2RJZA

Crystal structure of the type 4 fimbrial biogenesis protein pilo from pseudomonas aeruginosa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
SLKQQFSTKAFQAANLEAYKAQMKEMEESFGALLRQLPSDTEVPGLLEDITRTGLGSGLEFEEIKLLPEVAQQFYIELPIQISVVGGYHDLATFVSGVSSLPRIVTLHDFEIKPVAPGSTSKLRMSILAKTYRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Periplasmic domains of Pseudomonas aeruginosa PilN and PilO form a stable heterodimeric complex.
pubmed doi rcsb
molecule keywords PilO protein
molecule tags Structural genomics, unknown function
source organism Pseudomonas aeruginosa
total genus 40
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2rjzA01
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rjzA02
4DV1F 5LMNF 4JI8F 4GKJF 4X64F 4JYAF 4JI6F 3VQWA 2Q7HA 1VMBA 2ZM6F 2ZNJA 3DSQA 3R3TA 4CH3A 3QTCA 2Q7EA 4DR6F 5BR8F 1CQNA 4Q6GA 1XNQF 2VQEF 4LF5F 2E3CA 4DV7F 2E5LF 4DV3F 4OX9F 5IWAF 4X66F 2KJVA 4X62F 4LF7F 1XMOF 2F4VF 4DV0F 1GH8A 1XNRF 2JVDA 2UUBF 4LFAF 4K0KF 3OTOF 4DR1F 2UU9F 4LF8F 2RQ6A 4LF4F 1G1XA 4CH4A 2VQFF 5K1PA 4LF6F 4DV6F 4TQDA 1IBLF 4CS4A 3T1HF 4JI1F 1N33F 4DV2F 4JI4F 1IJEB 1HNZF 4LF9F 2HEPA 4CS3A 2UXDF 1B64A 2B7CB 2UXBF 2KJWA 1I94F 3ZZPA 4DV5F 1O9GA 4ZIBA 4DR7F 4LFBF 4B3MF 2B7BB 2UUCF 1IBKF 4DUZF 2ZINA 4X65F 4B3RF 1F60B 1LOUA 4YY3F 3ZEDA 4B3TF 4YHHF 1N36F 2ZNIA 1XMQF 4JI3F 2ZIMA 2YI8A 1FKAF 4NXNF 4DR5F 4CH6A 4CS2A 2UUAF 2YI9A 3VQYA 1N34F 1IBMF 1N32F 2R70A 4JI7F 4CH5A 2Q7GA 1HNXF 1QJHA 4DUYF 4BWAA 4DR4F 1FJGF 2ZCEA 1RISA 2PUSA 1HR0F 5AJ3F 4BW9A 2ZIOA 3T1YF 4DR3F 2YIBA 1O9HA 3VQVA 2J5AA 4DR2F 2QJ1A 3VQXA 2RJZA 2PGGA 4JI2F 5K1XA 2R72A 1G7CB 1G6UA 1IJFB 5LMUF 2YIBD 2BXJA 1J5EF 4DV4F 4JI0F 1CQMA 4NXMF 4GKKF 4LFCF 2YIAA 4JI5F 1HNWF 4AQYF 2HHHF 4JV5F 2YY3A 4B3SF 2UXCF 2BVZA 4KHPF 4TQFA 3BHPA
chains in the Genus database with same CATH superfamily
1FK9B 3BPZA 2G9OA 2YEVB 2DGXA 1R8BA 3FBFA 1X31C 3PZPA 3W9JA 2L9NA 4WK3A 1KQSR 3EX7B 4J5OA 4LFAJ 4JI3O 2AQ4A 1SZXA 5EWEA 2ZZMA 4GLXA 4DV6J 3P32A 4R8CA 1G2EA 4NLPA 3O1LA 1HNIA 2V0NA 3V6KA 3GWKC 2Q8VA 2GZOA 2ZOFA 1QCEA 3GV7B 1Y6XA 3VGTA 5IDJA 1TAEA 5LL6Y 2DTJA 3CMQA 4DX7A 2NUUG 2DR9A 2ZH2A 3QZ8A 1X4TA 3Q83A 1Q43A 3KK3B 2MZJA 4DUZF 3QBCA 3DOLB 1P7BA 3R1HA 1X5SA 1HMVB 2I2YA 4XDKA 3BPDA 3QG5A 1URNA 2I0XA 3I87A 2OPPA 1W0JG 3APOA 1GN3A 2B8PA 3VQTA 3J7Z5 4X62O 1XMBA 2P6TA 4MH8A 2BKOA 1MU2B 2FVQA 3TA1A 3GCXP 1SQGA 1RACB 2AYBA 5K5MA 2B5JA 3DDNA 2OIGA 3VOUA 5F8HA 3CD6V 4X88A 3G82B 2CQDA 2MKYA 3MMJA 3NL0A 4K5RA 1QLEB 4JI8F 3DLBA 1R31A 4LF7O 1YBUA 3K5MA 2FHKA 3O3LA 3CRRA 4LWSB 1EQ0A 5L3CA 4X4PA 1HNWJ 2CPZA 1PIEA 5IQQA 1NKBA 1S1XB 3MM5A 1NDCA 2M52A 4JI7O 1VLOA 3US5A 4DPUA 5CBGA 3PKMA 1EFRG 5J1PA 4DR3O 3L70H 2EIKC 4K8XA 1XMQO 3KMQA 3K0GA 5KHGA 3M9NB 2C2RA 2GUZA 2HHSA 3M6VA 1R3IC 2W0XA 3IC1A 3OR1B 4DUYJ 3QZ7A 3JYTA 4LF6B 4RUBA 2VA3A 1REVB 1YGYA 4KE5A 4XK8C 3V4IA 4YY3J 4B3TJ 1HFEL 4DX8H 2HWIA 1FVQA 4CT8A 2RHQB 1HBMA 4ANCA 2GW8A 1QVFR 4CLLA 1RZMA 3P3PA 2ADPA 5CA0A 4PELA 3IA0A 1B04A 3CS5A 4DV1F 5M2UA 2GIFA 4JI6F 3ZFVA 4I0XA 3U0ZA 3SSRA 5HJYA 1FFXB 3G87A 4PA6A 4MFBB 3OJUA 1LWFB 3HVTB 3MR7A 4YB6A 3SYPA 2XMTA 5L3BA 3RBXA 5IS2A 4I6AA 4H4KA 2MPUA 4OHZA 4USUA 2VOOA 3WC2A 1RT6A 1X59A 1N0UA 3HM9A 4IDKB 3JALB 1PYOB 1TKTB 1U1NA 4OLPA 4FYDA 3HK2A 2G1HA 4B08A 3BO2A 3ML0A 1WEYA 1SJ4P 1HR0B 4OI1A 4K50A 4RW4A 5DO2A 1Z5VA 5ETKA 2R8GA 1IBLJ 3V5RA 1UA0A 4KHPO 3GV8B 2RU9A 1L3TA 2P90A 5GTHZ 3NNHA 3EVWA 4KJIA 3G6YA 3OVAA 3QRRA 1FXRA 4N23A 3RYLA 2E1MC 1B7YB 2MEWA 2ZM6B 4JBCA 1W2BR 2YNIA 3QO9B 2UUBO 3H90A 2XY7A 3RFRA 5A8KB 4PG4A 5G0RB 4QJVA 5J2QB 5A8WB 2GDSA 2YIBD 4JI1O 1S6PB 4U6PA 2B43A 5ETOA 3V81B 3D2WA 2UUAB 4C8LA 2C3YA 1RABB 4B17A 4B3MO 2HHUA 4YR2A 4GZRB 3MWBA 4FS2A 4DPOA 3A3OB 4RNMA 4KAIA 2VPXB 4I50A 4B3SJ 3HX9A 2GGPB 3UQSA 1Q81T 2E9TA 4ZJQA 4LF9O 4DSJA 3KG4A 1SQVH 1WHWA 5JVDB 3KJVB 1KVIA 3C46A 1HNXB 4NLUA 1HQ2A 1AVMA 4LUBA 3AY0A 1P84F 2OT5A 4NA1A 3KLHB 3ZCCA 4DV5F 1AFJA 2FZKB 1TTHB 3POTA 1N33J 2CH7B 3CIZA 1UWAA 2HS4A 5ETRA 3SBMA 1YSJA 5KG7A 2ZD1B 2P2CB 1NK7A 2YQ0A 3MM8B 4LRCA 1ZAVA 2DT9A 1K1QA 5KFNA 1NTKH 2CKWA 4DV7O 2XYGB 3HHLD 5FL7G 1DTOA 3T1YF 2YXLA 2W8LA 5SUHA 1KKHA 3D3CJ 2K9PA 2EFQA 1SJ1A 3UDCA 3BQ0A 2LVWA 3DRPA 3NXZA 2F4VB 4NLVA 4MKAA 3C19A 1L0NH 4DOZA 4HR2A 1L3KA 3HKWA 1JMKC 4KTQA 2AHZA 4J9PA 5A2QY 4DFPA 2ZR3A 3N6LA 4JYAJ 4B9UA 1CJKB 5ETLA 1XMOO 2HMIA 2VHGA 1CP9A 5EZYA 4ENOA 4RWUA 5JMNA 1YDLA 4KRWA 5LMUJ 2B8QA 4O4HB 5IJ9B 3HDSA 1WC5A 4EBDA 1WTFA 3LUYA 3J80U 3NP5A 3MHSC 2RDCA 3E89A 1GM8A 1HBUB 4NXMB 1NJZA 1KC8T 3RN4A 3RAMA 1H0HB 1XI1A 1I1GA 5C25B 1N36O 1PBAA 1SC4B 4KFBA 5I42A 1RP5A 2OO4A 5LJ5Y 4UUWA 5HBMB 4I6YA 2AYMA 1GM7A 4ICGA 2UXCO 1SH0A 1TUVA 1KP2A 2FQQB 4PUOA 2MHNA 3ZTPA 5E33A 4X65B 3O44A 3ZO7A 3HVRA 2GJ2A 3AXKA 2QX0A 3BDPA 2QGFB 1B0VA 4WBNA 2ZCEA 1RCXB 3H40A 2C3OA 1U48A 3PM9A 2DY9A 1NJWA 5HSPA 4DQQA 1FRXA 2QJ1A 2KFNA 3MUVP 2M9KA 1B70B 1FNOA 5D78A 4NEZA 1CJUA 2RF2B 1WSRA 2FDNA 2HFVA 4IYHA 1RHQB 3K9SA 1WEZA 2F40A 1B0PA 3DXSX 3U1LA 3AJ1A 5LGUA 2UUCO 3DC2A 2Q66A 4CLFA 1M9NA 3NXSA 3BGLA 3R5AA 5K14A 2R7OA 4LBPA 1N0JA 2FHJA 2ZWPA 1H73A 3TEGA 