2RJZA

Crystal structure of the type 4 fimbrial biogenesis protein pilo from pseudomonas aeruginosa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
SLKQQFSTKAFQAANLEAYKAQMKEMEESFGALLRQLPSDTEVPGLLEDITRTGLGSGLEFEEIKLLPEVAQQFYIELPIQISVVGGYHDLATFVSGVSSLPRIVTLHDFEIKPVAPGSTSKLRMSILAKTYRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Periplasmic domains of Pseudomonas aeruginosa PilN and PilO form a stable heterodimeric complex.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords PilO protein
total genus 40
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2rjzA01
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rjzA02
4B3SF 4X62F 4DV0F 2YIAA 4DV6F 4DV7F 3VQXA 2E5LF 4CS3A 1HNZF 4B3MF 4JI1F 1N36F 2F4VF 1HNWF 2BVZA 1O9GA 2YI9A 4DV2F 2KJWA 4JI0F 1VMBA 2UUAF 1IJFB 4ZIBA 4AQYF 4JYAF 2JVDA 4DR5F 4JI3F 3VQYA 1FKAF 4JV5F 2KJVA 2BXJA 4DR2F 2UXDF 4LF9F 4DUZF 1N33F 1O9HA 4JI8F 2PGGA 1GH8A 2E3CA 4OX9F 1CQNA 2R70A 4TQDA 1F60B 1LOUA 2UU9F 4CH6A 2ZCEA 4LF4F 4JI6F 4JI4F 5LMUF 1FJGF 2VQEF 2RJZA 3BHPA 2YY3A 4YHHF 2R72A 4DV5F 4DR1F 1G1XA 1CQMA 4CH3A 2ZM6F 3VQVA 4BWAA 3DSQA 4LF5F 1J5EF 4LFCF 4DV1F 3T1HF 4LFAF 4NXMF 4K0KF 4X65F 4LF6F 4JI2F 5BR8F 2B7BB 2YI8A 3T1YF 1B64A 4CS2A 2PUSA 2HHHF 3ZZPA 5AJ3F 3VQWA 4B3TF 2UUCF 4DR4F 5K1PA 4BW9A 4YY3F 2RQ6A 4JI5F 4DR7F 1N32F 4CH4A 4DV3F 2YIBA 2ZIMA 2UUBF 1G7CB 4CS4A 2ZNJA 1IBKF 2J5AA 1IBMF 5IWAF 4GKJF 4GKKF 4X66F 4DV4F 4DR3F 1HNXF 1XMOF 3ZEDA 4X64F 3OTOF 2B7CB 1XMQF 4JI7F 2ZINA 1G6UA 2UXCF 1IBLF 1QJHA 4NXNF 2ZNIA 3R3TA 1I94F 2UXBF 4CH5A 1HR0F 2HEPA 4LFBF 4LF7F 2Q7GA 2YIBD 5LMNF 4LF8F 1XNQF 1IJEB 2ZIOA 4DUYF 2VQFF 2Q7HA 2QJ1A 4Q6GA 2Q7EA 4B3RF 4DR6F 1XNRF 4KHPF 3QTCA 4TQFA 1N34F 1RISA 5K1XA
chains in the Genus database with same CATH superfamily
2VWKA 1QHTA 2DXDA 2V4QA 4LF4O 1CJVB 3D2WA 3A8JA 1H8HG 3DXSX 4MTGA 5HL7Q 2BE3A 5KTQA 4MVOA 1S6OA 3EVMA 3FSIA 1S6PA 2CQBA 4X4NA 4LIRA 4QR1A 4X4VA 4JTDB 1Y66A 1L3TA 4IYIA 1SV5A 2HVIA 3W2VA 5E3QA 1GMVA 3HLUA 5LSLA 3AA9A 1S77D 4QPXA 5EC1C 5JH7B 2IJJA 1RPRA 3U0ZA 3UM7A 2QKCA 1S10A 2WW4A 1R8BA 4RPFA 3T1HB 1WA8B 3I4HX 1WDDA 1P84F 1Q6HA 2VUGA 3ETOA 2L35A 4RBUA 3J7YU 5FJ4A 3PJWA 3JTPA 3OR6C 2HBYB 3PACA 2VPZB 3M6UA 2PMZD 2OJ3A 4LRCA 5KUKA 2LQJA 1KLNA 3LUYA 3GCXP 1ZZFA 2CJBA 3C16B 4I1TA 3M2RA 3DXRB 4UTGA 2ZBQA 2DQ0A 3Q8YA 4NMXA 2QM4A 3WZ0A 1JB0C 5CYQB 2VBWA 2AHZA 3PTWA 1U48A 5BR8O 3FBBA 2ZZMA 2AYBA 4P2XA 2UXBO 2OSRA 5J2UB 3PHTA 3G82B 2UUAJ 2RH3A 2RDCA 3KNAA 1FA0A 3S3WA 1X4GA 1N34O 1E1RG 1TUGB 4L74A 4QYRA 1M56C 4NTYA 1H2NA 2J8AA 1Q4RA 5H5NA 2F4VF 1REGX 3UNGC 4RNHA 4WWSA 1RM1C 1K92A 1XDCA 1GAOA 2ZM6J 4PJ0Z 3FSXA 4LUBA 1U45A 2ZUGA 2MZRA 4DLGA 2VOOA 2W0XA 1RHJB 1N33B 3TXQA 3M8PB 3OEHG 1I94J 3OTOB 1UKUA 1KHVA 4KHRA 4DQPA 3D6FB 2GVDA 1FXVA 4CC5A 3UDVA 2QKSA 1KLMB 4J5OA 2XYPB 3KTQA 1FTCA 1BWVA 4J7KA 1CULB 1SKRA 1JIHA 5H6RA 2DNLA 1VQMV 1SF9A 3ISZA 4A8QA 1UZDA 1SQXH 1R3LC 3M99B 3CCMV 2A7WA 4DR4B 1NR7A 2HZVA 1HI1A 1KC8W 4ZP6A 2UUAB 5KX5B 3B8HA 4F7VA 2VBXA 1FK9B 3RGIA 2XAGA 1UP1A 3K57A 3MCMA 3ZTPA 4Q2MA 4B02A 1F5BA 2DXEA 2A2DA 2OPRA 4AILC 4JI2J 1RAIB 4KGZB 2FLLA 4B3TJ 2HRTA 2PTMA 4Q0BA 2H65B 2MKJA 1BHAA 1RM1B 3ZZ0A 4KTQA 2XOKG 3G6YA 3GIRA 1JXLA 3W9JA 5KAFZ 3W7WA 1T5EA 4DFPA 3V6DA 3SQGA 1XMQO 1FJEB 4H13B 