IRWP 1KKCA 4JI2F 3W7XA 4Y2AA 4Q0BB 3KLGA 1GMWD 1H2MA 1RSOA 2ZDIA 3NNHA 4URQU 3Q4HA 1F23A 2ZD1A 2J76E 3G6EV 2L08A 1ZWIC 2HKOA 2QA4V 4FYXB 1T03B 1Q79A 3RRHA 4DR3F 2QSFA 2L6LA 1DF4A 3RU0A 1Y76A 3ET6A 1ZL8A 2IYIA 2E9TA 4DX8H 1I7FA 4LREA 1HNWO 4BBYA 1QBZA 2RRAA 4DS4A 3H1JH 5KAIZ 1IQTA 1KQGB 4LF7J 4KHMA 4TWKA 2JJ2G 4PA7A 4QZVB 1YLXA 3IRXB 3JTOA 3AJ1A 3QO8A 5CA5A 3JSMB 3G80A 4PRFA 1RI7A 1QSSA 5IYDO 1FJ7A 5K1PA 4C11A 4L3NA 4ZCLA 4USVA 2OD4A 2R9LA 4IRKA 1F51A 3B82A 5H9EK 4EEYA 4FLXA 5L3GA 4RO0A 1I5XA 2XMAA 4QIVA 5IYZA 2F7VA 1NHUA 2XASA 5EYPB 3QIPA 1I08A 4WFFA 2KZZA 3PTWA 2R7XA 3QJJA 1CP9A 2OPPB 3MTJA 4BWAA 1HQEA 1S57A 3IG1B 4RW4B 3CDUA 1DJ0A 5H9FK 4PUOA 2COLA 5H9FJ 1KKHA 4WP3A 1RHMB 3DGPA 4NI2A 1HWIA 3DSQA 1IBCB 4FDFA 5A8KA 3TNVA 1K44A 2NPIA 2QIFA 5KFBA 3SJQC 1IBMB 2UUBF 3I4PA 3OJSA 4X66B 1UVKA 2UUCB 2QLBB 3A3NB 3R6GB 2CFXA 2AGQA 3BABA 3MM7B 3MOJB 2ZM6B 4J9VA 4Q8EA 1S6PB 4NLSA 2JJ1G 3MMAB 4DUYB 2AZ2A 4RAIA 3DN9A 2FUG9 3CRCA 4LF5J 1RPRA 2WRMA 2JLGA 2V94A 4NXNJ 1PL0A 3DOKA 2DD8S 4I6YA 4FYWB 2FVSA 4OHYA 1YJUA 2CNOB 1QD1A 4KGVB 5F8NA 4ZKIA 1UJ6A 4TQFA 3C15A 4M63A 2XI3A 2E3CA 2WVBA 2A0LA 2Q1LA 1NK0A 2E7WA 2W9BA 1XR5A 1CJTA 3SCLE 4KH1B 2W4PA 5A2QY 1HI1A 3FEZA 4L6V3 3M6WA 3AK3A 3E35A 5A2QN 2BBEA 4K4TA 1OY9A 2DHXA 1U48A 4YY3O 2ZZNA 1M0SA 5F0WA 2XCAA 2J5AA 2A06H 3DYAA 4WFEA 3KJFB 2RMKB 2F95B 4R8UA 1X9SA 3H5YA 4HTIA 3RW7A 3IBWA 4PG6A 1MN9A 3R6LB 3JAWB 4YP3A 4DYLA 4P10A 4JZ2A 3NG8A 3M9NB 4DL7A 5EC2C 1K3EA 2O66A 4IRDA 1GM9A 2ADPA 1WEXA 5FPRA 1A9NB 4UCUA 2VPYB 2CGNA 4FN5A 1HD0A 2LQ9A 1LQ9A 5FJ4A 3TGUH 2DISA 4NLOA 3M2VA 1Y10A 5HMXA 2X1AA 1R6NA 1RAIB 2D41A 1AZSB 2IJFA 3MURP 3IWXA 3N6LA 1HR0F 3TJTA 1RT4B 3TJ8A 4KSEB 1NO8A 2CJBA 4B3RB 5LGNA 3BBBA 4DUZF 1GN6A 3MAQA 3HSGA 5J2UA 4WE1A 3MEDB 2WSEC 1I5OB 3MM8A 1TP7A 1Q4RA 1FJGO 2HS4A 2KU7A 2Z58B 