1V5VA 3GR1A 1KECA 2F93B 4CLWA 4YS2A 4JPRA 2O67A 2RILA 4X1YB 3EGVA 3F41A 1NH2D 2ZJRQ 2RCVA 4RX6A 2R7VA 1AJQA 1WC4A 1PAUB 5B66Z 5E1AC 1XEQA 4U3JB 4JI0O 4JI2B 3UCGA 3CUNA 4CZCA 5C42A 1TUWA 1JJOA 2BE2B 2CPFA 3VAFA 5LOQA 2DKOB 3DGVA 2WSCC 3KHGA 1NH8A 1TMJA 5IM0B 5FDLA 4XAKA 2ZH4A 3FQLA 2Q0OC 3BSNA 5KFFA 5CYMB 2HW3A 4D3GA 1F9FA 2CQ2A 4BW5A 1JXVA 5J1EA 2MLZA 4NZ7A 2XAFA 5MLCV 3DMJB 3NY0A 1T05A 2BRKA 5HMXA 2PIIA 4EUVA 4W4MA 5F8IA 1HNWF 1FFWB 3CMES 3MGJA 2CQBA 3IAYA 1XR7A 1O6XA 2ZT9B 1N32B 1WLEA 2FC9A 4A48A 4MW3A 2F9DA 2OP5A 2XMJA 1QDUB 2K1EA 2MKJA 1FJGB 1MROB 5GMKa 4MT8A 3T1HO 4PWWA 4RW6B 4ELVA 4GRSA 4L3NA 2E76B 1VI7A 2E7WA 3I5CA 5KG4A 4QGPA 1D2DA 1Q16B 1YRUA 1FRJA 2R7QA 4UOFA 1V54C 2E5LJ 1GO3F 4CNYA 1ROPA 2QM4A 2CA9A 1F2GA 2LLZA 2WSEC 4LBIA 4DV0J 5JCOA 3KLVA 3ELHA 2JEGA 3AODA 2HKOA 4DEZA 3CMEV 4LMZA 2CWXA 3PX4A 1VCTA 2ZDIC 4YY3F 4R5PA 1WKKA 4B3TF 3LAMA 3R66A 2EPIA 2I5JA 3LGNA 2EFVA 3D68A 1JLQA 2PI4A 1NUEA 2DXDA 3EGWB 2CNKB 2G2YA 2KKWA 1JA8A 5E3PA 2GMLA 4X8AA 5D3GB 5DG7A 4KIAA 2R7UA 1SUQB 1VJWA 3RB6A 4CP5A 5BYQA 4Z2WA 2KB1A 3ABLB 3SFGA 3RBZA 1K8AW 3ZMSA 2PA8D 1L3VA 2KTQA 5D0HA 1D0EA 5LSRA 2M6YA 2QV6A 4YIOA 5IQ6A 5CHCB 2ODMA 3ZZYA 4LBEC 2QN6B 2XG8A 1ELOA 4URSA 2FGOA 1R0AB 2LECA 1Q53A 5BZBA 4Z7CA 3OFNG 1HHTP 1MNEA 3FB5C 4EZ9A 4NYPA 2FZGB 1Q6HA 2CQIA 4C3MA 1RJJA 2B4VA 2H5IB 2KL8A 4NI2B 1DQAA 4X1KA 3THOA 4KFMA 4M5GA 1HNZO 1PJ6A 1NAQA 2RSQA 4CDIA 4JI4J 1VBYA 1IBLF 4KXRA 1CJTB 2BOBC 1W59A 4KH0B 4LRDA 4TQRA 4UOHA 2UUTA 2WW4A 2MKIA 4P30A 2NNUA 1T95A 2Y1RI 4F4XA 2Y69C 4NLXA 4RJVA 2KHCA 2IMOA 3G80A 2ZBRA 1E6VA 1F60B 2ZNZA 3ITHB 4TUYB 3VGSA 4IH6A 2GBOA 1UEVA 2D41A 3MEKA 4KHMA 3NKYA 2POKA 2UUWA 1QSLA 2C2KB 3QJJA 5E3QA 1GNKA 4A46A 3W5XA 2OSQA 4KUMA 2DITA 4DRXB 2WBMA 1I7FA 5KAKA 1WDDA 5IOLA 4DPYA 3E8BA 4ZVRB 4C98A 1U6FA 5B1AB 3SYCA 4B3SF 4JI3B 2CJYB 2R7SA 2W9CB 2PFFB 4ICLB 3MFHA 3PCOB 3ZC4A 2J0WA 3BYRA 2FJBB 1RT4B 2YKAA 1X4EA 2HIQA 3BA8A 1ZAWA 4QNHB 1VRQC 4C8MA 2ZE8A 1FKAO 2F65A 1KRPA 3IBCB 3HKBB 2DYRB 1CS4A 2GMJA 1W2IA 3OTOF 4FLYA 1EZVH 3KK3A 4C48A 2OTJS 4NB5A 5HMZA 2ATLA 2ZUAA 1ZETA 1C0TB 4RWXA 3FC9A 1HMVA 1TQLA 5JXSA 1N33F 3MR5A 1TAUA 1S12A 4QE9A 5KFGA 2RMKB 2N7YA 5CAAA 4LF8J 3KLGB 3M32A 3JXOA 1U6BA 3ILLA 1MU2A 2QLFB 2IPOB 1K4DC 4X62B 2ITCC 4KV8A 2KI2A 2RQCA 3CJTA 1RHRB 2UXBJ 4J9ZB 1SF9A 3RW6A 1RLDA 4OPAA 1Q3EA 1IKWB 3C8YA 4L76A 3GQCA 1XNQO 5F8GA 3AK2A 2DNYA 5CA1B 3SJCC 1NSPA 2HJDA 2CQPA 4C0OC 1C1BA 4F02A 4LF7B 1NI8A 4LWSA 2LXFA 2RJZA 3SDEB 1DQ8A 3FB8C 5LMUF 1RGVA 4F04B 2A3JA 2M0GB 1S1XA 3EGZA 4W90B 1WHXA 4ECXA 4LBHA 2QR4A 4DV2B 2W9BB 1RP3B 3OL8A 3DNCA 4JI7B 1E6YA 4LC1A 3UM7A 3JD0A 3AB2B 4MS2A 2AW9A 1RB0A 1VRUB 4CH1A 4OMFG 3NBPB 4GX2A 4LF5F 2BEFA 1XQIA 4DR3B 2ZE7A 2XBPA 3DGEA 2DO0A 3BBBA 2BANB 1XNRF 3A0RA 1RU2A 5IT9N 4I2QB 1XMQB 4EYHB 2D3OR 5KFDA 2R2UA 4WCEV 3JARA 2G1DA 2QE7G 4ZVOB 1GM9A 2CZVC 1VQOS 3LWLA 3TA2A 3OQ2A 4WFAQ 4UCRA 1HI8A 1XL4A 4I1TA 4MIAA 4OZJA 4OHYA 4TSFG 5LGNA 1VIXA 4C97A 1RT2A 3S8SA 1M1KT 3E35A 3B4MA 1SS3A 3U7JA 5L3EA 2Z4PA 3RYIB 1H6KX 4LFBJ 2VC0A 4HNAB 2DQ0A 4BWAA 3K5NA 4U67Q 3NCPA 4KQZA 3ILJA 2AMCB 2UU9O 3TANA 1FFXA 2WVBA 1SV5B 5GTIZ 2H4YB 4MFBA 3J80Y 4DR1B 1B4SA 2U1AA 1U96A 4F2RA 1Y11A 2ILZA 4IG0B 4U7UK 2ADCA 4FLZA 4IDKA 3DRYA 3W9IA 1QTMA 3VQWA 3PYEA 1TKTA 4U95A 2E5JA 4JTAB 4PI0A 2WTFA 1VQNS 5DJBA 2OPRB 3N9UC 5DRKA 3FKBA 2AD9A 4EZ6A 4AFFA 4CO4A 2NYIA 3MCNA 3OM3B 4R25A 1FVSA 5C7PA 3TVYA 5H9EJ 2N3LA 1VC5A 2ZHOA 4PDVA 3EYZA 3VAHA 1JKHB 4NCGB 2E75B 2B3TB 4KHPB 1AR4A 4O3QA 2UVWA 3MCMA 2XO7A 2HHPA 2E9ZA 4K4UA 5F2VO 3MAQA 4LF4J 1S79A 1OCCB 4L72B 4FPPA 2MZ1A 5HI7A 2AZ3A 1AZSB 6AT1B 5G0RA 2B9XA 5J2QA 1D9DA 1XN9A 2UUBB 2K06A 2Z2MA 2IFXA 2FYXA 2LGWA 2X1FA 1S57A 1J5OB 1S6PA 3UO3A 4G1PA 4M1KA 2ZXWC 4F6RA 2D1CA 4JI1B 1PG5B 3HB3B 4P71A 2AZ1A 2FJAB 1NK0A 2A2CA 4PXCA 1S1VB 3AHPA 4WBFA 2XM3A 4LIWA 4X1IB 2ILYA 2VU5A 4JI8O 1G7CB 4B3MB 3GMGA 4A8XA 3SCKE 4C8ZA 2KB2A 3CX5F 2GGPA 5C93A 1P27B 1PJ5A 5JVDA 1VEWA 3BN7A 3HVWA 5GADI 4LF9B 2IYGA 4JAAA 3KCXA 1NPRA 4KKOB 2NPFA 4NEYA 1JOYA 4JOUA 2HHHJ 2E5LF 2RB7A 4UCOA 3KLHA 4NXNO 3FK4A 4DV0F 4KT0C 2OTLS 3CTRA 3RBDA 1NZ6A 2CH7A 2DE0X 4GC6A 4NRTA 3VVTA 1TK8A 3VAKA 4TQDA 1RBLA 4PPDA 5G4DA 4TXSA 2ZD1A 3G6ES 4IRCA 5L39A 3GTYX 3BREA 4DR7J 3SYZA 1HW9A 2ASJA 2VQFJ 1U2FA 3EWGA 2YXYA 1VIOA 1YJVA 1U24A 4DV7B 2ALZA 3QVNA 4NCBA 1IQTA 2DYAA 2F23A 2B1IA 4O4RA 1NPKA 2XLIA 5IY5B 3ILIA 2R9RB 2HZCA 2W6IG 1QNMA 3GFXA 2V6AA 1KONA 2N82B 4WP3A 1KP3A 2BX6A 2IDEA 1UJ4A 4F26A 4X66O 2QIFA 4ED8A 3R6LB 1N0NA 3AJDA 4O4HA 1XMOB 3SSQA 5H9EK 1BCCH 2V63A 1F9EB 2B56A 2M8DB 4LVOP 3TR5A 2YKNB 2YWEA 4QWDA 1RTDA 5KHKA 1M57B 1RWUA 4F3MA 5KT5A 3UDEA 3PW2A 1RDRA 2JGUA 5HROB 2QA2A 5KFOA 4G6VB 4PWDB 1JLEB 4WIIA 5A2QN 2DGOA 2KXNB 2YX4A 4ATNA 2JX2A 1G3OA 4DUTA 1BD6A 1MMLA 2BW7A 2XYHB 5IT4A 2NR5A 3JQJA 3CF5Q 4DFKA 1N36B 5HBMA 2JFDA 1WSVA 4E2LA 4QR2A 4CLKA 5DDPC 3TAQA 1Q5OA 2CVIA 2HP8A 3DCAA 4IQXA 1URRA 4R0JA 1H98A 4ZIBA 4L75A 1JR9A 2GIQA 5IYDO 5JJBA 5GMEA 1NU1H 3ASNC 5T41A 2XLKA 5LXRA 3SYAA 1N6QA 3TVKA 3C6UB 4ELUA 1IBMJ 3JAWA 4D6TH 4MT1A 1NR7A 4Q5VA 2RF2A 1FERA 1XR5A 1FJCA 4CH5A 