2HBRB 3GPAA 2OPPA 2W9BA 4AL5A 3U1NA 1XHXA 5B3SC 1B3QA 2F4VJ 2Z3YA 1X31C 5L8RC 2YNHA 3E8HA 1RZMA 3X1LB 2OPQA 1HD1A 2W6JG 2HYIB 2DGSA 2D41A 1GMGA 3CCUV 3SPCA 1OJ4A 1QDUB 4FM0A 2KYXA 3BKTA 1SESA 3O8WA 5JCOA 1DTOA 4JI4O 3OLAA 2YNFB 3WC2A 2YKPA 2KRRA 2JOQA 5KG7A 5GADI 1QY7A 2ZDPA 1WORA 3S7RA 2E9RX 1FDNA 5L1KA 1S4EA 1BUXA 1VBKA 2JJ1G 3OXFA 5J2MA 2YXHA 3QGIA 4KFMA 1MLAA 1VIXA 2W4CA 5J2TB 1UWBA 4WP8A 2QZ8A 1S5ZA 3VQTA 1Z5WA 1HBMB 5H9FK 1CPYA 3UN5A 3ETEA 2ZWPA 3H0PA 4OJ3A 2B9ZA 2FHKA 3AAWB 2ASDA 3IXQA 4IO1A 1SL0A 5E7OB 3I6PA 4J42A 1C1BA 1NJXA 3NR7A 2WVDA 1AROP 1UW9A 1SL2A 4JV2A 3H4BA 2XGQA 4X1KB 3CD5A 3A0RA 1KVIA 1A9NB 3JAKA 3O3LA 4DR5B 1H0HB 4FDFA 4J90A 2QSFA 1Y6XA 3ZZYA 4F4LA 2OUGA 2Z30B 2GVZA 2PE8A 1YVFA 3CVKA 3D6TB 3HKDA 4IFYA 1E6YA 2R9RB 2QWNB 1J27A 1W7WA 3T6JA 1NK8A 4QOTA 2XM3A 3FBFA 3EGNA 1JKHB 2Q5ZA 4LF5B 1R8CA 3G2XA 3HVRA 1NDLA 2FY8A 1HL6A 1BGXT 2DNYA 4DR3B 4B3SO 1I51B 3KJFB 4O4JA 3H20A 3AG4C 3RBDA 2DR6A 1C4CA 4FNHA 1YLXA 2UUBJ 1D09B 4NMLA 1N88A 3KUEA 3G87A 4K4YA 4XK8C 3NNCA 1PNLA 4HYKA 4LREA 1UVLA 1XUQA 4DR1J 4GX0A 1HHTP 2HQDA 5KT5A 3GG1A 3FRYA 2JFDA 3TZXA 2YUAA 3MDFA 1SKVA 4B3RJ 3J7ZT 1OJHA 3EXAA 4K4ZA 4LFCJ 4ZDNA 2JZ5A 3G6BA 4A8YA 4LF7O 2QYGA 4HL9A 2XSJA 5TISZ 2KT5A 2ZE6A 3LGHA 2ZIOA 2WAMA 4DUYF 3SPIA 2IA0A 2PDAA 4ZCLA 2PI5A 2C3MA 1FJGO 1Z5VA 4ENOA 3SV3A 2UUTA 1N6QB 1AFJA 1WHYA 1FKPB 1YJUA 8ATCB 1ZS6A 1ZPVA 1HNZB 1HR0O 1S9EB 2XY5A 1SZTA 5DETA 4I67A 2IJIA 5HANA 1RTIB 1Q7YW 2P9GA 5G4DA 4RW6B 2DNQA 3P3NA 3TK1A 2DHHA 3HHLB 5IC4B 1VQNV 2FHJD 4OMFG 3AXMA 1VRTB 4Y65A 3C46A 4PWUA 3SQOP 2XMMA 2O1PA 5CYMA 3KJQB 1VJQA 3GU0A 3BO3A 3SJQC 5F8GA 2CQ4A 1MN7A 1OY6A 1JKHA 2HSEB 1V3RA 3MTJA 3WG7B 1X4HA 3KYLA 4LFAF 3PDNA 3FYIB 3BFRA 4WIIA 3DXBA 2B9EA 5KFHA 2FJWA 2BRLA 2QWOB 3K59A 3TW0A 3JSMB 1S72S 2ROPA 4TQSA 5I42A 2R2RA 4LF1A 5DM7Q 4CS4A 2K7KA 2PD1A 1Q78A 3CRMA 3DLEB 2GSMB 2Q66A 3MXHP 5LXTB 3KHGA 4I6AA 3O9OA 4D3GA 3UVJA 1UEUA 2BJ8A 1FD8A 4NZ7A 4M8LA 4GVBA 2GA7A 4EO8A 5HMWA 2OFGX 5IYDO 1KBRA 2NXUA 2ZDOA 1M57B 1S7IA 3IC7A 2R7TA 4C8NA 2B6AA 4JI1F 5DEDA 1R3KC 4U95A 2MZQA 1TKXA 4LRAA 4NXNO 5AXNA 3ONQA 4PWDB 2C2DA 1EB0A 3R5BA 3JS9A 2UXDO 1CC8A 3AG3B 1NJIT 1U7LA 5E1AC 3P49B 3ZCCA 5D4NA 1N33F 4FBTA 4OI3A 1ULRA 3AG1B 1FYJA 4DV1O 2AX1A 3LP1A 3EUNA 4JI4F 5LMUF 4GKJJ 1GM9A 4ZOLB 1U02A 3KWMA 4RWUA 4QZVB 1P49A 4G27B 4Q8FA 3QYYA 2HVDA 1RT4A 4BBYA 1WDTA 3NGTA 3S1TA 1HW9A 1V5IB 2FZCB 3CJSA 1IXKA 2MLXA 5CBHA 4W92B 5CD4A 1BZKA 2OO4A 4O4IA 1I7FA 4MVQA 4M5DA 3LDDA 1OZ0A 3FYEB 4XO0A 3T3FA 1YG0A 4FP9A 4X66B 1RQ0A 2HFEC 3NKYA 4LRFA 1GX6A 1IM4A 4OHVA 5CYJA 2OAUA 3GJQB 4X62O 2A9HA 4DR4J 1UA0A 3IGNA 1MMMA 5ETMA 4B3SF 1T9TA 4PQUA 2MQ8A 2PGCA 4OYOA 2M52A 2BYCA 3I9V9 4X1IB 3W66A 3HKEB 2AEMA 1PJ6A 4JAAA 4R7CA 1FNMA 1TL5A 2AGOA 3GSIA 4DK1A 3NXZA 3H9VA 1Y5LB 4IRCA 2KT3A 1S48A 2WOMA 3DM2A 1YHQS 3BKFA 4UFZA 4J9PA 2DNRA 1N34B 2KM8B 5HO4A 1G1XA 2BBEA 2MZ1A 3HVAA 2J0XA 5THWA 3UPFA 1PC4A 1CSJA 2DGTA 2DHXA 1X4AA 3OVAA 1JJ2U 2MQOA 2HHHB 1RWXB 4B3TF 1RSOB 3OR2B 3I5CA 1M9NA 4DV4O 3EX7B 5JXSA 1IBMB 2DRBA 3EVWA 3IRXB 1RT5B 4PG4A 1KQSR 1VF7A 1WSVA 2JVRA 2A3QA 4LRDA 4YN3B 1NB7A 2YEVA 4FLVA 2DIUA 3A12A 1FAFA 3OLBA 4ID8A 3BYPA 2RNBA 4DR2J 2WLLA 2ILZA 1PD3A 3MR6A 3TUZC 3N28A 1KUQA 3DM2B 4FVCA 2CGOA 4WP9A 2NS1B 2MSSA 3NNAA 