3TK1A 1EBOA 4P71A 1RTDB 2GHVC 5EX0A 1VC0A 2NUHA 1AYEA 5DS7A 1KC8T 3ABKC 2HHQA 2HHXA 4Z7CA 2QKCA 2IVYA 1VQ7V 8AT1B 3HSDA 3BEHA 3OGCC 4DV5B 1RCXB 2C2NA 3JSLA 1GK9A 1IR1A 1B3QA 4DR4F 1FJCA 1WF1A 3ASOB 5KHKA 3Q23A 1B7YB 4TXSA 4Z37A 2ZKTA 3BS9A 4H4OB 4X2BA 1SKSA 2P06A 3D3BJ 3GV7B 5CA0A 1X4AA 3IXQA 4Y2KA 1XEZA 2GJIA 2ZH1A 1SJRA 4O4LB 3FAVA 3HKZD 3CYOA 5DDOC 1EAYC 2B4VA 4JB8B 4OZ0A 4QWEA 1DQ8A 3CW2C 2ZOGA 4BC9A 3KUHA 3VAFA 1TMMA 1VARA 3MECB 1SKVA 2BACA 2XOKG 4KHPO 4OI2A 3BGUA 2Q0AA 3N28A 4TYBA 4PPZA 2V63A 4ECYA 3JD3A 4OV6A 3JYTA 3IN5A 1SV5B 4DCPB 1VF5B 4ECXA 2KT3A 4WTYA 1X5OA 2DN9A 1H2GA 3MUTP 4M5HA 2AEFA 2JOQA 4I50A 1XN9A 4NZ6A 4P7TA 1DTOA 1K5QA 3V81A 2JEIA 4P72A 2Z5UA 3P6YC 2F4VO 2RD5C 4J37A 4B9VA 1GT8A 2DNRA 4WYLA 5T14A 3TVKA 2DH7A 4RU9A 4IGGA 1FVSA 1TR0A 3F44A 3K0DA 1K0TA 2HGMA 4C3MA 2E1PA 3AD8C 2XNDG 2CE4A 3MM6A 4ASUG 3MR3A 2WSCC 2B4OA 2Q79A 1N0UA 5A6PA 2CPEA 4UW2A 2V5HG 1H38A 3GR1A 1RAJA 3UCUP 4DR7J 3OAAG 2WLKA 2H4WB 4ZPBA 1D9AA 3J81U 4OYAA 4EU0A 1JLQA 2Q6BA 3JTPA 1DURA 3WQPA 3AEIA 3SSQA 1KP2A 2PC6A 1N4CA 3MZIA 2RH3A 1URFA 1VMBA 1DLBA 1FTRA 5B66Z 1N5VA 4K4UA 4WBNB 4DPTA 2H51B 1JLFA 1XNRF 2VQEJ 1KWMA 1G4YB 4ECWA 2H5IB 4YS2A 5GAHU 5JJEB 1D3WA 2GZOA 1VQPV 4F0MA 3OVAA 4OYPA 1UVJA 4X8AA 1TL7A 2AEJA 2CZVC 3G2XA 1MLAA 1VQ4V 5F41A 2H5EA 2HURA 1IN0A 2Y1RI 1N36B 3P4UB 3E22B 1V9OA 2KG0A 3SXLA 3NCQA 4IH5A 2QG9B 2M9KA 4G2KA 2ALZA 3P3PA 4EMDA 1Q6IA 1N32F 2NUUG 3OTOF 4Q43A 4YOEA 1TV6B 5KFPA 3V6DA 3GSIA 1VQMV 4USIA 1VQYA 5D4LA 1XC9A 5DEDA 5H9CA 2J9EA 4J9OA 5IT9Y 2H9ZA 2VFRA 5KOWA 4DV7O 4Z2WA 3HKBB 5IT9N 3QJLA 2ROEA 1OCZC 3AG7A 1UMJA 4ZPVR 2QR4A 1VEWA 1S9EA 1HW8A 3RGBA 3RRKA 3NOCA 2HK3A 1G1XA 1S1UA 3ABLB 1WDTA 4RUEA 3M8PA 1V3SA 5J1EA 3QZ8A 5C8YB 4MKBA 5J2QA 2DNLA 2X3DA 4P9OA 1YITV 3NLCA 1LW0B 1JLEA 1HA1A 2AP6A 4JV5J 1RTHB 4MFBA 