3K7RA 3MD0A 4LQ3A 1NK6A 2HZVA 4QYRA 4ITSA 2C2OB 3CCMS 4NZ6A 1RI7A 5IWAB 5K9FA 4ECVA 3RW7A 1Z2GA 3VGUA 5DQIA 1ZTWA 4I68A 1J5EF 3ZHVA 4DG1B 1MA1A 1VC6A 1M5SA 1WDTA 5AXLA 2LXIA 3BZQA 3D3BJ 4FKYA 2LP7A 2HR3A 1NKCA 1IVZA 1BE3H 1VMBA 2PY5A 1Q8IA 5A8RA 2QA1A 4IL6Z 4X1YA 2J8AA 3GCWP 3UI3A 3N6MA 2M4MA 3H59A 1NB2A 1SRYA 2NXEA 3MEEB 1FAFA 4OQJA 2M7SA 1NTMH 2XMVA 2BABA 4J9KA 4LF8F 3JATB 4CZZA 1Y5LB 2BE2A 1FJEB 4ECSA 4JI0B 1AI5A 4DV5O 4DR4O 1P1TA 2HNZA 5H9CA 1MSWD 2MK3A 4NASA 5F3TA 5L1IA 3OXGA 2JDJA 1GK8A 9ATCB 1S9FA 3MDFA 1ZAUA 1U1RA 1YVWA 2A9HA 3JAMU 3RTVA 5CYMA 2UXBF 4JASA 1MMNA 1FDBA 3FVYA 2RVJA 4ZJLA 1APSA 4WF9Q 2H3OA 1GFWB 1LNQA 3DC6A 3OXLA 4S0MA 1FHTA 5LMNO 3DMJA 2C2MB 3T1YO 1S59A 1VF6C 1AB3A 3CDBA 1ROFA 4LIRA 3I96A 2AJ4A 2RS2A 3H5YA 2HFUA 2DNQA 2OLWA 4Y2MA 3DOMA 4UY8T 4P72A 3KLEB 4HDGA 2JJ2G 2KRRA 2QYGA 3VAGA 1MG7A 4RW6A 1FXDA 1CQMA 2QWOB 1U1KA 2L9WA 5FPRA 3ISZA 3T1HB 3S3WA 1X4HA 1XERA 5GAGU 1BMQB 2F5GA 1KFSA 1M93A 4NLSA 4I55B 3SPGA 3GIIA 1UTAA 2GA7A 4XIUA 4Y2AA 3N01A 4DR5O 1FT8A 1D5NA 2ASLA 3L72H 4NYZA 1UL3A 2ZFHA 3M2RA 3HKDB 4MVSA 2LU2A 4OX9J 5M2RA 3DXRB 3N27A 3SV3A 4DW0A 3MHHC 1EIYB 4AILC 3KK1A 1Q86T 1EKRA 4F0HA 5D3GA 4AXJA 1PM9A 3MCSA 4LFBF 1SUQA 4PD4F 4E98A 2DNOA 4C8OA 1S10A 2LCWA 4J9UE 1Y10A 4OJHA 3K17A 4F3OA 1N34J 3W63A 4P2XA 1Q79A 2XTAA 3K08A 1RU1A 3KLFB 1VQKV 5ETMA 2RRAA 3MM7A 3CNQP 2GTSA 4OHXA 3OHBA 3GWOA 1R0AA 3VZHA 3JTOA 1OY8A 5HO4A 4YHHJ 4LFAO 2LDYA 3T6JA 5EX0A 1UEUA 4O23A 4DV6O 2LU1A 4NI2A 2LA6A 2D3UA 1B06A 4ECYA 5H5NA 1FDNA 1L3SA 4WF9V 3FX7A 5E0OA 3CRMA 3EZOA 3QT8A 1M5HA 2AKWB 1HNZB 2IJRA 4LJMA 4J9SA 2ZNJA 1RBOB 1UWBB 3MEGB 3JD2A 1JLCA 5LL6d 4DL6A 3B4DA 1GK9A 5B1NA 1E1RG 2PA3A 4UB8Z 4LF2A 2I6WA 2Z30B 4ED3A 3V6HA 4ZVUB 2H65B 2XSJA 3CMAS 2QLWA 2BJDA 1KVKA 4LF4F 4TUYA 1YJ9S 2RUSA 5KFHA 1K47A 4F36A 4K8RA 3N79A 3EXAA 4WYWA 2VICA 4G1IA 3FBCA 3PO4A 1BZKA 5GONA 4DRXA 2A0LA 2W7AA 2V8GA 1HQUB 1GRJA 2HNDB 2OIHA 5LP6B 5J9PC 1JJ4A 1AFIA 1M5IA 2IM3A 4DW1A 1MMMA 2LQ9A 5I3UA 2D9OA 3ZZUA 2W9CA 3I9ZA 5ITHA 1Y7PA 2DCLA 3PFEA 1VLYA 3DLGB 1HNWO 5IE9A 3IC9A 3AD7C 2JLFA 1YJ9V 5JVGQ 2FL4A 4YP3A 4QPXA 2YNHA 4JAUA 3EM1A 5CBHA 2F95B 3HKBA 2HHHF 2NXCA 2XWYA 2V2VA 4Y2KA 3JYCA 4U9RA 1RPOA 1C0TA 2Q9LA 2EIMB 3TRGA 3HHLC 4M5DA 5C8YB 2MTLA 1TAQA 5KX5B 3PTWA 5EHHA 4B3RO 1M57C 2DW4A 3KUEA 3K3WA 2ZNYA 3ZRVA 3KLGA 3LAKA 4ZPAA 2VQFF 2PMWA 4DUYO 3TOQA 2MHEA 3UR3C 2R8KA 4J7KA 2DNHA 3MCOA 5BR8J 1WI6A 3B6BA 4PQAA 1IKWA 1RT7A 3D3QA 3EICA 3IO1A 5EYPB 4RU9A 1JX9A 1XNQB 1F23A 4ZVTB 3CJHB 1E79G 4A8MP 3Q8QB 4ECTA 4FVMA 5EUHA 3SDEA 2QM7A 3RG6A 4H54A 5CB4B 1LWCB 1Y74B 2YC0A 4FP9A 3ZZZA 5LSOA 5L46A 4QOTA 4FZVA 4O4IB 2W9BA 5BXIA 2YH1A 1UPPA 2M70A 1IKYA 3W7SA 2EFNA 3BN4A 4J7CA 4OI2A 1ZA2B 3W7WA 3NBPA 1TUBB 3LSQA 1R8CA 2BANA 2GS8A 2XNDG 4I2QA 3N2GB 5LOVB 1M90W 3ETQA 4M95A 4IG3B 3SQGA 1KN6A 1IXKA 1G8MA 2UP1A 4PYAA 4DV3J 4G27B 1RSOB 1IBLO 2GO8A 3PDNA 2ZBIA 1GH8A 3S7RA 2MQPA 1VQPV 1K0TA 4ZHRA 1C2PA 2M88A 1FNMA 3ABUA 4KBIA 1PGZA 1VR6A 2VKRA 2XMMA 4B7EA 2PT0A 4P9OA 3N6NA 1B3QA 4O3SA 5B1OA 3OVSA 2RH3A 3NOCA 1S0OA 1AA1B 2KYZA 2JHEA 4H37A 1J2VA 5J2UA 3QF7A 1SV5A 1F2HA 4FF4A 3I0SA 3V4MA 3WDOA 1IXMA 1HWYA 3MR3A 2IRXA 2RAQA 2OEKA 5JQGA 2J0XA 2P9CA 3W7UA 4IG0A 1Y5IB 4DR6O 3C3LA 3TP2A 3E8FA 5T14A 3JAKB 2XZWA 2CG8A 4MKBA 3BKFA 4MK8A 4B3SO 3CC4V 2VOPA 2OPRA 3RZAA 2WAQD 1SJRA 3LP0B 2ZH3A 3D36A 5KFAA 1JJHA 1SC1B 3T4ZA 2C2ZB 3M8RA 2JLGA 3STLC 1JKHA 3J80N 3A8IA 1SZTA 1SKSA 1R1BA 2DWDC 4JI5J 3GIMA 1I5XA 1OPIA 3ZS8C 3HSGA 4JV5J 2UV8A 2MKHA 1GN2A 4BDPA 5F9NA 2XY5A 3WBZA 4USVA 4USHA 4QU7A 2RQ6A 2QL9B 1AZSA 3QSYB 2AGQA 1VQ7V 2DHXA 4EFEA 4BAYA 1RTJB 2JVRA 3H20A 4D7SA 1AR1B 2F43G 2FC8A 4DF8A 2XUMA 4OYMA 4KGKA 1J5OA 2CTRA 4UXNA 5LA6B 2BDPA 3MF5A 4B9VA 5GAHU 2J9CA 3MMBA 1IBKJ 4FF1A 1R3KC 2GJFA 4G65A 3QO5A 1S1VA 1U1PA 1UPGA 3EVKA 5IYZB 4X1IA 1FKPB 1EHWA 1GMUA 4OZ2A 4DS4A 1H72C 2AGAA 3ABKB 4JYAO 2HS0A 4L74A 3BQ2A 3P30A 3BH6B 3C6TB 3SJAC 4NWBA 2BSKA 4JI8B 3BH7B 5B0FA 3MMAB 1O5JA 4YR3A 1US6A 5KUKA 2VBYA 5LMUO 2CPDA 1YF2A 1VJQA 3IM9A 1U0HA 2YIBA 2PTMA 2XHCA 1OSCA 3RR8A 2N4DA 1KTVA 2H48B 2V8HA 4KKOA 3BR8A 1QE1B 2C3PA 3PW0A 3ZRXA 3H2UB 3PJ9A 4DU8A 3GSDA 3TGUH 3STZC 3QWPA 4NXNB 4CTAB 3DLLQ 1MMDA 1TV6B 3L74H 1HLWA 1KLMA 4L87A 2P67A 1N52B 4OXSA 3CC2V 2IBKA 2B9YA 4QZVB 2GIRA 3N2KA 3HT0A 3H98A 4HDHA 3G67A 4RKUC 2EK6A 2EC2A 4OX9F 1Q82W 3V2UC 2KJVA 2X1AA 1SI9A 4ZLJA 2AXTZ 2ITDC 4OX7A 3JSMB 1DF4A 2B4OA 3QAUA 3ZHRA 3T5HA 1S6QB 5SZTA 3HJFA 4J10A 2M3DA 3LSUA 3JSNA 3FFQA 3KNGA 3QRQA 3HSZA 3VR1A 2QMUB 1RE1B 1OQ3A 3LGMA 1ZM2A 4IH7A 3CSXA 4DCOB 3PKYA 4XBFA 1IKVB 5IC4B 3AG1B 3OTEA 4RQEA 4BWMA 3QJLA 3CE2A 3QT5A 2ROEA 1UMJA 4ES3A 3HPOA 2Y9HA 4X66B 2JZ5A 4YHHF 3IXQA 3GFZA 2QA4S 3W8GA 1GQEA 3P6YC 3IC7A 2LQBA 4JI6B 2YKNA 2GC8A 3EXCX 2KZZA 1K4CC 2BJ3A 2ZOMA 1S5LZ 3SYQA 4DR2J 1HWJA 2NS1B 5LJ3Y 4CO0A 4FLTA 3ZX6A 3HKCB 4ILMA 2BYCA 3TQ1A 3W2VB 4WYLA 4I4TB 3Q22A 4ZCKA 3TUZC 2CG4A 3S01A 3RVYA 3WB2A 1LW2B 3VALA 1PD3A 3A3PB 5KFTA 2Q7EA 2ZZTA 2HRYA 3G8QA 1M1HA 2E3CA 1RTHB 4ZOLB 2NCKL 5DN6G 2NXJA 2AEFA 5BMVB 1Q7YW 3ENWA 1RA6A 3I55S 3H25A 3AD9C 4ZDNA 2HBYB 