2Z57B 1ZOTA 2VWJA 4C8ZA 4K2XA 2VBZA 2JEUA 4DV3B 2RKIA 4UZBA 1M1HA 1M5HA 3CMEV 3I5BA 4U67Q 4X4PA 4B3TB 1TL3B 3FK4A 3I55V 3D28A 3SMZA 3POTA 2G4BA 1O9HA 5JJEB 5J1PA 1MOFA 4YJ3A 3LH2S 3T1CA 2HQ3A 2V4RA 1HNXJ 4NEZA 2G2OA 3ZZTA 2IC3A 2YX7A 1S0OA 3PG9A 4QJFB 1GFWB 2CPIA 2VA3A 2HNYB 4LF6F 4L6V3 1S7HA 4DZDA 3D3CJ 3D8CA 4QU7A 4TU8A 2EIMC 1EQMA 1VIBA 2UUCB 4YJ2B 3O2IA 1I3OB 4U7UD 1BHNA 1EM1A 3IM9A 3UN3A 4NTWA 3PX4A 1NTKH 2A2CA 4DUZO 2DNNA 4XDDA 4RU2A 3KLIB 4JI7J 2Y69C 4CLYA 3H5UA 1NK6A 3CD0A 3PHEA 1G6UA 3FCWA 4EBEA 2R3VA 3QT8A 2Y1RI 1U2CA 3MHHC 2KXHA 3LPEA 5C25A 4OJ1A 1LWCB 4IYHA 2KVIA 3PJSK 3L09A 1RT5A 3CMQA 1Q1KA 4CT9A 4B3RO 2BSKA 3L71H 4EB6B 3P8BB 4OV6A 3PW0A 2GBOA 3OT9A 4DV2F 4DQSA 4NA2A 4ZHQB 3CCSS 4JI1J 1YI2S 2CTWA 3DRYA 3SR2C 5B1AB 2J8SA 3EDRB 4ED8A 3ET6A 5JVDB 5FPRA 1FTRA 3GONA 3R6LB 2GHYA 2L48A 1IXMA 1NMEB 3M8QB 4LMZA 2B4PA 4X1YB 3LW5C 3I82A 3EHBB 4LSLA 4WFXA 1XIQA 4R25A 3G96A 4P7TA 1EX8A 1GM8A 3D1OA 3MCSA 3MEKA 2BTOA 5IC6B 4MFBA 4R0EA 1BXNA 1KVKA 1IXBA 3E22B 4HAMA 1P9YA 4TWKA 3FX7A 5EWGA 4NI2B 3ZTSA 4PDVA 1X4CA 1S1UA 4DFKA 2L9WA 2HNZB 2XTAA 1TMJA 2MKKA 3LWMA 2EFQA 4E2FB 2FJEB 1IN0A 4LFAJ 1NRKA 5K8OA 3TQ1A 2DY9A 2VRZA 3FFIB 1Y4ZB 3L74H 1WHVA 4ID5B 4FLYA 2UUCO 1YZ6A 3CC7S 4PYDA 1K0VA 3E8BA 1IKXB 1M5IA 2NXCA 2BKPA 2XULA 4B9LA 5KFCA 1HNIA 3D3QA 4ES1A 1U97A 4F3OA 2UXCO 1WG1A 3R1HA 3DLGA 2F8MA 1NCLA 3MM8B 4KQZA 4FPIA 1HQUA 2RVJA 4E8UA 3H2VE 4IRKA 3RR8A 4MIAA 3CULA 1RPOA 1I5YA 1AR4A 3MOZA 4N5SA 3RAQA 4TV8A 4HT7A 1D9FA 1PNKA 3JATB 1AVMA 2JRIA 2WCXA 3QNEA 2WVFA 3NXSA 3NG8A 2Y0IA 3PX0A 6AT1B 2BTQB 4NCGA 4NXMO 4PQAA 4H4KC 4NRTA 1K97A 2G2YA 3QLHB 3ZMZA 4Q45A 5KAKA 4DR1O 2GX8A 2RRNA 4DV6B 1DRZA 2ZDIA 1BQXA 1KTQA 1IKVA 3E8FA 3WB1A 4FPRA 2HNDA 4QWAA 4BC7A 4B9TA 2F43G 4FZ1A 4OJHA 2JLEA 2LECA 2VONA 1Q0NA 2D3UA 3GJRB 1WNEA 2UUBF 2Q0OC 4WFAV 3CNQP 2IJKA 2DO0A 4M5NA 3RYFB 4J9LA 1RTIA 4OYWA 4GMKA 1N8RT 4LWSB 2GGPB 3X2QB 2OEKA 4ILMA 2QSWA 2Z0GA 3X2QC 1DHMA 4F26A 3NL0A 2XG8A 3F5WC 1YRUA 3SCIE 3H25A 1EZVH 5LJ3Y 1BQMA 1KS2A 5D8HB 5E3AA 2DT9A 2Q6CA 4USHA 2AHYA 3LWLA 3KXDA 4MT8A 1OCRB 3AODA 4RR5A 3RW0A 2A1BA 4I7FA 3L72H 3J7AU 2VOPA 1D8ZA 2MQQA 1P9QC 3EGVA 4ICLB 3C14A 3TZZA 2QLFB 1NU1H 2DYSC 1Q8KA 4KSEB 4DPXA 4K0KJ 3WDOA 2EINC 3RAXA 1R6KA 3R5JB 4QIGA 1AI7A 1N5QA 2GGPA 3AG1C 3W8PA 4LF5F 3IJ4A 2ZE5A 1Q16B 4TQRA 5KFMA 2WSEC 1ACMB 3R6GB 2AJQA 1Q5YA 3V4IA 4JI7O 5F8JA 1DLOA 4J91A 2E1PA 2CPFA 2LA4A 1SJ1A 1NVPB 4J9RA 3MI7X 1U47A 3TUIC 4C3MA 3ZN1A 1I94O 1XMOB 1O6XA 2CJKA 4LF9O 1X5TA 2MLYA 4NCGB 3MDSA 2VFUA 1TK0A 4F4KA 3QJLA 4PDMA 3QLHA 3GG0A 4OYMA 2EFVA 2RMKB 1RP5A 1BWEA 5IV4A 4U96A 3B8NA 4XDLA 3N6NA 1F51A 4X4SA 5CAAA 3VF0B 1UPGA 1J2VA 3R9LA 2PSZA 2R7SA 3H98A 4M5HA 3T41A 2B9XA 3BRCA 4LWSA 1WC3A 4K0KB 4BHQA 1EZJA 4DPWA 3Q89A 4DRXB 2XSFA 2MJNA 3OTFA 4MTXA 2ZH2A 1S1WB 3Q22A 2DKOB 1HFEL 4TV9A 3I56S 4PELA 2H4WB 1WTFA 4Y00A 3KJVA 1IKVB 3C14B 1N5TA 2HLDG 1UETA 1ZM4A 3D6MB 4I55B 3DSQA 2BSKB 4PXBA 3HULA 1GRJA 2OYQA 2ASJA 3NGRA 4NLXA 3KG2A 3H1LH 5EIBC 3H42A 2C3PA 4OYPA 1RJJA 2Q6BA 5IV3A 2IYGA 3R7SB 3LDCA 1XBLA 4WFZA 3GV5B 1UJ6A 4K5RA 2DISA 2E7WA 2BABA 4WFHA 3N2GB 1GN4A 2XWYA 2ROEA 2WPDG 4KGKA 2GFFA 4B3MB 2R7VA 2R7XA 1XQ8A 1VBZA 1I94F 2VFRA 2HMIB 5IJ0A 5E5NA 1VLYA 1FXKC 2OTLV 2KI2A 5E2QA 1RWKB 2EK6A 5CA1B 