1KLMB 1GQEA 1X31C 3HK2A 3IA0A 2K8GA 3OTCA 5EDWA 1KKDA 4YJ2A 5AXLA 2XLJA 3KHHA 2BEFA 1H3DA 4PXDA 1UFWA 1NQTA 1WNSA 2BSKB 2IC3B 2QMXA 2RNEA 4C97A 1OQ6A 2EX3A 1QAYA 4ZLPA 2HP8A 3CB4A 2LCWA 4JYAJ 3PEJA 5KFLA 2OTLV 3J7ZT 3F56A 1N5QA 2GGPA 3OLBA 2ZE8A 4DV3F 5JMNA 1RWVB 1S1TA 1RWXB 5ETSA 2W7OA 4JI3J 4Q44A 2VIHA 4X4OA 4Y00A 4K2XA 3M6UA 5FNVA 3THPA 1XEQA 4JGSA 2CG8A 1HR0B 3B8MA 3TARA 4DUZB 2BQRA 3EXAA 2IM9A 4X89A 3I55V 3M1VB 5RUBA 1FFSB 5BYQA 2CPZA 2WVDA 4ED1A 4PKDB 1TQLA 4CLUA 2WLNA 1K73W 3HHLB 3AQOA 4B9TA 3THOA 2UU9F 4KC5A 2XAJA 3OTDA 1S4EA 2CPHA 4LQ9A 3CMEV 2WLHA 2HFNA 4MIAA 1GKFA 5GMEA 5CBGA 1PAUB 3N2GB 2B5JB 4YHHB 4NLXA 4ECQA 3G86A 2QKAA 1N8RT 3WB0A 2FC9A 3CEDA 1LWXA 3OVSA 1J5EB 3WU2Z 4E8UA 1JX4A 2B9WA 3R5CA 2LYVA 4NA2A 4J9SA 3TUJC 2I8EA 2Q43A 4ZN3A 2M6YA 4GKJO 1G2EA 4QPKA 1F7YA 1DAXA 1CJUA 3G8TA 1EN6A 4OYZA 1OSCA 2XYHB 3M8SA 2MGZB 3K03A 4N76A 5KHHA 4KFBB 2WCXA 4UCVA 1XIQA 2LA4A 3CRAA 4NX9A 1SA0A 2ZH4A 4A8WA 2R7TA 2NSBA 1PCAA 3O3LA 1H74A 3B2EE 5E41A 2GSMB 5LHGA 2UXCO 3S8SA 2UUAJ 2XMWA 2ZWPA 1RT5A 4LFBB 1G7CB 4ZPAA 1REVB 1TUVA 3DOMA 4PA9A 1A0OB 2QTSA 5EZYB 1W7WA 1GXUA 2WPDG 2P6TA 4KQZA 3OR2B 1IVZA 4PXCA 1R27B 3EM1A 3IGAC 1RAGB 4DQQA 4DG1B 2HQ3A 3JALB 1L3KA 4JI5O 2FZGB 1Q8BA 2GMLA 4JPRA 2ZH5A 4LF4O 2YIDA 2BANB 4KT0C 1EM1A 3M8QA 3C2PA 1SKUB 4WXOA 4AL5A 1TTHB 1Y67A 3I87A 1M1HA 1J27A 1V3ZA 1Q0NA 5GMKa 2OAUA 3KK2B 3CCLS 4IO9Q 3T4ZA 3K5NA 4A8OA 2APOA 3AOCA 4Y65A 1U6ZA 1T5EA 3CO9A 4I2QB 5K5MA 2VASA 2YNHA 3FUYA 1N5YB 1RT1B 1NPKA 2A10A 2FYUH 4FFBA 1JJHA 1FVQA 2EFGA 4I9WA 4UF4A 4RNHA 1YJTA 4ELUA 1KD1T 1KN6A 4TU8A 4DQSA 4YB7A 3ELHA 1H98A 4KGZB 3UFCX 5LGUA 4IH7A 1BL8A 4NA1A 3K06A 1RT6A 4FNHA 4LFCO 2VQFF 2CPDA 4JI7O 1OWXA 2MLYA 3TRGA 1XMQJ 5F9NA 2JNJA 4OJ1A 4DV6O 1FX2A 3OMNB 2OWOA 4B3MO 2E9ZA 2F66C 2BM1A 3FRZA 3CCJV 4I7FA 2W8LA 3PX6A 