3C6UA 4CM0A 4EMDA 2RIJA 2QLJB 2UXDJ 2VV5A 3JSRA 1IXBA 4URGA 3IMQJ 2HVKC 2PEHA 5J2MA 5KFYA 5LT5A 4ID5B 1U2CA 3TZXA 3CPWU 2MZSA 4CO2A 4OV6A 3K9AA 3MR6A 4MKYA 4GX1A 1NDPA 4GUNA 2HWHA 2KRBA 1HW7A 3BSCA 4ZITA 4WU2A 1HBOB 1YQHA 2GV1A 2Z0GA 2PC6A 2BCCH 3BGFA 3ZTQA 5KHIA 2HFOA 1OCZB 1OY6A 3ABMB 4JV0A 4ZN1A 3PR5B 3IGNA 3OL7A 3OR7C 1WPXA 4UCVA 1QR8A 1U97A 1JQGA 4UZBA 4OJ3A 1NQTA 4ZI7B 2NXUA 5KFZA 1H2TZ 2EINC 1N5SA 4ANEA 3HHKA 3JATA 3KWMA 4RNNA 3K59A 1RTIA 4DV0O 2YPYA 4UQTA 1L5UA 4TLRA 4NR1A 4DV5B 4DR4B 1ITPA 5BR8F 3K8VA 5B1BC 2QDOA 2G38A 1O0PA 4QCLA 1RM1C 1HDJA 3K57A 1DRZA 2VC1A 4MIBA 2HWTA 3M8QB 4LF6F 1AJPA 3EE3A 4GCZA 4FYVB 3JB9k 1R6NA 4RUHA 2VQEJ 3NS7B 1IWAA 5GVQA 5LMNB 3HFVA 3T1YB 4DK0A 3AOBA 1HHQA 2JC1A 1D9FA 3LP2B 3MM9B 2IY5B 3KLEA 4Y00A 2DVIA 4C11B 3ZEDA 3NMRA 2ZH6A 4BC9A 3WG7B 4DSLA 4H4MA 2YI9A 3KDNA 1EZZB 4CO5A 4LR8A 4O4LB 4PZVA 3Q0AA 2DR8A 1KHWA 2LA4A 1UVIA 3OW2U 1RFYA 4HYOA 2LDIA 4I55A 2QT7A 5LSLA 4P7TA 2PSZA 3MAAB 4GKKJ 4HLBA 2JH3A 1VBZA 2ABYA 2HQFA 1CPZA 1K8AT 4JI4O 1MN7A 4PDLA 1QVGR 2BBEA 2H5EA 5HP1A 4DR5B 3MPDA 3HKDA 3DOKB 3SCIE 1R27B 7AT1B 4QU6A 2E5IA 4ZCMA 3DXRA 2LQTA 2FTKA 1RT1B 4DU7A 2OHDA 3IFEA 1D1UA 3L73H 2UV8G 3DXBA 2YTCA 1HNXO 6FDRA 2C22A 3R2CJ 4WKYA 3QFWA 2R7RA 2FY1A 2X7RB 1TELA 3KLFA 2HQGA 5D0RA 4K4TA 3QIPA 4ZN3A 2B7CB 1BQMB 1FPOA 4DUZJ 3OTCA 3ZZPA 1EB0A 4JYYA 1R7IA 1F5AA 2GFFA 4U7OA 3AA8A 5DDOC 3RYFB 4YDDB 4LFAB 1MWYA 2UUAF 3DGPB 1IVSA 3GJTB 1VOMA 4DV6B 1VFJA 4P2SA 5GAGI 1W7WA 5CA5A 2QA4G 1M4UA 4KR0B 2AJ2A 5HAOA 1MW7A 4A8QA 2R2SA 3VZIA 1UWBA 3MEGA 1YTFB 4IR1A 5ETVA 1VGYA 5K1XA 4HACB 5DZ6A 3RU0A 1WC0A 1NLKL 5EN1A 2BZ2A 4RL1A 5A0YB 1F4MA 3K89A 1NK9A 5KG5A 4JI5F 4JV5F 4DJBA 1VISA 2CZ4A 5CD4H 3MDSA 1I94O 4JF3A 1GMVA 1BQZA 3VGVA 4YEAA 5DLGA 4LF8O 3PYDA 2DB1A 4Q6GA 3CCUV 2ZOGA 4X4VA 1GTHA 3HJVA 2W9AA 3F7YC 2AGOA 3FEZA 4BHQA 2JVDA 5L1LA 1T9VA 3EHBB 2UXBO 2Y8WA 1LV5A 2BA9A 3OTFA 2K7JA 3BPSP 1HQUA 1H3DA 1RCOB 4P9SA 2GNKA 5AE3A 2OGUA 2D7SA 1H2KA 1UVLA 1XJWB 4NTXA 4OIXA 3SFUA 5B0DA 4KY3A 4OYAA 3CXCR 1NT2B 1KDNA 1VIBA 2VKZG 2QTSA 2B9EA 4F2SA 3PHTA 2N7CA 3CRAA 1HNWB 5AXKA 4FM2A 2E66A 4Q0BA 3CCJS 1RT3B 1I51B 2ALYB 2CJKA 4X4TA 3CWBH 3UDLA 2D2CB 5C8YA 4ZBMA 5EX3A 2AIRB 3L09A 2MQNA 3W62A 4A8FA 5KX5A 4CIOA 2MJUA 4L6V3 1G6UA 2P4KA 1QAYA 1SL2A 1FWLA 1WP8A 3DTUB 4NXMF 2HVJC 3T9NA 2BVZA 4GT1A 2EIKB 2MGZA 3CE8A 1JLAB 5B0EA 3G4SV 4Y34A 1JJ2R 1X5TA 1ZL8A 4DUYB 2ZKTA 2M5YA 3BEGB 1C1CA 4TU8A 4B3TB 1AI6A 2Z2ZA 3AA9A 4RNHA 4JYCA 3C14B 3UCUP 3CJHA 1VQLS 4ES1A 3FFIB 2HNYB 4LFBO 3HXMA 3T5JA 2BE7D 3HSJA 2CPHA 5KAIZ 1X4FA 5KHHA 5CB4A 4UB6Z 2EULA 3D28A 3QSIA 3GVMA 2P5OA 1WP7A 2HEKA 3FYEB 1FDAA 2W2PP 4M94A 1DHMA 4TY8A 2YWHA 1LOUA 4FYWB 4RWWA 2JEJA 5T7LB 3LPYA 5JVHQ 1EN4A 1TUBA 3TAMB 2P8IA 3UNYA 4CYUB 1M5KC 2OPSA 3HFKA 5LOVA 1OQ6A 4UCUA 1NR1A 4TV8B 1LW0A 1CVJA 3W64A 4IFYB 4IHJA 1DF5A 3I5AA 1VQLV 4TN2A 1RAHB 3HD1A 4MK9A 2KM8B 1X0FA 3AEIA 1RSOA 1OCZC 2RDIA 4NLTA 3MM6B 2VPYB 4RBTA 3GIKA 3IM8A 1IBLB 4B7KA 1FRKA 2X7IA 1VP7A 4ECQA 1S77D 1RHKB 3L7UA 1S72S 3R3TA 2CPIA 4LF4O 4P6QA 4WE1B 3LW5C 5KOXA 2Q6CA 2ADQB 4GKJJ 3WX8A 1DLOB 4RZRA 4JGSA 3M05A 4IT5A 3OXFA 5DEDA 2J9EA 5A6PA 2WBRA 1T94A 8AT1B 4D3HA 2J0QD 1Q81W 1QBZA 4DI6A 5GAEU 1S1WB 3MEDB 3JAKA 5A6WA 2LFVA 2FVPA 1WF2A 2CQ0A 3ILOA 1YHQS 1SERA 2WW8A 2JSXA 4OYOA 1HWKA 3CC7V 4B3SB 3WU2Z 1UP1A 4KH1B 3LP0A 1N32F 4B3MJ 1F51A 2IYIA 2HK2A 2Y4UA 4U7CA 3WG7C 3RB3A 1FJGF 1H2UX 4FFBB 4IIJB 4O2BB 2VPWB 1F5BA 3TX0A 3CDEA 1AROP 2A6MA 2IIHA 1YJ7A 1F0XA 3LWMA 2PMZD 3KCYA 4M5JA 4IKAA 2KZMA 4Q8EA 4TV9A 1N33B 3KZIZ 3T41A 4CRJA 2VUGA 3G71V 1AR5A 2X1GA 2CIMA 3QWUA 1P9YA 4DR7O 1RTJA 3A8EA 4URQU 4YDXA 4DFJA 1S0VA 4C8NA 1YHQV 3PN1A 2LJ2A 2MKKA 1OIAA 2VQEF 1NVPD 1MOFA 3PHEA 3CJ0A 2V69A 1NSKL 3CULA 1NKEA 1KEKA 2P7TC 4J90A 5E3AA 1FKPA 3HP6A 1QVFU 2VD3A 2DBBA 2GQ2A 2J6UA 4DHVA 3C3TA 1SESA 3JCUZ 3MMAA 2XMAA 4JYAB 2J9DA 2J7UA 2OUGA 3TI0A 4C3LA 3OMAB 4TYAA 4KPYA 2WCXA 4CLUA 3CDUA 1G4YB 5LMUB 3A0BZ 2VG7B 4O4JB 3PJWA 2VONA 3LOUA 4EBEA 1KQFB 2ETNA 4ED2A 1QE1A 2FHJD 3FD9A 4UQGA 2AZ0A 4Y0FA 2YUAA 4PQUB 2Q68A 5ETPA 3TUPA 1XHZA 5DLFA 1TL4A 4PDRA 2YNFB 4DS5A 2G0JA 1TV6A 1RWWB 4P74A 2HHTA 1PP9H 3JCZA 3IRXB 2IAJB 3K0DA 1Y66A 2BKNA 1THZA 2JNJA 4W92B 4KO0B 3BCCH 2GHVC 2NSCA 2QWQB 5EC2C 4ZIVA 3M6UA 4AI8A 1GTEA 3JSMA 2IRYA 5AJ3F 4UF4A 3TEHB 3LP1A 1HQEA 1S6QA 3EVMA 4M5NA 1TGOA 2Q7HA 4CCHA 3MECB 1TKZB 3JTNA 3FAVB 1H7XA 3BKTA 5IFMA 4DN9A 2FGCA 5GAHI 1CQNA 4FVCA 3CD6S 2JOQA 2QFJA 4XDDA 2UXCJ 2GHYA 1W2BU 3JAMN 2VFSA 1IBMO 1RHJB 3IGVA 2BJ8A 4K5SA 2JRIA 1S76D 2RDDA 3TA0A 2XGPA 5EDWA 1UFLA 3NS6A 5L3DA 2EZPA 3SJQC 3CCTA 2OCHA 1FWKA 3HD2A 1N88A 1NHKL 5B0CA 2BUNA 1K5SA 1GMWA 4P9PA 5EIBD 3E2EA 4B9LA 2B1GA 1TL7B 2ZHBA 1Q90D 1FJ7A 3DC5A 4JI3F 2CZ9A 4HBNA 3C16A 3HKCA 1NDKA 3EMTA 3W5YA 4UVBA 4I4TA 3R5CA 4RR5A 2UUCJ 2QMWA 2RNBA 3P3NA 4NLRA 4QBUA 1OJHA 1LW2A 1X60A 3OFFA 5AT1B 1YI2V 4JP8A 2XASA 4A8YA 4ZPTR 4E8UA 3EXYA 4ZOLA 4DV2O 2ZE5A 4A8SA 1BWEA 3AH6A 2C2AA 2YWWA 1WJZA 2XQCA 1NZAA 3AD8C 3PR4A 2EG1A 2Q1LA 1Y9OA 1N48A 3T1AA 3QQCD 4FK5C 5C24B 1MWZA 1HA1A 3VWSA 3BBCA 4K4XA 4LFCJ 3R5DA 1CLFA 1WACA 