3WX4A 3VAKA 1SQPH 3CE8A 3C2PA 2UUCJ 1IDSA 2V2VA 1IZ3A 4LFAO 1DLOB 2F1FA 4YDXA 2PIIA 3QJJA 2RQCA 4IR1A 1V5VA 3QO7A 1NK5A 3UQ8A 3BQ1A 2Q4PA 5C5JA 2DB1A 2UUAO 1N4CA 1ZA1B 2HVJC 2R7UA 4EYIB 5SZTA 2W2OP 4F50A 3K06A 2E5JA 1YIJV 4Q43A 1N48A 4KYZA 3HX9A 2KRBA 3I0RA 3A0HZ 1FRKA 1NLKL 3ABTA 1QCEA 2EINB 1GKFA 2LP7A 2YQ1A 1D5NA 2YPZA 3T19A 2HZAA 4NVPA 4JBCA 1Q43A 1Y76B 3G8QA 4X65B 4P74A 3VAMA 4BWMA 3DU5A 2BTQA 3V5RA 2GAHC 3CJ2A 2LCWA 5U47A 4DWIA 2KO1A 2J5AA 1N33O 4LQ9A 4YIPA 1ITPA 2XLJA 4U7NA 3VAIA 2KFYA 4DW0A 3JALB 3TEHB 3ZO7A 3MWBA 3LAKA 2UXCF 4NXNF 2LO1A 2BJ1A 4Q0BB 1FWLA 4LR8A 2W8LA 4U8VA 3J80N 2JDIG 3FB5C 4JI5O 3IWXA 1SV5B 3BAAA 2BE7D 1D3WA 1EZZB 1S4FA 5EDWA 1D2DA 2VH7A 3LQVA 4XDCA 4KR0B 1H2KA 4TSFG 2CGNA 5L3GA 1KHWA 3LPYA 5ETPA 3HHLA 2YH0A 3MPYA 2V1DA 4JYAF 2AGPA 2IRUA 2B5JB 1YTFD 5CA5A 2JNJA 5GONA 3BGLA 3HI9A 4YOEA 1HW7A 3BGFA 1RBOB 3M2UB 1H98A 2U1AA 5ETRA 4J9KA 3FUYA 1HHSA 3LA0A 1RWNB 4DU7A 1JWWA 2OPSA 2CPYA 2ZH7A 3E86A 4JZ2A 1SJ3P 4QWCA 2GQQA 5HN0A 3NWRA 1D9DA 2HP8A 3D3BJ 2C3OA 4DV5J 2XMTA 4FF3A 2YKNB 4C8YA 2C2AA 2YS8A 4YXWG 3M1VB 1AYEA 1FD2A 4BW9A 4LT6A 2KFNA 5D0GA 4DV2O 1G7CB 3Q0AA 3CX5F 3K0DA 1U1QA 2CQHA 4RO0A 2E5IA 3CRQA 4DJBA 2X6CA 1ZYQA 1VC5A 4KUMA 1NDPA 4M95A 2KL8A 2ILYA 4KJIA 1QSSA 5IT9Y 4UOHA 2M8DB 1B4SA 5IT0A 2HEPA 1GK9A 4M5JA 3IWNC 5LMNF 5FNVA 4G65A 4PCQA 1WEXA 1VP7A 1WC4A 1HQEB 3CCJV 5HATA 5B0FA 3Q4HA 2NUHA 4LNUA 2XI2A 3CC4V 3TX8A 3CPWU 1K44A 5D0EA 5IWAO 3AG2B 2WBMA 2VL1A 1YJ7A 2HVHA 2UVUA 1HNWJ 4B9UA 5H9EK 2Q0AA 1U1LA 5IT4A 4JAUA 1NZAA 2BW2A 2ZBRA 3J80Y 3N79A 4HHJA 4X65O 4IFVB 5KHKA 4YHHB 1KOOA 3MM5A 4U8YA 1KEKA 2AJFE 1YDXA 1KP3A 2Y69B 5E41A 3DC2A 4IT5A 4J7JA 9ATCB 2D7SA 2XWXA 1NPKA 2RAQA 4I6WA 1ZTTA 1UVKA 4F3MA 1VQNS 1A7GE 4K8XA 4L75A 4ZPAA 4HHHA 4O3QA 5DG9A 1DF4A 3V4IB 5C2GA 2OMLA 1XREA 1YJNV 2KXFA 4I2QB 3RB0A 2RQ6A 3P32A 3KLGB 3BYRA 1T94A 4DPUA 3HB3B 1FEEA 3RFRA 1UJWB 5B0BA 2B5JA 1HWKA 4WK1A 4X1IA 4CZZA 3G86A 3IAS9 4J9OA 1J95A 4DR7O 3MCNA 1TR0A 5L38A 2ETNA 1KBHA 4O3NA 2ZWOA 4O3PA 1X9WA 4DR4O 2RS2A 2LEAA 3SCKE 1TV6A 2CWXA 3PKMA 2BQ3A 3A1YG 1NDKA 1U6FA 3JYTA 3CDBA 2Q7HA 1X9SA 3ZMTA 3AHPA 4QE7A 3GB0A 2I1RA 1VRTA 2W25A 5IY5B 1SBRA 1Y3JA 1FXHA 3APQA 1B0TA 2DOSA 2V69A 3AK3A 3HVTB 1S5LZ 3BS9A 3RRGA 4CO1A 2CAJA 2Y0SD 5BR8B 2RQKA 2CNLB 3MMAA 1Y10A 2ZM6F 4KPCA 1SKWA 3HSDA 1H2UX 2V67A 3DLEA 1RWPB 6FDRA 4KBIA 1DZ5A 2YXLA 3SI8A 3FAVB 5EK0A 2WA3A 1NH8A 4DV4J 5D5QA 4LH6A 1RTDB 4WFFA 4RLEA 1NJIW 2W1BA 4ZVFA 4XTTA 3GB7C 1CC7A 4RL1A 4UUXA 4FVMA 1LWXA 4JP8A 3B4SA 4DQIA 2E5LB 1VQLS 5K14A 1SQVH 2NXNA 3BN7A 1TUWA 5CD4H 2XNQA 1H6KX 2OIHA 4R6ZA 4ZLJA 4ZI7A 2OCCB 3BO4A 2R9IA 4DZ6A 5LP6B 2B56A 3SSRA 4OPAA 4F3QA 3KLVA 5HP1B 2K7JA 2ZVSA 5HVFA 5HVHA 5B0CA 4CLUA 4ANEA 2DN9A 3VZIA 2VICA 5FDLB 3TEGA 1GXLA 5DDQC 2ZUAA 1AI5A 2HGLA 3X3UA 1XR5A 1BE4A 4Z7YA 3BSOA 1R6NA 4URGA 1YZBA 2RS8A 4UQGA 4LFBB 5KG4A 1KONA 4LBIA 4RW4B 1WEZA 1S76D 3P30A 2V8VA 3G4SS 4MH8A 5J2NA 4I64A 4JYAB 4KO0B 4LIWA 1RU2A 3W5ZA 1HBOA 1SH2A 5CZXA 2AGQA 4DUZF 3OFNG 1J5EJ 2RD5C 5CMUA 2XMAA 5GAEI 2QA4V 1R8PA 1ZX3A 4QWEA 4TQDA 4PA4A 1F60B 3CD6S 5AXMA 4YDDB 3JQMA 1B0PA 4DSIA 1W0KG 2FC9A 1RT6A 4F02A 2LQTA 4USJC 1GTHA 2HS0A 4M5MA 2V8PA 4QYZJ 2F93B 3UO0A 4PXDA 3T1HF 1YJ9S 2JEXA 2VJUA 1FEHA 2Z2LA 1RDRA 2Z5UA 3ETDA 