1ZETA 4OX9F 4BWJA 4G27B 3Q8VA 2IM3A 1HQ2A 5IWAO 2BCCH 1TAEA 3HZEA 2ADCA 1NCLA 3BRCA 4CH3A 1LWEA 3GCXP 3QT8A 4KKOA 3GJTB 1RLDA 2YQ0A 3N2KA 5KOXA 2AQ4A 5BZBA 4QGPA 3RB3A 5B0BA 3C14A 1SESA 1UETA 1V55B 4FLVA 4P2MA 3QT6A 1FKPA 4ZHQB 1HNZB 3KLHB 3V5RA 1ITPA 2YH0A 4LRAA 1FCAA 4ZVPB 4CLKA 4IT5A 1S7IA 4RL1A 2CWKA 4DR2B 4RNMA 3SPCA 3ISND 4V19X 1MWYA 1CG2A 4WFAV 2D7SA 3NRBA 4ZVRB 3ITHB 5D8HB 1DBDA 1YKWA 2BZ2A 3THTA 4BR6A 3FCVA 1T03A 1VQNS 2QDOA 4JI8O 3BKFA 1YF2A 1XMOF 2ILZA 2JZ5A 3ZMVA 4DR1J 5BMVB 4HACB 1RM1C 3CCQV 2DR7A 2KB1A 4DQRA 3JXOA 4CO5A 3LH2S 2GQ2A 1KP6A 1JLAB 3BM7A 4DL5A 2X1GA 5DDQC 4X4QA 3H20A 1P84F 1YDLA 2YUAA 4DS5A 4K0KB 1YTFD 2VJVA 3SDEB 5L3FA 3RRGA 3CD6S 2QZ8A 4IQXA 1WKLA 1EKSA 4W4LA 3GIIA 3MF5A 3ULHA 1U8SA 2LGQA 3BN4A 3T1YB 4DV3B 3GFZA 3ABKB 2W2MP 4DOZA 3JAKB 4LF8B 2CQ4A 1D9DA 5EYPA 3ZCCA 2PD1A 3VQTA 4NYKA 4JI6F 3DU6A 2YTCA 1FD8A 3MD1A 2OPPA 5C24B 3RBEA 3IAYA 2XMKA 4JI1J 4R5PA 3IG1A 2EFOA 2PT0A 3PYGA 1S0OA 3RW0A 3UI3A 2LQ5A 2WB1D 1VC5A 4UCTA 2A1BA 5KFSA 2RCVA 1SIZA 5E5NA 3HLUA 4YR3A 2JVDA 3N01A 5HMWA 2ZFHA 4WZMA 2VOPA 3BY6A 4PWWA 2JEUA 4XO0A 3VGVA 1H2SB 4NLRA 1U1OA 4W92B 4AQYO 1X4DA 1GMGA 2DO4A 3T6JA 5KG6A 2DY1A 4NLDA 2RT3A 1SL2A 4ENOA 2CDRB 4ID5A 3T1HF 2G1HA 2HSEB 4I55A 1IBKB 1Q3EA 4MTOA 2KVIA 4UUWA 2XS2A 2RU9A 3R27A 1AI5A 2N3OA 1FYJA 3ZRWB 4YMEA 4MVSA 4KJIA 1YRXA 1XERA 2EJRA 4DPOA 5DG8A 1B6QA 1WC0A 5JCOA 2NLWA 1GN4A 1CC7A 2D2CB 4J11A 1SQBH 4C8LA 1PYSB 3D54A 3LPYA 4I9QA 5L38A 5E3RA 1SC4B 4Q7AA 4ZLJA 2FHOB 5KHJA 3CCUV 4LBIA 4DHVA 1SS3A 4I0XB 2VBWA 1L3UA 2JC1A 1UW9A 3L7OA 5CAAA 4DWIA 2F5GA 1WG4A 2AF6A 3MCSA 4JP8A 4MVOA 4LF9O 4G1IA 4LMZA 3JAWA 3TVYA 3OBIA 1M56C 1V54C 1RISA 3CJ5A 3FBCA 3CC7V 3SCKE 2J8SA 1U0HA 2X6AA 3FCWA 4PHZA 4XDJA 1EJ7L 5EHHA 1TL3B 2OP5A 1F4MA 4KGKA 4WKRA 5HQ8A 2QFIA 2XG8A 3BH6B 4IRCA 1HNIA 