2FJVA 2R4FA 1QAIA 4X62F 2WLKA 2Y0PA 1ZPWX 4ID5A 3CJKB 3C90A 4X64J 2B9WA 5U47A 3CEIA 3GG1A 2FUG9 5KMGB 1L3UA 3CCEV 1UVJA 4RUCA 4NA3A 3M6WA 1A6LA 3C15A 3QNWB 2X51A 3TX8A 3EVOA 4FBUA 2OCCC 1UKUA 4FXWA 3K03A 4X89A 4N76A 2WVEA 3BSOA 4X20B 3KFWX 3PJSK 4MJKA 3DHXA 1GX6A 4Q2MA 3CJRA 2LQ5A 3B8MA 1B3TA 4KHRA 1MG1A 1FXLA 3Q8SB 2L9DA 3WFVA 4JI7F 5J2TA 1YCIA 3AXMA 4RO0A 3B2EE 3KHLA 3OL6A 5KT3A 2Y1JA 1YIJV 2H4WB 3ISND 4F4KA 3L3CA 2ZE2A 4DR3F 4DR1O 4HHUA 4M5LA 1O9HA 2E5LB 4DPXA 1JMTA 5B7WA 4DV0B 3D0GE 5D4NA 5L3GA 4ZVPB 3PJXA 3J7A1 5ETTA 1V54B 4ID8A 2KM8C 1S0NA 3LH2S 3M8QA 4X4UA 1TL5A 4LSZB 3MURP 3SR2C 1VF5B 3QATA 3UD3P 1TL3B 5THWA 2IMWP 1NBEB 5B5EZ 1MLAA 3QTCA 3AQOA 4L3KA 2EVZA 1DTTB 3DU6A 1R0BG 5JJEB 2NN4A 1OY9A 1N34O 4I7ZB 3MM9A 4B9SA 3EJMA 4C4WA 1MWQA 2F66C 5LYJB 5KFBA 2W8KA 3B77A 3WX4A 1RT5B 4C11A 1JK9B 3T19A 5DDQC 2CDYA 2XS7A 2QSFA 2EJ7A 3N28A 3FB7C 1H2VZ 3W60A 1C4CA 2OIEA 4RW8B 1OV9A 2YKMB 3FMWA 4O4LA 3WIUA 3KUHA 4ERDA 4O3RA 2EK1A 3KJNB 3H1HH 2IW5A 1NO8A 1G1XB 4AL7A 3LO3A 3MAAA 4LF1A 1ULRA 2YI8A 3BDEA 4PA3A 1YITV 3UCZP 3JASA 3QT6A 4PXBA 3DKDA 4P52A 3MTJA 2CRLA 1U49A 2EWHA 3B54A 2DHGA 4F50A 4JI4B 1ZS6A 2MDAA 3W7XA 4F67A 3UWTA 1GAXA 4TU9A 4K4ZA 1IWGA 4TY9A 4OZNA 3H1JH 4OV1A 2AJQA 1HNIB 2ZBQA 2KG1A 5KFJA 2FTRA 5FNVB 1IURA 4O4GA 1RT1A 4IO1A 3D66A 2KKHA 3HHEA 1HYSB 1OCRC 2XTJP 1SIWB 4DL0C 4KC5A 2Y48A 1K44A 4KHPF 5EWGA 1AUDA 4GKJF 1VQYA 2W2QP 2W1BA 2Y69B 4DV4J 4ED7A 4X4OA 4EGLA 3BR9A 4RPFA 2E5GA 4DK1A 2VG6B 3OTOJ 1BQMA 1I3OB 5KT7A 2XT9A 4MVZA 3KG2A 3HMJG 2UUBF 2LP4A 1AYEA 4J7JA 2YICA 2ZE6A 3KJQB 3D5MA 4OYZA 1OCOC 3IR5B 2N74A 5K1PA 1OWXA 3RYFA 1QAXA 4JI1F 4HH0A 5KG6A 2EILB 1WAZA 2E44A 4USWA 1K0VA 4PG7A 5D4PA 3S1TA 4R7CA 3NRBA 5HK4A 2B5JB 2XS5A 1JNRB 2D9PA 1BT8A 4B3MF 4WTYA 3CCQV 1LUWA 2GO9A 4XPEA 4LR9A 4AE5A 1UJWB 3UKMA 2QGNA 3GLJA 1R43A 4ZVSB 3J7ZT 1N5YA 4HACA 4PAAA 3TO8A 2CPXA 5A0YA 3H0PA 2HVEA 2UXNA 3JD4A 3TAPA 2YKQA 1BHBA 3Q8YA 3MM5B 3SPCA 4PI2A 5H6QA 2VWJA 3VBBA 4ETZA 3HSDA 3PEHA 2H51B 1I94B 3U11A 2DIUA 2V50A 4TQSA 4LF8B 3DYAB 1S1TB 4Q43A 1FO1A 3HHDA 2VDHA 2YY3A 4W4KA 3I5BA 3NEKA 4X9QA 3KNAA 2I1RA 3CCSV 2WZ1A 3TZZA 2GUZB 4DL2A 3ZRWA 4YN3B 4LF5J 3EZUA 2UXBB 1MZEA 3PACA 5JJJB 4BLGA 2BACA 1XNRJ 4DV7F 4C0HA 2XNRA 2DR6A 2WPDG 2W24A 3HR0A 1YVFA 4OZ0A 1IDSA 2EX3A 3V4IB 1L8DA 1YJWS 4RUEA 3SPJA 2BQRA 3AK1A 4EKWA 2HEPA 3Q2TC 1PV0A 3RBEA 4N21A 1GAOA 2LXUA 5EK0A 2WOMB 1AP6A 2JGDB 4C0BA 4V19J 3CO9A 2HBRB 3F0NA 1FXKC 4O0NA 1COWG 5LGTA 2KT3A 4L73A 1Z2LA 1D5AA 3NGKA 3U02A 1OYEA 4OYWA 3T5LA 2VFVA 3T1CA 1IR0A 3UQ8A 2QO3A 3AG4C 5JH7A 1D3WA 2EIJC 2DCUB 3B40A 4DV3O 1QTNB 5IWAO 2W25A 1PKUA 3TARA 1LWXA 3M8PB 4NTWA 4HHJA 1RHMB 4EFBA 3ZTRA 1UVMA 1YJWV 3NGUA 1FD2A 2CUYA 4LCUC 1XOUA 1S3JA 3I82A 3JSLA 4LP8A 2V7QG 3QO8A 4J7ZA 2H8PC 4QR0A 2FY8A 2UXCF 3C14A 2N4CA 3CJ4A 1TVKB 3FFIA 2HNYA 1NEEA 3D1QA 3NGTA 4E4EA 1M90T 2DRBA 2R8JA 3CXHF 2DHAA 1NJIW 2RMLA 3G9CA 1REGX 2ZVIA 4LFBB 2QYCA 3M30B 2XZTB 4P73A 2AGPA 4DL4A 4QWAA 3BEHA 3AOAA 1FFGB 3R65A 4PXEA 1WG4A 5T7LA 1Z5WA 2YNIB 2ZDOA 4EFAC 1SC5B 3CIMA 4CYUA 5B08A 1H2SB 2UU9J 2RT3A 3L9DA 1JPXA 4NPOA 4TV8A 4BIOA 1CJVA 2UUCF 1I5YA 4J80A 4FXDA 1JIHA 4FLXA 3IP0A 3OL9A 4DPTA 3IJ4A 4U3FH 2GAGC 4UCTA 1LEOA 3UN2A 1WKLA 3S6EA 5L1JA 4F4AA 5IT9U 1XTZA 3DRXA 4ED4A 5KLVH 2BQ3A 2X6CA 1OSDA 1HWLA 4JI5O 3KHRA 4JV5O 4EWTA 5CCMA 3ZMTA 2MYFA 2E7XA 4F3QA 3D54A 4JI0F 3SV4A 4LF4B 4DDFA 1BHAA 3RAQA 4LFCF 1MZFA 5CZVA 1RKJA 4FF3A 3RYCB 4X64F 4XTTA 3UT5B 2MY8A 2CADA 2PD1A 3VAIA 1LK5A 3E8GA 1GTOA 3KK2A 1IBKO 5F8LA 2CTPA 3OT7A 3SDLA 3HZGA 4NLGA 3CGIA 2WRMA 3MEDA 2QM8A 1X4GA 2E1CA 3D6HB 1KLNA 3Q23A 3NGDA 2ZXWB 4RW7B 4K59A 4TOIA 4J91A 4EB6A 2NLWA 3DRPB 1VK8A 2K1RB 3H4DA 3E01B 4KGVB 4FLVA 3VAMA 1WNEA 1UPMB 3B8NA 3EFFK 4FFBA 4IIJA 4O2BA 1QUPA 2J0SD 5ETNA 4RW9B 2HMIB 2ZC4A 3H2VE 4WK1A 3LNNA 3UCSC 2MQ8A 4Q7AA 5LXTB 2HHHB 3RAXA 1QAJA 2DNZA 3WIVA 1K34A 3V6DB 3IS9A 2XYPB 2XB2D 4NXNJ 1U1MA 1BC6A 2RQKA 2V67A 4DR7B 1F9HA 2IM2A 2KG7B 2VQFB 2JJ4D 4OYPA 1JWWA 4LNUB 4DF4A 2MY7A 3A0HZ 4MVMA 4DO2A 1XBLA 4AHCA 3M1VA 4V19X 2DPIA 4P10A 2P4VA 1CC8A 4LH7A 1A32A 2NZ4A 2BOAA 4PUOB 3MMCB 2UVVA 3HVAA 5B0BA 4YUDA 2VG5A 4KL1A 3RB0A 4J9YB 1Q82T 1ZA1B 1B99A 3MZIA 2VG7A 3G6XA 4O4JA 2IM0A 3BM7A 1I0HA 2XULA 4YOEA 1TP7A 2DN9A 4A8OA 1NVPB 3TYTA 4BR6A 5ITZA 1WA8A 5KA5A 3IR7B 3FBBA 4DR2O 2YNFA 2HG4A 1FK9A 1O9GA 1SKWA 2EILC 2YEVA 1V55B 1VF7A 3IRXA 2IAJA 1WNSA 2IJNA 4I9QA 4OL8A 2DNMA 4KO0A 2FB5A 4G1QB 4QIVA 4CLSA 4ZA1A 3B78A 2K8GA 3K8WA 2R70A 4JYBA 1R89A 2F1FA 3H5XA 3VF0B 1OPZA 1D8ZA 4DPWA 1V6HA 2FZCB 3LTOA 2HGMA 4Y28C 3ZBHA 1TKZA 2QZ8A 3D1HA 3FAVA 1J5EJ 1RADB 1DTQB 3AJ2A 3L7OA 1FE0A 2LO1A 2R72A 4DV4F 4NZ0A 3OLBA 5AXNA 3LDDA 5J1NA 1M56C 2UXDO 1YZBA 3DOLA 4HTIA 3O65A 1S99A 1S0MA 1IBMB 2DOSA 5KFKA 2DGWA 5C42B 4NCAA 3GPAA 1ZM3A 1GKFA 3K5PA 1YBAA 3ASNB 2XAJA 2ZKOA 3C66A 1FTCA 4C8YA 3J7YI 5FDLB 2IH1C 4RBUA 1AXQA 3CCVS 4EO8A 4CM2A 2IU0A 4KGMA 3H42A 1BE4A 1ZTEA 1YJNV 4JB8B 3QPIA 4CBCA 4GO5X 3APQA 2P5VA 1AJNA 1JLFB 3I32A 1UFIA 3G82A 1N4CA 2CQGA 2GVDB 3WC0A 2OEJA 1L0LH 1WOPA 2HLUA 3OAAG 4DX5A 3D6TB 5LHGA 1FX4A 4NMXA 2ZH8A 4ES2A 