3T1YF 3HPOA 3BKUA 3KK3A 3B78A 4UV8A 2XI3A 2CNOB 4OHZA 2Z2MA 1U49A 1U0HA 3ZHVA 3KK1A 1ZM9A 1XOUA 1LFPA 1T9YA 2MPUA 3W2WA 3D54A 1FHTA 1LNQA 4LR3A 5DQHA 5LHIA 3RU0A 3IAM9 2N04A 2BCCH 3DC5A 3MD3A 1XNQB 4CH7A 3H59A 4CLKA 3U11A 3RWRD 4DL4A 3EDQB 5I3PA 3G8TA 3R65A 1PAEX 3BBBA 4WXOA 1XNRJ 3SDLA 3C6TA 3QO9B 2D3OR 2BJ9A 3M30A 3ULHA 4Z2XA 1G2EA 3CS5A 4K8ZA 3DLHA 3ZC4A 2ZM6O 3FJ2A 2L41A 1JNZB 5GVQA 1W26A 4MVRA 4QU6A 1K34A 2R9LA 4MMOA 4IQMA 3J80U 2RDDA 4V19X 1R3IC 4ZHRB 5LP6A 2VPYB 1LEOA 1B70B 2JLGA 1NPRA 3L4BC 1H2GA 4DV5F 4DV3J 2RHSB 2ZBIA 1Z2GA 4HH1A 2MDAA 3CDUA 4XPEA 4NYKA 2MQNA 4ANDA 1KKCA 2UXCB 4KV8A 2YNIA 1EIYB 3KOAA 5I3QA 3VQWA 3LP0B 2DE0X 3ABLB 4DR7F 5CXTA 4ZCKA 2ADPA 1VQLV 2MEWA 2X1FA 5H9FJ 1SKSA 3CIMA 2XT9A 2ZNJA 1KRPA 4DR7B 5KFVA 2Y8YA 4JI6J 1V9OA 1HQEA 3Q8QB 5GMKa 2WLLB 3ABMB 3K5NA 3A3OB 3B82A 4CLLA 2W9BB 4QGPA 3RYIA 3M8AA 3FEYB 5JJBA 3W9HA 1FNOA 2LXUA 2XASA 5EBLC 4FLUA 1KQKA 3JAMN 5KG6A 4AL7A 1AJQA 2HVZA 5J2NB 1HNVA 1XNQO 1KVJA 2AIRB 2Y48A 3LNMB 4O4RA 1AP6A 3C6UB 2UXCJ 1YJ9V 5KFXA 4AQYF 3ASNB 1S6QA 2KJVA 1PYOB 2LGQA 2YQ3A 4H0LB 1PYTA 1JJHA 1FRIA 3LNNA 5FLXY 4I4BA 3BPDA 3MMBB 2VG5B 2BJ7A 1SJFA 4LF4B 3QPIA 2N3LA 5DRKA 1HWLA 3KLIA 4UVBA 3AQOA 4NXMF 4OPHA 2YWWA 1NBEB 2WONA 5C24B 5RUBA 2O57A 2WBRA 1ZAWA 3QNWB 2IJHA 4NCBA 1R73A 2XZWA 5LXTA 3P4UB 2EVZA 1UVNA 2YNHB 2GUZA 1QUPA 2ZR3A 2RU3A 1ZBTA 2GQCA 4PQUB 5LHHA 3AQPA 3EXCX 4DX6A 3MEEB 1ICEB 4LSNB 4NA1A 2CG8A 5CN0A 2QC3A 1XMOJ 1UAWA 1M90W 4X20B 1U6ZA 4USVA 3BPZA 3D68A 2HFZA 1YBTA 2DEJA 5DDRC 4YB1P 1DLBA 2CYYA 2CQIA 1OCOC 2MZSA 1Q8BA 5A0YB 5IM0A 1Q8IA 2OLWA 3OPKA 3WIUA 4PG5A 3THVA 3PJXA 3FZ2A 3TJ9A 5F9NA 1YK9A 2C42A 1RT1B 1ZUQA 2H54B 2FVCA 2ADCA 1N32O 2HPUA 4XAKA 4OI4A 2HNZA 1VQ5V 1T9UA 4EK2A 6FD1A 3H01A 5HLFB 1GN3A 4TV9B 2XZDB 3K8WA 4USKA 2N7YA 5B08A 5EWEA 1Y3KA 2CAZC 3IS9B 9RUBA 3VVTA 3F56A 2GVZB 3PJ9A 3D66A 1HNWB 4OI0A 4OYBA 3OGIB 4O4GB 1Y00A 2HQGA 2YKAA 2X3GA 1T02A 2Y0BB 2PFFB 5KFIA 2FUG9 1FKPA 4EFBA 3LP2A 1WELA 1MWZA 2L08A 5EUHA 2V8HA 3GIMA 2N4DA 5JH7A 4TYBA 2XAJA 4QWBA 4QW9A 1E79G 4GX1A 3ABMC 5CCMA 3NGDA 3GTYX 2ACYA 4NLPA 3W7BA 5IOLA 4G1PA 1E6VA 3RN4A 1SQBH 1WP8A 3DLJA 1JK9B 1TK8A 4KE5A 1VQKV 1TUBA 3LSUA 1M5OC 5GTIZ 1RAEB 1ZH5A 2IM0A 2D2CB 1Q5OA 1KB9F 1ZZNA 4QR0A 4ZS6A 3L73H 3K9SA 4K4SA 3WFVA 5F8LA 3PKYA 3VWSA 3TJ8A 1WP7A 4LF6O 2HAIA 2GS8A 1Q6UA 2Y4UA 3KG1A 1RT1A 2YY3A 2EBOA 1V9PA 4CWBA 4X4UA 4ZA1A 1KLMA 2LMIA 5JWPA 5DJBA 4ED3A 1FFGB 4CS2A 4DV6O 4NLRA 5K8NA 1S1TA 2B9WA 5J1NA 3NAHA 1M90T 1PBUA 1FF2A 3VGSA 1NSPA 2VFSA 2BE2A 1I0HA 1PV0A 4CH4A 2VC0A 1FJCA 1FX2A 2JEGA 2DHAA 4RW9A 3BVOA 1HPZB 3TA1A 2HNYA 3T9NA 1O5JA 2PEBA 1PBAA 4LBPA 4DPOA 3QFHA 1QTNB 2AV5A 2J0WA 3SEOA 3C16A 3HT3A 2YIDA 5T7LA 1M1KT 1B0VA 2JJ2G 1HNWO 3BPSP 3OUFA 3JSLA 4JI0J 2WVBA 4PYAA 4DO2A 1U6BA 1X0FA 1U26A 4P2FA 4OXSA 1LXJA 3V4MA 4KIAA 4WE1A 4CLSA 1X9MA 2P6SA 2YI9A 4B9VA 3FDSA 2LW7A 4XPCA 1WTBA 3PEHA 1C0TA 4H4OB 4LF5O 1L5UA 4QIFA 1S5HC 2NR5A 4NR1A 1L1FA 2JHEA 2LQ5A 2MKCA 1TV6B 3KG0A 3LP0A 1EJ7L 2XS5A 2OFHX 1CQNA 4K50A 3JXOA 1SQGA 1XHZA 2A06H 1HPZA 3TX0A 4NEYA 2KQXA 2HWIA 4ICGA 3CXCU 3DCAA 2GIRA 1XC9A 2QLXA 4DF4A 2DR7A 4QCLA 4AT1B 2UU9B 3E01A 3OFFA 2BM0A 1NKDA 4X64O 4YR2A 5F8HA 5BMVA 5EBWC 2V94A 4G6VB 4U3JB 3J81Y 2DK2A 3CHXA 4ZOLA 3CWJA 3JTOA 3OTBA 