1JFFB 2R2RA 4ZLLA 1SKRA 4LF7O 4QW8A 2Y3YA 2PGCA 2PZSA 2OT5A 1XK8A 2OPSB 4I68A 4Q2LA 5A76A 1MOFA 1RT4A 2E5LB 4P2XA 1XL4A 4PCQA 1F2HA 3CT9A 3ZNJ1 2ZNZA 1JA8A 5HLFB 1RPOA 3AG4C 2AYGA 2HEKA 1VISA 2XO6A 3BGLA 3E8GA 3ENQA 3CCRS 2DJWA 1H7XA 2B56A 4G1PA 3EHBB 1V5VA 2OTJS 2DVIA 4CWBA 2QM4A 5LJ3Y 2DRAA 2GIQA 3H1HH 4ZP7A 2VONA 2QMUB 1OCZB 2ACMA 2UVRA 3US5A 2KJVA 4OX9B 4O3PA 3RR8A 3KCXA 3IR5B 4OZNA 3JARB 2MK3A 4WCEV 1S77D 1SUQA 3JATB 4X66J 2UUCJ 1OJ4A 4NRTA 1FESA 3ZHUA 4B17A 1P1TA 1SH3A 3KKYA 1UFKA 3GFHA 4H4OA 2HVDA 2ZH8A 2PMZD 2ILMA 1RTIA 3IWLA 5D4OA 4LF6B 1FFXB 1L0NH 1U1MA 3DRRA 4WIIA 5LP6C 4JTAB 1KVKA 4X65J 3FQKA 2KO1A 4LF5O 3ONQA 2C22A 4N21A 4LRCA 4NXNO 3NGTA 3H98A 1AFIA 3HR0A 3S6EA 4ZVOB 2H8PC 4LVNP 4QYZJ 5IDJA 4X4VA 2BQUA 5HI7A 2RU3A 4X1YA 2V34A 3VGUA 3A12A 2YXLA 1RKJA 1Q5VA 3R1LA 4YR2A 4L8JA 1O51A 1WI6A 2XB2D 1VRQC 3FYEB 3AHPA 2CH7B 2ZBRA 3R5GA 2LU2A 2C2AA 4USKA 1M5IA 5CYQB 4DL4A 4TU9A 1RABB 3QWPA 4QBUA 3H0PA 1BMQB 1EQMA 2RQMA 2Z2ZA 3X2QC 5LMNJ 2KXNB 1NJZA 4UCRA 4QIEA 4QE9A 4HBNA 2W4DA 4B3SB 2RAQA 2C3PA 1UKUA 2AJ1A 4PA3A 2JLFA 3LP1B 1GN3A 1OY8A 1X5PA 4JI6B 4AI8A 4ZIWA 4Y2IA 2ATCB 3KG4A 3TZWA 3RYHB 3S7RA 2XAQA 1YJWS 2RUGA 1YBUA 3RN4A 3OM3B 1TK5A 2MZQA 1HD1A 4JI4B 1RK8A 4CH1A 3KJQB 5HMYA 4CO1A 4DR6F 1S10A 4O4IA 3BGRA 2JGDB 4UB8Z 4IR1A 3LNMB 4DR5B 1WF0A 3WFVA 2ZH6A 2CAJA 1YK9A 3K17A 5M2PA 1BQ0A 5AXKA 4BIUA 2HAFA 1WKKA 3M30A 2NYHA 4NLGA 4J41A 1AW0A 5KFTA 2EFNA 1JXVA 1MMDA 1RXOB 4GX2A 5CB4B 2E9RX 2JVRA 3E22A 3NGUA 5J9PC 3L7UA 4K4XA 5D4NA 5B0AA 4DPXA 1N0VC 1FK9A 3E8BA 3CD7A 4FLWA 1FDAA 3QO5A 4PXEA 4B9SA 1M5VC 3OSNA 1PO6A 5F8JA 4CLSA 2MTLA 2GQCA 3I0RA 3ABUA 5B0EA 5DJBA 4LR9A 4O4HB 4EFBA 3D28A 4HNAA 1EZJA 2KXFA 2R4FA 3HKBA 2DIUA 3SYCA 1SKWA 4FYDA 3GWKC 1VRTB 4EBEA 1OO0B 3E8HA 2HHHB 1P8GA 2LEPA 4QJVA 4QIWF 3LQVA 4LH7A 2K2PA 2AIRB