1FKAF 2KH9A 4PJ0Z 4BS2A 3M8ZA 3RB4A 3PEJA 4A8KA 2PZSA 4GMKA 3HPLC 2LQ8A 2PUSA 3CCVV 2ZH1A 4BWJA 4QWBA 2EBOA 1VDHA 4LRAA 1HBNB 2MQQA 2DEJA 4A8WA 3R9LA 1JLBB 2ROGA 2B4UA 4H4KC 3W8PA 1S6OA 3CJKA 1TVRB 1BQ0A 1VQ6S 4LVNP 5AXMA 2VQEO 2ZH5A 3K5LA 5KMGA 1SETA 2GVZB 4EBCA 1GN4A 2GCFA 2W2MP 3OR1A 4R5PB 4A47A 3ZZTA 3SJBC 1XNQF 3ZMZA 3A8TA 3NNAA 2HGNA 2MW2B 4AQYJ 1U09A 1REVA 5LMNJ 2UVUA 2JC0A 3DN9A 4X20A 1TKXB 1VQ5V 3O9OA 2QEXV 2F9JA 1DJ0A 4WFXA 4MW8A 4ZOSA 1VK3A 4N8NA 3GFHA 2D74B 5DECA 3U27A 2Q6AA 4JTDB 2KFZA 2YWGA 1VQ6V 3CSKA 4GKKO 1YXBA 3OUYB 1RBAA 1SXLA 2XC9A 1N8RW 3SPHA 2IVFB 1T9YA 2XI3A 3OMNB 2L35A 3ZMUA 1LWFA 3HVTA 5D5QA 1T8EA 4TWKA 1VHIA 3DLKB 1FFSB 2ACMA 5L8RC 2FYUH 1SJQA 3I5DA 2H3EB 4AXIA 1R3LC 3JALA 4Q20A 5F8MA 1TL3A 1U1LA 4C3KA 2FJDB 4UOCA 3RR7A 5H9FJ 4UT4A 3D1OA 2ZDIA 2CNNB 1DTTA 1HW8A 4H4OB 2GX8A 1KD1W 1ZZFA 4H0LB 5LYJA 3HO1A 2NR0A 1N34B 1PYTA 4Z2XA 1E6VB 2KT5A 4DUZO 1RWVB 1RXOB 3BGUA 4RW8A 2YKMA 3I4PA 4ZP6A 2DWEC 2HS3A 4P2FA 4P75A 3ZZOA 1OS5A 2PDAA 2O57A 4YHHB 2W2NP 2HHXA 2UU9F 2DGSA 3M9OB 3QO9A 1G1XA 4K2JA 4E2FB 2F8EX 5A8KA 2AU0A 3TWZA 2O01C 5A8WA 1N5VA 1Q4RA 3CW2C 2GHPA 3RGBA 3FEYB 2MKSA 1MN9A 2I9SA 1T11A 3V81A 1FYJA 2ZBCA 3L7PA 1VQ9V 1ZSPA 4J9OA 2VA2A 2R7TA 4JTCB 3AK3A 4WFAV 3TQEA 4AYBD 1X9SA 4QQBA 3TK1A 5DS7A 1W0KG 5FNVA 2KHDA 2AV5A 2LQJA 3KKYA 1HD1A 2DQ3A 3VCDA 1HYSA 3AG3C 3Q86A 4DLGA 3DM2B 3PW5A 3X1LB 2IRUA 1R0CB 1R6VA 1U25A 1RSCA 3KJVA 1CS4B 2DEIA 1KBRA 3BRCA 1N56A 2VFTA 3QGGA 2VH7A 2EFGA 3PYGA 1SL1A 2VG6A 1QUVA 2YSUB 3NCQA 3AG7A 2Q67A 1T02A 3FRYA 4ZP7A 2B6AB 2ILMA 3A8JA 3LALA 3CO0P 2B5UA 3IAM9 3M32B 2Z56B 2PE8A 3RW0A 1FCAA 2BM1A 3LSSA 1RQ0A 3MM8A 2ARHA 1TZ0A 4KV8B 2VJVA 3TXSA 3G6VA 4OJ1A 3D7SB 5CH7B 4WXOA 4BIZA 4BCAA 2JEIA 3LANA 5B3SC 4DSKA 4NTYA 3LGHA 3W5ZA 5C5JA 1K73T 5IT9Y 3CDAA 1C1BB 2CTQA 4WFEA 3MOJB 4RNOA 3GZ7A 3N4WA 3M8AA 4K0KJ 1SQFA 1CJKA 3QGPA 1SL0A 3F73A 5H9FK 4DLEA 2LW1A 3NGRA 1U4BA 3MAHA 4QIWF 5IJ9A 4DV1O 4YIPA 1E6YB 4JI6O 4NXNF 2GQQA 2O3DA 3DYAA 3B4SA 1S1TA 1KS2A 3HHLB 2JS5A 1V55C 4G28B 3ASOC 5D77A 1Y76B 2KG0A 2Q7GA 2AF6A 5HATA 4X4NA 4M5KA 4DZ6A 4B3RJ 1G6BA 1HBUA 5BR8B 2AJ0A 4WFZA 1N4LA 2PMHA 3JARB 2FHMA 3HI9A 2MMYA 5C25A 2X0LA 3PYFA 2IHR1 1EKSA 2WHOA 4GVLA 3O8WA 1RT2B 1YJUA 3CCLS 5KG1A 4MVQA 2VF3A 2DGUA 1BWVA 1OJ4A 1WEXA 4HZ3A 2J6SA 3K06A 3T2MA 1P1LA 5KFEA 2ZQMA 3E8OA 5F3ZA 4UW2A 1D09B 1UVKA 4Z37A 3DRRB 3GFYA 2Q0AA 4X66F 2WOMA 1XREA 3HFZB 2JGDA 1KKCA 1FD8A 1GX5A 1S6UA 2LMIA 2VL1A 3FUYA 3FSXA 2CUGA 4N56A 2IU3A 2FVSA 5FPOA 2J8SA 1KQKA 5AE2A 2QG9B 1WPBA 2C3MA 5FD1A 3CJ8A 1K3EA 4MTPA 3OGCC 3M8YA 2CQHA 1ZLZA 1H8HG 2KYXA 2CJQA 1NKDA 3M8PA 1IM6A 3CCLV 2E1PA 4DV3B 3R7BB 5IJ0B 3I6PA 5GADU 2V1DA 2VB6A 2L41A 3ZTOA 4IGGA 2LKZA 2F7VA 1TVKA 5EIBC 2RU3A 3KLIB 4PHZA 2GQCA 4GKJO 3M30A 4IRKA 4M63A 4GX5A 4U3JA 2YIAA 4J9QA 2OPQB 3M7VA 3R2DJ 1XHXA 5M2PA 3MPVA 1SB6A 5IM0A 4F4ZA 5JCOC 1X7VA 1YX2A 1V3ZA 1WD6A 3EUNA 3TW0A 1DBDA 3BJYA 3ETEA 4N77A 2ASYA 2OJ3A 3TZWA 3PW7A 2E29A 2ROPA 1QY7A 2K3IA 2PYJA 4F6RB 3CRQA 4W98A 1JX4A 4GYCB 3IG1B 4AD6A 5D8HB 1NH2B 4DR6J 2MB0B 2L3MA 3GSIA 2FMLA 1RKIA 1NH7A 2BV3A 2H94A 4LRFA 1PNMA 4O3PA 3J7AU 2WA4A 4P2ZA 3TVZA 4FZ1A 4P2MA 2CWKA 2AJ1A 5ADZA 5E79Z 4NMLA 5CA3A 1HKAA 1U8SA 2N05A 3M99B 3SMZA 2Z0AA 3RT3C 4K2XA 1MROA 4JI5B 3ZXWA 1F7YA 4JV5B 4CH6A 4RUFA 2HAFA 4NLDA 5KFMA 4FMTA 1YZ6A 3MD1A 5LXYA 3KG1A 1UCNA 4WP8A 4Y2IA 4DR4F 3GE9A 3RYCA 3K58A 3NGSA 4YB5A 3UT5A 3TUJC 2Q43A 4I69A 1VQKS 5GMDA 4C8KA 1VC0A 4EO6A 1FA0A 4C9DA 1F5CA 2BTQB 1IBKB 3ZN0A 1K9MW 4ZPCA 7FDRA 4AQYF 3A13A 1B7FA 2YX1A 1FI4A 4RW7A 2C1EB 5LMNF 3ISNC 1ZUQA 2DGVA 3OHAA 2N04A 1LWEB 2WVDA 3T4DA 4BC7A 2K1RA 1SPBP 2DYSC 1ZPVA 3E01A 2CFXA 5RUBA 1WOOA 2BOCC 2VASA 1P6TA 2CTWA 1R6TA 3X2QC 4RW9A 5KFXA 3GV5B 1AI7A 2KFYA 5LXTA 5EC1C 3GJSB 5FJ4A 1KU9A 3HCXA 2ZD9A 3V6DA 1RAEB 2R9IA 4I9WA 1RTDB 3G86A 4X4RA 8RUCA 1T3NA 1X5PA 5C2GA 2XMKA 4M5MA 1N5TA 4I0WA 4N8OA 2YQ1A 3UO0A 1XDCA 4DR5F 2KG7A 2EBEA 3VQYA 4QW8A 2ZZNA 1DLBA 4LNUA 4QIFA 1BS3A 2BE9B 5HFMA 2MZTA 4NA2A 1TKDA 3OMIB 3ETGA 4HAMA 1YK9A 3GYXB 1QQCA 1CJTA 1RHUB 2ZUGA 3ULHA 4NRUA 1DZ5A 1KUQA 3MMCA 5L9XA 4UVCA 5BYRA 4W4LA 2IJIA 2V8VA 1NCLA 4WXWA 3OEHG 1GXTA 4FZ0A 5TISZ 2G4BA 5I3QA 3ITHA 4MYTA 1N6QB 1S49A 3JAWB 2VBXA 1TK0A 2HLDG 3R6GB 2LFRA 3DDIA 4UZCA 2QWPB 4LFAF 4DR2B 1X8DA 1WG1A 2HQDA 3WQPA 1P49A 1TUGB 3SEOA 1KOHA 2C3UA 2DJVA 3WHIA 2KXHA 4DV6F 1UJ6A 5AE1A 3CWJA 4DMZA 1DARA 4B9TA 4G1QA 2VBWA 2R9LA 3TUIC 4JUZA 2DXEA 3B82A 5KHJA 1QLEC 3MUTP 5JWPA 4ICLA 5KT6A 1UW9A 1NBMG 3QYYA 3TJTA 1FEEA 1RT4A 2HK3A 2CPYA 3ZHUA 1DTQA 4HH1A 1MSDA 5A8RB 5IV4A 2X6AA 1BUXA 2FD2A 4F0MA 2ATCB 3OD4A 1FRIA 2IJHA 2VS0A 4R50A 2ASDA 4ZPBA 4LFCO 1QHTA 3UD4P 4AL5A 2HGLA 2UXDB 4OJGA 2J5AA 2MQLA 3RWRD 1Q6IA 2HNZB 4X64O 2FKXA 2E5HA 4WZQA 2DH9A 1H2MA 2Z2LA 3A2FA 3QMQA 1EX8A 2X3DA 2MLXA 3CHXA 3PY8A 4UVAA 4PG5A 4FS1A 2HQCA 1XQ8A 2CXEA 2COLA 1HP8A 3BVOA 5D5PA 1U8WA 1EAYC 4ZVGA 1JLFA 4YY3O 4B3TO 2P22C 3BYPA 4OZ1A 2GVDA 5CA1A 1SC3B 4TU7A 4K0KF 4LF6J 3I56S 3QLHB 2ATKC 1RUSA 2YH0A 1LFPA 2WSFC 4ZVFA 5CYJA 5KFPA 3DOMB 2RN9A 4ILRA 5E7OB 4UV9A 1ZOTA 2EJRA 1FRMA 1VQPS 