4NA3A 4OZNA 2DGXA 4W4MA 1AW0A 3PR5B 3QAEA 1SA0A 1FWPA 2IBOA 5HQ8A 3J7Z5 2JLFA 1KP6A 2ZOFA 3CCEV 1FFTB 4DV7F 5GAHU 3H5XA 3CCWA 2XY6A 1K47A 4CTAA 3RR7A 4C8LA 4MK7A 3HSJA 4IFYB 1F0XA 4BAYA 1A6LA 3AG2C 2PFDA 4P6QA 1LUWA 4UVAA 2R8HA 4K4XA 1YIJS 2OP5A 2KTQA 2JSXA 4ZP7A 2MKHA 1RTDA 1GAXA 2W9CB 3P3PA 3BZQA 2G13A 4JI6O 4HEA9 3O5TB 4DV1F 3UT5A 4R8UA 1N54B 2QJ3A 2W9AA 4WJBA 5CHCB 1LWFA 2ZE2B 2R8KA 2XUMA 3CCQV 2LW1A 3FSYA 3MTKA 2VKZG 2F63A 4KPYA 2DR5A 3ICXA 1UW4A 5DGAA 2EW9A 2DCUB 3CW2C 2ZKTA 1OPIA 5CQGA 4DQQA 4GLXA 4QBUA 4ZCIA 4NB5A 4JV5B 4E0DA 4X64F 2IJFA 5J9PC 2SXLA 2ADQB 1IVZA 4OHWA 3I0RB 4WE1B 4DSJA 2Z2YB 5DDOC 1U0SA 2QJ1A 1JLFB 5K20B 1YZ7A 1V55C 3N5BA 1MZFA 3TZYA 2Y9HA 1N34F 2BKNA 4LSZB 5K1XA 1KKDA 3KK3B 1UFIA 2P90A 2DH8A 4DL5A 2KKHA 4C8MA 1CG2A 1FRMA 1KP2A 2BDPA 1TELA 5LM7E 1M5PC 1WWHA 2CPJA 4MW3A 2E1MC 1KD1T 1NSKL 5HJYA 3SV4A 4K4UA 1DQAA 3AJDA 2X7IA 5LMUO 2XY7A 2Z0AA 5KT4A 2OPPB 2VQFB 3ETMA 1H3DA 4L3KA 1QLEB 4GX2A 5CH7B 4LF4F 3ZRXA 3HR0A 3CRRA 2RJZA 4DV4B 4ZJQA 1OWXA 2MKYA 1FE0A 1RTHA 1VJWA 5ETSA 3AT1B 2YSUB 1UTAA 1U24A 3UDEA 5KFEA 3BBCA 1MMNA 1P1TA 5JQGB 1EHWA 4KB7A 4JI1O 3T5JA 3ZZPA 1FKOB 1TKDA 4MS2A 3LSSA 5JJJB 2PYJA 2UUCF 2UV8A 2E76B 4HH0A 1NUEA 1KTVA 2R7RA 3T2MA 4UCTA 5GAGI 1SQEA 2JC0A 3OL8A 4DYLA 2E9ZA 4NLTA 1DQ8A 3L7UA 1TUBB 1OQ6A 2Q7GA 1XNRB 2RT3A 3LTOA 3RB4A 3K5LA 4JI5B 2R7QA 2HW3A 2QLWA 1TP7A 2WB4A 2D3OW 4QJVA 3D67A 1OIAA 4DR6O 3KMSA 3W63A 4F0HA 1BY9A 2ZDIC 3CRAA 4X1KA 4RJVA 4C11B 2H5IB 5LSOA 4DRXA 3A8EA 4HTJA 2J7KA 3V2UC 4USIA 5AJ3J 3DHXA 3OW2R 1R6TA 2IU0A 1FDBA 4JI5J 5AE1A 2GV9A 1XBWA 1FRJA 4FJCC 1V6HA 3W2VB 3MPDA 1HBMA 1YXBA 2ZE8A 1RYRA 2VQEF 4B7EA 1NXIA 2RF2B 2NZ4A 1X5OA 1OYDA 3BR8A 3ILIA 4CH3A 1NT2B 4FIPC 3LDEA 3V6JA 2QWRB 4X4OA 1R8HA 2RHQB 5J2QA 2HHTA 4IKAA 3W61A 2IMOA 3QVNA 1VQPS 4H4KA 2R8IA 4JV5O 3NS5A 1MSWD 3HK2A 1BGYH 4USWA 2E1AA 1NK7A 3GFZA 3DXRA 1KQGB 1K4DC 3HD2A 1IBKO 3CD7A 1E6YB 4JI8O 3DC6A 1QNMA 2C1EB 4DV0J 2FVQA 2O01C 2EFGA 2XSJB 4ANCA 5A8KA 3JARB 4KHPO 2ROGA 3HHLC 2YQ0A 3V81A 3BY6A 2WWWA 2N3OA 4MKBA 4DV3O 2VG6A 4TLRA 4DV7O 3V6HA 4NYOA 4NYPA 4PKDB 4LF9J 1MMDA 4ZN1A 2W4PA 3M32A 3MM5B 3SCJE 7FDRA 1S0NA 5M2PA 1IR0A 3MMBA 2WSSG 1V3ZA 1S5JA 4DG1B 2ZH6A 1VK3A 2NPFA 2BX6A 2XMVA 3C15B 1UFWA 3VHQA 2XNRA 2LDIA 1RGVA 3KG4A 4LVOP 5AE3A 1RXOB 4ZP8A 2KM8C 5KOXA 1WC5A 2Y1LB 5J1EB 4ITSA 2PEHA 1Q5VA 3P5BP 2VS0A 4B9SA 3LAMA 4QR2A 2DTJA 1GO3F 4FYVB 4Y6IA 4GYCB 1VS3A 4TY8A 3Q8PB 5EBMC 5I4MA 3M8SA 3RYCB 4C0HA 1H73A 1RT3A 1QAJA 4NZ6A 4J9QA 1XK8A 2OPQB 1APSA 1CJKA 3QWPA 4NPOA 4RW8B 3HKZD 2VQEJ 4MT1A 2AGAA 4CCHA 2H1YA 5HK4A 2FTKA 2FQQB 1RWVB 5LMNB 3PV8A 3H1KH 4F6RB 1RT7B 3FEZA 2H3EB 2IRXA 4DR6F 3Q8VA 1ZSPA 4FMTA 1LWFB 2ZE2A 4PDRA 4KHPF 3JSRA 3WQPA 3PX6A 2ALZA 2CVEA 2MZTA 5HI7A 1OCOB 4YJ3B 5KFWA 2UVVA 2COLA 3PR4A 3ENAA 1HNWF 3G6VA 3K79A 2B9YA 2OH2A 2XHCA 4IH5A 5D4OA 1P1LA 2LFRA 5KFZA 1HI0P 4NKGB 4EB6A 4JV5F 2IH1C 3ENVA 4EZ9A 1VBXA 3OM3B 4CC6A 1TZ0A 1SETA 4ZVPB 2VZ9A 1EAYC 4C0BA 3D36A 4R5PB 4IOCQ 2E75B 4P71A 3CPWR 1MG7A 5LL6Y 2YNIB 1UZHA 3CCSV 3NOGA 2DJVA 4P75A 2F95B 5HBMA 3Q24A 2PMHA 4HDGA 2ITDC 2B51A 3NP5A 1WEYA 4FM2A 2XMJA 3AK2A 3QRRA 3MMJA 1VRUA 1VQ6S 3OR2A 4NI2A 4ABMA 3HKBB 1OV9A 3TETA 5D0HA 4CLFA 1IKYA 1R31A 2YTCA 4DS5A 2WAQD 1NI8A 3BABA 3K89A 3K9AA 5CA0A 