3AG2B 4IYQA 2OYQA 1V9OA 1NHUA 3Q4HB 1T03B 4I67A 3PVXA 1YJTA 2VPZB 4B3RF 2EINB 3Q24A 1HBNA 4KYZA 1F3VA 1VRUA 1NB7A 2V68A 2NSBA 2PEBA 1JLBA 2V94A 2VZ9A 1UAWA 5CN0A 2QSAA 1TVRA 4NX9A 1Q95G 4WJBA 4YB7A 3TJAA 3PXGa 4DUYF 2ZKUA 2GV9A 4XO0A 5B1BB 5LHIA 2GVZA 2KVIA 3I56V 1RM1B 2VQEB 4TVAB 4WPAA 4ANDA 4CO1A 2J76E 4CI0B 1H74A 3M2RB 3AT1B 4WKRA 4QPJA 4LR3A 4HVZA 4PA4A 4N41A 1S5JA 3JD1A 1BL8A 1VF6A 3WZ0A 1Z4UA 1HR0J 1S5HC 3FJ2A 3KK1B 2FJEB 1G4CA 2CQ4A 1TKXA 5CZXA 3CC4S 2QLXA 4R8UB 2KQXA 5KG2A 2BMBA 1OYDA 3Q8PB 1EBOA 1GXLA 3RYIA 3UPFA 4HNAA 1S4EA 3O2IA 1MNGA 3MM7B 3OSPA 3CD7A 3OUYA 3I0RB 4MTFA 1JXLA 3DHWC 2ZM6J 2EKNA 2V2ZA 4Q8FA 3CD5A 3CDWA 1VHFA 4GKKB 2HVHA 1FNXH 2RRNA 2KU7A 2MZRA 2MJNA 1QR9A 3DLKA 4CO3A 3TXQA 1BGYH 4PABA 2N3OA 1VQ7S 1SQBH 2C2DA 2W4DA 1H7WA 2OELA 2WSSG 4FLUA 2UUAJ 3I9V9 5AG2A 4USTA 3PFOA 3WB0A 3GONA 2Y8YA 2HG5C 2NPIA 3O6QA 4H4OA 1JLCB 4PYDA 1NMEB 4USJC 3ZZ0A 1XL6A 4DV4O 2P06A 4ZP9A 3SYOA 2XSJB 3KTQA 1YBTA 5HVGA 4Y2CA 3OTOO 4NCGA 2WONB 5J2NB 1C0UB 2DR7A 1PC4A 5KTQA 4UV8A 4PCQA 4ECWA 3ZRSA 1HNXJ 4NYKA 1N33O 2R9AA 4DUZB 3IBFB 3PIOQ 2G0IA 4J9NA 2BKPA 5IV3A 2CNLB 4ED1A 1U7LA 5KFRA 3NMAA 2WAMA 3ENQA 4EI2A 5GONB 3P4UB 4ECUA 3CD0A 2QKCA 3MI7X 3BFRA 4DR6F 4ASUG 4WCEQ 2Z8QA 4YR0A 2QLBB 4PKDB 3H5UA 5I3UB 4QPTA 2AZ2A 2DXFA 1LFWA 1EP4B 4X4QA 5FLXU 3CC2S 4QR1A 2HIYA 3HT3A 2DH7A 5K8MA 4YJ3B 3OSNA 1CULB 4DYLA 2DRAA 2F4VJ 3DM2A 4Q2LA 2YNHB 3D0IE 2PGCA 2NREA 3M7MX 4N7TA 3PRDA 4OHVA 3PIPQ 1LR1A 2B7BB 3M6XA 4CH0S 3Q89A 5KFQA 4IOCQ 5HFLA 2M2BA 2EC0A 1JQ0A 2C28A 2EZOA 2MXYA 4M5DB 2QMXA 2MQMA 4UOGA 1I94J 2G0CA 1FXVA 2B6AA 4EK2A 1SKUB 2V8DA 3SZ2A 4LF5O 2ZIOA 4WFHA 5H2FZ 1XNRO 5DM6Q 4OZLA 4OZ3A 2FLPA 3MR2A 2QFIA 2F1MA 4NXMJ 2Y0SD 4ZP8A 3IRWP 1RT7B 1PILA 4QYZJ 5EBMC 2VIHA 3W65A 4FKXA 2ZH7A 4OX6A 4JYAF 1V5IB 1RPRA 2OTJV 1X0PA 1SA0B 2W6JG 1I6JA 3ENAA 1HNVB 3VQSA 2BW2A 3C3SA 3ICLA 4WZMA 4X65J 1SKRA 4M8LA 2XOKG 3BAAA 1M5OC 2FJXA 2Y1LB 1U2RA 2AX1A 1IKYB 2W01A 4PG6A 1DAXA 2P9EA 3PRVA 3ETOA 1B0TA 3HHLA 1JLGB 3T3FA 1QVGU 4OI3A 4DV1B 1Y76A 3OE7G 2QRRA 5KG0A 4FNHA 1YKWA 4FYXB 2FIUA 4ZPDA 5HROA 1FD9A 3AOCA 3P5TL 3OT9A 4PEOA 4USMA 3SQGB 1TA8A 4PWDA 1JLEA 2YBVA 1RYSA 2OFHX 1OO0B 2A18A 2E1RA 1Q78A 3VHQA 3OUSA 4N5SA 4MSWC 1D9AA 1K97A 4KSEB 2HSEB 2FLNA 4ZLPA 3VVUA 4DXLA 2QSWA 4IOAQ 4UUXA 4PA9A 4CLTA 4I5SA 4ZHRB 4JV2A 2NZCA 4WFFA 1V3SA 3P49B 4USKA 3DRRA 1K92A 3ET6B 2PYLA 3Q8UA 1GH6A 2DNGA 1RAIB 3EZ5A 1NSAA 3CYOA 1EM1A 2F8HA 1X4BA 1PKXA 4DQRA 4RBVA 3B09A 2XO6A 4JI2J 1PNKA 2B9ZA 5JUMA 2HPUA 1YZ7A 5J2UB 4O2AB 2AW0A 3I0SB 3FYIB 3E83A 4QW9A 1VQOV 1NJIT 1WN7A 1SKVA 4IRDA 4LRBA 2K7KA 3L9ZA 5JQGB 4ED5A 3PX6A 1W25A 1IR2A 5DM6V 3ZNUA 2HRTA 8ATCB 1SH2A 2DHSA 4O44B 5IJ0A 4UCSA 1FTRA 3CJSA 4Z1VA 2HFNA 4DG1A 2KT2A 3MUMP 3M8SA 5EGYA 4IFVB 2O5DA 2NXNA 3R5JB 1NJXA 1WF1A 4DCPB 2XLJA 3KLIA 1Q5YA 1L1FA 1C4AA 1S1UB 3AG2C 3KOAA 1N32J 2OWOA 1PBUA 4QYZK 2MSTA 3MEEA 4GKJB 4TLQA 1FJGJ 1A7GE 2OPQA 1QJHA 4ECRA 3BB5A 4FN5A 2E5LO 2AYEA 1TU0B 4F7VA 4EYIB 3D67A 5CYQB 3QO7A 1JCHA 1NJYA 3OBIA 3TNVA 3A4TA 5F41A 1VQNV 4UY85 3CXCU 1BHNA 4YFUA 2YPZA 1B6QA 3DLEB 1J95A 5IC6B 3MMBB 2DGTA 3FEXB 1VS3A 3IG1A 1Q0NA 4QIWD 2IM1A 3TETA 2KDOA 3ADAC 3Q8VA 1UA1A 2J7WA 2OD4A 2CGNA 1Q8BA 2JJ1G 2DNNA 1VQMS 1U47A 2BSKB 2C42A 3ABLC 2A6OA 2VFRA 1ZM9A 3ZHTA 3BSAA 1YRTA 2JK5C 3HF5A 1EN6A 1GXUA 4OYBA 5D0EA 1U0HB 3K5OA 1KBHA 3SXLA 1SBRA 4HT5A 1PO6A 3QIDA 4K4VA 1E1QG 3ENVA 4ZPVR 2HURA 2WLMA 4OI6A 1JJ2U 1T9TA 3OFHA 5DM7Q 4DWIA 3CCWA 2W4CA 2YKPA 3NOGA 3AB4B 3FCHA 1UVNA 1FX2A 1KLMB 4Z7YA 1X5OA 2BTQA 2YDEA 2UZAA 2ZITA 2DJWA 4DN0A 4G2KA 3N2KB 4DZDA 2WVFA 4MMOA 4FF2A 4NYOA 2Z2YB 1P9QC 1VQMV 4PA7A 2ZEJA 1HR0F 2OKQA 1WELA 2J7KA 4BIUA 3F56A 1GMWD 1LWEA 1Y5NB 5KFWA 3Q8RB 1U45A 1QM9A 3M2VB 4OLOA 5CBFA 1I08A 3PV8A 4WFGA 2A0FB 2HFEC 2LGQA 3DFEA 5AJ3J 3UVJB 2D3O1 1S48A 3CRCA 2KJWA 2DPJA 2ZBPA 4O0IA 3VTIA 2OTLV 2CJAA 4DCJB 3K79A 3UE2A 2PI5A 2ZM6F 4ZKIA 2XCAA 1RWNB 1GT8A 4K7QA 1XEZA 2UVRA 2HVIA 4D7TA 1R8HA 1WHYA 3G6EV 4ED6A 3ETMA 2XHBA 1NK5A 5C2CA 2P9GA 3FDSA 1A0OB 1URFA 3RRGA 2RD5C 2JEUA 2W7PA 4U7NA 3CCUS 5HJXA 4JI4F 5B1AC 1Y4MA 4J11A 5DETA 1ZYQA 3T9ZA 1CG2A 2OI2A 3N5FA 4GVBB 2E1AA 4J41A 5DGAA 2J6TA 3DI6B 2V4RA 1B64A 1H8EG 2HRUA 5E5NA 1J5EO 1AT1B 2L08A 5B0AA 4JI3J 1XIQA 3H1KH 2JIZG 2KSDA 4FPIA 5KFSA 4B3OB 1Y67A 2DYRC 2UXCB 1ICEB 1YTYA 1KFDA 2A06H 3A12A 3I4HX 5FIIA 1HNXF 3QAEA 1IZ3A 5KAFZ 2FLOA 3SIPB 1OZ0A 3QNEA 2C2NA 2X6BA 3J81U 5H1SV 1CBKA 2XMWA 4AL6A 3BO4A 1TFYA 1SQEA 2VFUA 3HLUA 4RO2A 3KKFA 4K4SA 5J2MB 3OVBA 4FLWA 4OGQB 3MD3A 5D4LA 3QGHA 1RWXB 1SQPH 2HNDA 5LP6A 4KP4A 2JWNA 5L3FA 4X62J 3D6MB 2UUCB 4Y3CA 1LXNA 2F4VF 3MXHP 3ETDA 2RE1A 4GX0A 3DLGA 1XK8A 2NLJC 3G4SS 4CH4A 4ZS6A 1EZJA 3D8CA 4U8YA 1D8YA 1FRHA 5H6RA 5HL7Q 4ZPWR 1RLCL 2DHHA 2IJFA 1DURA 2SXLA 3C2PA 4LF7J 5HN0A 1IUJA 4O3NA 2EKYA 1KWMA 1I94F 4FNIA 1WWHA 2CE4A 2DNPA 4MTGA 4ZVQB 1NXIA 4DV2J 3JSBA 4OX8A 3PO5A 1RTIB 2BR0A 1O8BA 1U26A 1Q8LA 4LFCB 3MPWA 4WP9A 2J9DE 4JI7J 3CCMV 5GW7A 3CJ2A 2DNKA 5DG9A 1R6YA 1PL0A 4X64B 2EEYA 3A8KA 3CT9A 3RUBL 4DR3J 4J9RA 4K4YA 2OAUA 3JS9A 2QWNB 4AQYO 1XMQJ 1RWPB 4ETXA 3BKUA 3VQXA 