1BQZA 2OELA 2DNZA 1URNA 2W8KA 2ZZNA 2UXBF 4K0KO 2YNGB 4LF7F 3J7A1 1TGOA 1FXKB 4QPTA 4FZ0A 1JLEB 3BSCA 2VHGA 4KGMA 4X65J 2XMWA 5HFLA 5LMNO 1IBMJ 4ZLPA 1SUQB 2ZH3A 1Q7YT 1NZ6A 4DL2A 1VARA 1EETB 1UPPA 3H4DA 2B4UA 4PDLA 3KK1B 5JUMA 4R8CA 3BO2A 3TQEA 4RW7A 3VGUA 3PVXA 2ODMA 3UFCX 2JEFA 3ISNC 3HKEA 4DXLA 4DR2B 2DYAA 2FYUH 4WFGA 4H33A 1KOHA 3KJVB 2MW2B 4OIXA 4TU7A 4HKQA 5F3ZA 1RA7A 2R72A 4DR1F 4FN5A 3T4ZA 1LK7A 3R5GA 4H54A 2YKOA 3CF5Q 4JGSA 4ZITA 1VF5B 4FLWA 2PA3A 2GV1A 1W2IA 1PO6A 1M5KC 1WNSA 3R5DA 4X66J 4O0IA 4B9MA 3MM6B 3G67A 2J0QD 3D1QA 3OTOJ 4ELUA 1RI7A 3PNIA 3BDPA 3J81N 2HHXA 3M9NB 1VCTA 4ZMMA 2VODA 3U27A 4K5SA 4CNZA 1FRXA 2VQEB 2LP4A 3GIKA 3P96A 1F9HA 3OR1B 3TVKA 3MEGA 4JI7F 1S9GB 2AW9A 2AJ2A 2J6SA 1V54C 5F2VO 4IHJA 3CEDA 2OD6A 2B4VA 2FHMA 5JVHQ 2IMWP 1RA6A 3E01B 4WBNB 5EYPB 1UVIA 2RRBA 2EEYA 1ZTWA 4DI6A 1HBUB 4KV8B 4DCOB 4IGGA 4IL6Z 4O23A 5E33A 1OY8A 4YMEA 3RG6A 1KFDA 5I3UA 3IGAC 3ZRWB 4ED1A 4CO4A 4PPZA 4TN2A 3SYZA 3QMQA 7AT1B 1NK0A 3F7VC 2DBBA 1JJCB 3ABKB 2J6UA 2KVQE 5GTHZ 4HI2A 2G2ZA 5DLGA 3T1YJ 2NXEA 3OSNA 5J2PA 4ED5A 3OTCA 2AD9A 4WZMA 3AG4B 3CYOA 4LFCO 2QFJA 1F3FA 4CO3A 4X88A 3R1LA 1S6UA 1TFYA 3FCVA 1VQ5S 3N6MA 2IJRA 2YDEA 2C2ZB 1KN6A 3A8IA 4WKRA 4O3SA 5KFBA 3HO1A 3M2RB 3QBCA 3SXLA 1M5SA 4ES3A 3JATA 3HFKA 4ILLA 4ZVTB 4U7OA 1KMIZ 3EZOA 2G9OA 1RSCA 4N76A 1OY9A 3OE7G 3DDNA 2DYRC 1REVA 5C8YA 4ILRA 2HURA 3KLEB 3GP9A 3LP1B 3D9BA 2EFOA 2EIMB 4EFAC 1SH3A 3HP6A 1N5YB 2OEMA 5GAEU 1JMKC 4Y0FA 3KLHB 2GO8A 4TNOA 1HBNB 1XNQF 2AZ3A 3F41A 4PRFA 3CE2A 5SUHA 2ZKOA 3F0NA 1YITV 4H4MA 3D5MA 5B0AA 2BACA 3EZ5A 4X66O 3MEDB 3HMJG 4WF9V 3BGUA 4FYWB 3IFXA 2BA9A 4IIJA 1YJWV 1WA8A 5F8NA 3PFEA 4DL0C 3AD8C 4P2SA 2JVDA 3UWTA 1P4RA 1QAIA 4WU2A 1T95A 3E83A 2IBKA 4DUZJ 2LEPA 1PC5A 2QSAA 2QRRA 1E1QG 3K0JA 3BJYA 2F23A 4G28B 2P8IA 3K04A 1XTZA 4YIOA 2Z8QA 3OTEA 4IDKA 1RB0A 1FRHA 3VALA 1R3JC 1SL1A 2M70A 1GMWD 4JI2O 5B1AC 2ZT9B 3TAQA 2A79B 4QPJA 2YI8A 3MD0A 4RNNA 4RUHA 3EJMA 2JC1A 2NSCA 1VHIA 1JMTA 1YGYA 4DR4F 5K1PA 2DPIA 4DSLA 5LL6d 3A3NB 4ZVQB 3TZWA 2DGWA 3GJSB 3MR2A 3QIPB 3MPVA 2EG1A 3CJKB 4I4TB 3W3SA 3M8QA 1NS1A 4FPPA 1H7XA 3MR7A 8AT1B 2B7CB 2YWKA 2BW7A 2QLJB 3B54A 4ZJLA 4DUYO 3NGUA 1HP8A 1WUUA 3MM8A 1P7BA 2CQGA 1T0TV 1AI6A 2RSQA 2IM2A 5K8PA 4DSKA 5HQMA 3H90A 2ATLA 3Q4HB 4QNHB 3OVBA 2E5LF 4DS4A 2XCAA 4WF9Q 1WD6A 2GZOA 5FNVB 1OCCC 2V4DA 2ZC4A 2WLNA 4F4WA 4B3TO 3NGSA 1FFXA 4DSFA 2FJAB 3EMTA 2RUSA 1IBMO 3A0BZ 2E7VA 4A8WA 2EG2A 1HQUB 1TVRB 1R0AA 2OCHA 2LEBA 2OTJS 3RW7A 4IIJB 2XMKA 3HSZA 1HBNA 4GKKB 4LR7A 4ZPDA 1HDJA 5LYJB 4K8RA 4FBUA 3JD1A 1N36J 2NXJA 2VFTA 2DRAA 1JX9A 4MIWA 2JS5A 3NLCA 5IQQA 1HNXO 2KG7B 1IBKF 1B06A 1IBLO 4Y28C 3RVZA 1VGYA 2GHPA 2M2BA 3BGRA 2ZXWB 4C7UA 3JD2A 4Y2KA 4AYBD 4PPDA 4K4TA 1L8DA 1TKZB 5KA5A 1U25A 4NLSA 1C1BB 2VDHA 4X62B 3NAIA 1I1GA 3TRGA 3MAHA 3GV8B 4YHHO 2PZSA 5HROB 3UDLA 1PYSB 1T9WA 4WU3A 4N56A 3PRDA 4NLGA 1NAQA 2L9NA 3AG3C 3UD5A 2J7WA 3ZHTA 4LF7J 4FFBA 5CB4B 3KDNA 3QIPA 2HIYA 4LQ3A 3OMIB 4ZHQA 2KZZA 3O1LA 2Q68A 2A10A 2GUZB 2YWGA 1RLCL 3ASOC 3DKDA 2B5UA 4O0NA 1I6JA 1G4CA 3QRPA 2HQIA 4WBNA 4NCAA 1CS4A 2MKIA 2VQFJ 3JSNA 3M2UA 1X5PA 3TO8A 1LXNA 3JASA 5LBQA 2V68A 3P5TL 1PPJH 4O2AB 1HW8A 3UN2A 1S6PB 1A32A 1WKLA 1N8RW 4OYAA 2E7XA 1NR1A 2H94A 4ECVA 2CTQA 2XC9A 5BXZA 