2V4JB 1UEKA 2Q79A 1YSCA 2Q6BA 2FPHX 2APOA 2V2KA 5EYPA 3PNIA 3BA9A 5FLXY 5D6GA 4R6ZA 4YY3B 3FCWA 3QLHA 2MLYA 4KGZB 4ZLLA 4TQFA 1R3JC 4X65F 3NNCA 1HI0P 1KYOF 2OCCB 3F5WC 2ZC3A 1H2NA 1YEWA 4F4YA 2NUHA 3R7NB 4U96A 2JS3A 3RRKA 3K2YA 1LWCA 2A3QA 1Y74A 5D0GA 3OD2A 4ECZA 4H4MB 4O4IA 4RUAA 4TT3G 3Q4HA 1T03A 1PCAA 1RWKB 1EQMA 3OTBA 2JEFA 3IWLA 5DGBA 3JTPA 1LUVA 5B09A 4EEYA 4QJFB 1WC6A 2IC3B 3BS9A 3MPUB 4ED0A 2ERRA 3B8HA 2W0FC 3DRSB 5K20B 3A3NB 2E7VA 3PRBA 5I3PA 3FBEA 4O3OA 4GO7X 2O66A 4B9NA 2R3VA 2YWFA 4DR1J 2HVZA 3N2GA 4USIA 2CPEA 4IG3A 1KMIZ 1BY9A 1VMGA 5HLFB 4PR6A 1EETB 4PRFA 5HVFA 5HANA 1TK5A 5HP1B 3N5BA 5DG8A 2CQCA 1V9PA 4IH5A 3D36C 1N8RT 3DU5A 2FB0A 4QIEA 2KN4A 2IBOA 4J9LA 2QWRB 5HMWA 1HPZB 1LK7A 1PSDA 4OYXA 4R8UA 2AEJA 2BE3A 4OI4A 3CC7S 2KXFA 2RKIB 3OEEG 1PC5A 4JI2F 4I56A 4ZMMA 3E51A 2OEMA 1OCCC 2RDJA 1YTFD 4KHPJ 1NZ8A 3IBWA 4OZ5A 2AEMA 4DSFA 3QIPB 4CC6A 1EN5A 4FYYB 3I0RA 1KD1T 4MTXA 3F7VC 4PG8A 2AHYA 2QC3A 2CK3G 3GIRA 4JAVA 5HQLA 1T9XA 4MTOA 3R7SB 2YWKA 2XNQA 2UUBJ 1SVDA 3P45B 3FNNA 1NK8A 3G71S 2UXXA 3H01A 1Y4ZB 4JI1J 4LREA 1UFKA 2YNGB 1NHVA 2Z58B 1EJ7L 3FMBA 2W4PA 2DNRA 1Z2ZA 1S9EB 2HYIB 2Y3YA 3K0JA 2EFPA 4ZHQB 2RNEA 6FD1A 1U1OA 3HKEB 1Z1ZA 4WFNQ 1OCRB 2HHHO 2WONA 5J2NA 4DV4B 4H13B 1M0SA 4CLYA 1C0UA 4LF9J 3TCUA 5J2PB 2EFOA 4NLOA 3OTOB 2D3OW 1GEHA 3L75H 2XMUA 4MK7A 5CQGA 4A4JA 2V5HG 1NSQA 3BGRB 3OJSA 1BXNA 2B51A 4PWUA 1KQGB 1NU4A 4LT6A 5ETSA 3CJQA 1WTBA 2HFSA 2V9KA 1R3NA 2VQFO 1OCOB 1RWMB 1XC9A 1KOOA 1KKDA 5LA6A 1X9WA 1PYSB 4WFBQ 1UJ5A 2WB1D 5KFLA 1TL1B 2ZWOA 4ZCLA 1RWOB 2ZJPQ 5IYZA 3W66A 1EP4A 3CMAV 5IY5C 4LR7A 4K0KO 3W7BA 4YJ3A 3W1YC 3C6TA 4DV7J 3BO3A 1CULA 1HHSA 1X4DA 3VAJA 1JFFB 1CC7A 4DFMA 1S5ZA 3W2WB 2HQIA 3U1MA 4Q0BB 3NR7A 3ZMVA 1KVJA 1KC8W 2PO4A 4MKVA 1S97A 2X1BA 4BBYA 3L4BC 2GSMB 3LUTB 3UFCX 5CABA 4HEA9 1NK4A 1XMOJ 4J37A 4M5HA 3NG8A 4I7FB 4YXWG 2WVCA 1YRXA 2DY1A 4CTAA 2HKEA 4DR7F 1RYRA 4MIWA 3SGIA 4IOBA 3IN5A 1VYAA 4MVUA 2F8MA 1JVMA 1X4CA 4LF5B 3WB1A 2PF4E 3H2LA 2MGZB 3L95X 3LA0A 1R8AA 1XNRB 5BY1A 2ZDPA 1YG0A 3CJ5A 4CS2A 1FE4A 4QE7A 1ZL8B 2WLHA 3UO2A 2CAZC 1HL6A 1RAOA 5E2QA 4EEQA 4QIGA 1C1CB 1N54B 2CJ9A 3R1LA 1N36J 1SA0A 4XDCA 2GHWA 3VQVA 4F0KA 5KOWA 1HNVA 4P7VA 5F0UA 2XAHA 3RYHB 3H1LH 1FKOB 2KO1A 5E3CA 1HWUA 1PPJH 4C7UA 3K04A 1NNDA 3HULA 1PNLA 1IKVA 1ORQC 2RUGA 4HI2A 1V3RA 1KSPA 3IWXA 1YI2S 1M5PC 4QWCA 1BMFG 1IBCB 2YQ3A 4ZKAA 4IYIA 4TY8B 5L38A 3H1IH 1JLGA 2BJ1A 1FXKB 3CB4A 4F25A 3EPIA 1JB0C 4HHHA 3D4JA 1WKJA 2KVQE 1U6ZA 4DL7A 5K8PA 1N0VC 2OPSB 2E9RX 4UUJC 2HAIA 3J7AN 3BGOP 4J9VA 3AG4B 2ZVSA 1LW0B 5DQHA 1WUUA 2EIJB 5KUMA 4IHJB 3ICXA 4WFBV 1PL4A 3DLJA 5E41A 5IWAJ 5IZHA 3KHHA 5DZ7A 2IM9A 3OR2B 3W2VA 4U8VA 2R2RA 1QU7A 4YJ2B 1VRTB 1IM4A 1WORA 9RUBA 2YXHA 1SQXH 4LSLB 4LQ9A 3CCES 2WK4A 3DDKA 4RU2A 2ZINA 1P8GA 1LXJA 5KFVA 3LDEA 1BSMA 3X3UA 4HKQA 2M8HA 1RTHA 3ET6A 4WIQA 1CXZB 2ZH9A 1IBMF 5BMVA 1NTZH 3M2UB 1ZWIC 4NLWA 3E22B 1SIZA 5DDRC 1AW0A 2A2DA 2BJEA 2JRSA 3R5GA 4O2AA 3V6JA 4JI0J 1DK1A 5L9NA 2GTAA 1P7GA 2UU9B 4DSEA 4F4LA 1YIJS 4RLEA 2GMHA 4LSNB 2QL5B 2AJFE 2EW9A 2V34A 3UW1A 4DL5A 3U1NA 2BJ9A 4O44A 2CYYA 1XBWA 3UN3A 3D3IA 1HBOA 2WLNA 5K8NA 3OLAA 3H8YA 4IFVA 1WF0A 1Q1KA 4LF7F 4KB7A 4YQWA 4X2BA 3MOZA 2AX0A 2VJUA 3GR0A 4HI1A 4NLQA 4CQ1A 1BLUA 2FVCA 2QJ3A 1S1UA 1ZM4A 4DV2F 3TJ8A 4MAKA 4ZI7A 2I38A 3AFGA 3L71H 3SCJE 1DQ9A 3J81Y 4DQSA 2BOPA 2V9WA 4TNOA 5HQMA 4I2PB 4CC5A 2D69A 2EI5A 4TV9B 3BY6A 3OFEA 3T1HJ 4J42A 5CD4A 5CYQA 2QTWA 2ZNIA 1XMQF 2LW7A 3P5BP 1WB7A 1K7DA 3R97A 3W7TA 3OUFA 1Q6UA 1UFWA 3DLEA 4OX9O 2FHOB 3LF0A 4V1Ak 1UW4A 1YITS 4F6EA 2CJXB 3J81j 1OHHG 5A9GA 1U0SA 2XI2A 5L1KA 1YJRA 4H33A 3SI8A 1IKXB 4CT9A 4KGXB 1T9UA 4DX6A 1JNZB 3LP2A 2Y1IA 4DL3A 3PX0A 4CLZA 1M1GA 2Y0IA 4N47A 4ZVHA 1K9MT 3H7HB 1AB8A 2L6LA 5B0GA 2HVDA 1S9GB 2W2OP 4X84A 3G96A 1AI4A 4CLPA 2WLLB 5D15A 1H2LA 1BQNB 2ADBA 2Q5ZA 4YHHO 2WLIB 2G13A 2K3KA 1ZTTA 3GIJA 1HD0A 2Z57B 4DR1F 1CPYA 4B9MA 4RQFA 3GB7C 3HKZD 2EBGA 3JAMY 2D3ZA 4QPKA 4L8JA 4K4WA 3F44A 2F4FA 2XEXA 3VV2B 2QKAA 2PN6A 2BTOA 4TYBA 4KPCA 4NKGB 3E8HA 3BABA 4I6WA 2IBZH 2BM0A 3DOKA 3NAIA 3THPA 1SJFA 5CXTA 3T6BA 3LP1B 1HQEB 3BV8A 2U2FA 3M2VA 1HNZJ 4F4WA 1N34F 3UVJA 4OI0A 3KMSA 3CCQS 5KT4A 2XHWA 2XAGA 1RISA 1NRKA 2QE5A 3CP1A 4FM1A 3KXDA 4UFZA 1K5QA 1R6KA 3R8YA 2O1PA 2JFKA 2BXJA 1RA7A 2HBZB 2Y4TA 2OPPB 2YIDA 3GYGA 4WWSA 4I64A 3TJ9A 5LP6C 2V2QA 2VDIA 3R27A 1R8PA 3RJMB 2ZR2A 4DBQA 3RGIA 3DGPA 3AQPA 4XPCA 3THVA 3HHNB 1WC1A 3C16B 4GVBA 4IQMA 2F3JA 3DI6A 1UETA 3E86A 3CCSS 1KB9F 4CH7A 5CCLA 2AYGA 1J5EB 1WJ9A 3OPKA 4B3OA 3QJPA 4LF9F 5K8OA 5F9LA 4F8RA 3IGAC 2QA4V 5KA6A 2LEAA 2Z5UA 3ZHQA 5IXUA 2EIMC 2WA3A 4PDMA 4ZCIA 1WB8A 1K33A 4FXVA 3BBFA 5BXZA 1M56B 1QSSA 1F4NA 3FRZA 2P6JA 2IA0A 5ETQA 2XWXA 5BR8O 4ZK7M 1W26A 2DISA 5MAOA 3CCRS 1XILA 5F8JA 1T0TV 1H2GA 1KP6A 4IO9Q 4LF6O 1IJFB 3C15B 1VBKA 2PFDA 3JYTB 2LEBA 4IR9A 1O51A 4H44B 3I55V 4NVPA 2OMOA 1XNQJ 3ZZRA 1AP5A 1ENVA 1T3OA 3UDVA 2FLLA 1SCJB 3THTA 1HBMB 1IQZA 2DD8S 1RT3A 4A5UB 4FJCC 1XMOF 4Q44A 5CA0B 3G8TA 5J2TB 2XGQA 4ER8A 2QL7B 2ZHAA 1UZDA 3CCRV 2ZE2B 3KG0A 1MABG 2EG2A 4I0XB 5DQGA 1VQ8S 1F6TA 3ZJZA