1TFWA 4HBNA 3MM9B 1FFXB 2MSTA 4W98A 3MUMP 1NH7A 3OUYA 3VAFA 4X62J 1ZLZA 3ZEDA 1VLOA 1AUDA 3HHDA 2QMUB 1UVJA 4RBVA 4F36A 2ZNIA 2QYCA 3BH6B 3R2CJ 4DN9A 3QZ7A 4YJ2A 4K7QA 3EZUA 1FDDA 4EI2A 1YJRA 2JS3A 3I55S 2UZAA 1G4YB 2CIMA 3HZGA 1GT8A 5ETQA 3E89A 4IG3B 4DR6J 3H40A 2F4VB 1ZPWX 3VQYA 2CJQA 5HVGA 2ALYB 3BBFA 2KFZA 1TAQA 3IMQJ 4WZQA 2EK1A 4IQXA 3I0SA 2HWHA 5GW7A 4MSWC 2Y3YA 3IR6B 4JI3J 2I9SA 4BDPA 2ZC3A 3VQVA 2IDEA 4ECYA 5KX5A 5C42B 4OX8A 1C2PA 5IYZA 4JI0B 1FXKA 5IJ9A 1CJUA 3ITHB 2QE5A 4QPKA 4X4TA 2IIHA 4NXNJ 2OKQA 1WOSA 1Z4UA 1C0UB 2BANA 3A3PB 3WB0A 2Q1LA 4MTPA 5GAHI 3D0HE 4DV3F 4I2PA 4LF6J 2QWPB 5AT1B 2HIQA 4RAIA 5D6GA 5JMNA 2CTPA 2RIJA 3MUVP 2P5OA 3M32B 3C3TA 2QL5B 4CLPA 1O0PA 4CYUB 4CH5A 2LQ8A 5E3PA 3IC9A 1W2BU 4NXNB 1Y5NB 1GX5A 2DNGA 4C8OA 1Y74B 5GMDA 3G4SV 2F5GA 3CCZA 3KHLA 1HYSA 2HMIA 1S3JA 1S49A 1R7IA 4RNOA 4B3MF 2E5HA 4EKWA 4KFBB 1F23A 1VQMS 2MQMA 4C0OC 2DMXA 5KG2A 2M88A 4O4LB 1RHRB 1IJFB 3DRPA 1QE1B 1KNZA 3GCWP 2VB6A 4LF8B 1OS5A 4RW9B 1K5QA 2DY1A 1ZTEA 4YHHF 5J2QB 2W01A 3ZN0A 4K4VA 1JOYA 1PKUA 3AG7A 1P7GA 2IJNA 1CXZB 5L3FA 3ML0A 4GC7A 1U2FA 2FJXA 2DGUA 5CBFA 5FPOA 3I31A 2CKWA 2DQ3A 3OXGA 1RT7A 3UR3C 2WLHA 4PG8A 4ECRA 3SSSA 4ZVUB 3N01A 2M0GB 5BY1A 1WOOA 3CCJS 3BQ0A 2VIHA 1PJ7A 3DOMA 5A8RA 4JV0A 2K8GA 2GJFA 3E3XA 5FL7G 3FKSG 3CXCR 1U1KA 4ZCMA 1XILA 4A8XA 4LFBF 2BJDA 1TL4A 1VRQC 4DV7B 1NZ8A 3GJTB 3FMBA 2V0NA 5KFAA 1TKTB 2R2UA 3DYAA 4PZVA 3JCUZ 2HHUA 1TUVA 4IH7A 4NASA 5KFFA 2AYEA 1XMOO 3JTNA 2EX3A 5FIIA 3H8YA 2PGGA 3HT0A 3EE3A 4UB6Z 4B7KA 5MAOA 3M6XA 4YUDA 3CC7V 1PGZA 3WG7C 3UE2A 4X2BA 2Q43A 1W2BR 1QSLA 1WSRA 5IWAB 2OGUA 1T03A 2CPZA 5IYBO 4KP4A 1MNEA 4ASUG 1GNKA 3HVTA 2LVWA 1EKSA 1Q8LA 3UI3A 5HROA 4X20A 2VKRA 4TT3G 4TY8B 1WN7A 1NHUA 4YS2A 5A6WA 4K0KF 1C0UA 2LKZA 2WLIA 2BJ3A 4Q44A 3ZRWA 4ECUA 3ZRVA 1N4LA 4MK8A 1S9EA 1DY3A 3UKMA 3NCPA 5ITHA 2M7SA 2HHSA 1WACA 4CM0A 5LT5A 2F66C 4RW6A 1SC6A 1SVDA 1VFJA 1ZAUA 1HKAA 3GV7B 4AE5A 2AJ4A 4DV4F 3ELHA 4TV8B 1YQHA 4BWJA 5I42B 3PY8A 2EIKC 4ETXA 4DDFA 2LJ2A 2LLZA 4ED0A 1S12A 1CBKA 1LW0B 2YX4A 1NK4A 2Q6AA 2CPDA 1TL3A 2C3YA 2PN6A 4USMA 3D36C 2WZ1A 1H7WA 3VGTA 2OWOA 3ABLC 3MCOA 4DX5A 5LSRA 4AFFA 1K73W 2B8PA 2QN6B 3M8ZA 4MW8A 3EM1A 1EN5A 3JB9k 3S3XA 4ER8A 2ZD1A 2HVKC 1PIEA 1UCNA 3W5YA 3FFIA 3DGVA 3NOCA 1VQ9S 5D78A 2A0FB 2H5JB 1MU2A 2J9CA 3WX8A 2UUBB 4EBDA 3OAAG 1Y5IB 4L76A 4LFAB 2XS7A 2JGDB 1R6YA 1GTOA 3SDEB 2QFIA 3W7UA 4JB8B 2D69A 4GO5X 3UNYA 4DBQA 1S1VB 2Y1IA 5IDJA 4LF7B 1WG4A 1TKTA 2DNKA 2XCPA 3V6DB 3TAPA 2C28A 4OZLA 5LOVA 4I68A 2NZCA 3N0VA 3OUYB 4IG3A 1FCAA 3EXYA 3FC9A 4HACA 1URRA 5B7WA 4DHVA 3ETGA 4O4GA 4Z37A 2CZ4A 5FLXU 3CCRS 1YKWA 3PW2A 5E3CA 2VQFF 3CRCA 3NCRA 1VQ4V 2LU2A 3OD4A 4ED2A 1WI6A 4LF4J 2H5EA 1RISA 2O67A 4PWWA 1U8SA 3IG1A 4DV7J 3OL9A 3MPUB 1BC6A 4CS3A 3JSYA 3MFIA 2KSDA 2BOCC 3MAAA 4FXVA 2X51A 4PUOA 2VBYA 1YX2A 3W62A 2YKMA 2EC2A 1LUVA 1TL7A 5DGBA 1M1KW 4RW8A 1JLGB 2VQEO 1IWAA 2BJEA 5IS2A 4M5IA 3HF5A 1T03B 5IFMA 4ZVGA 3AJ2A 2AEJA 3UCUP 1BCCH 3ITHA 4GO7X 1WC6A 2QL9B 2G1HA 3ASOB 3GR0A 4B3OB 4DX7A 2N74A 5KFGA 2K9PA 4AQYJ 2F8EX 1L3UA 3RZAA 4LF9B 5HSPA 4R0JA 2ZHBA 4I55A 1MROA 3OGCC 5B5EZ 1WPBA 1Q81T 4ED7A 2DJWA 1N32B 2LFSA 2P9EA 5DO2A 1OMSA 3HM9A 2NLJC 1KDNA 4DXWA 4DV2B 4IHJB 3JSBA 2HVEA 2OPSB 4CRJA 4UOGA 3ZHSA 3DTUB 1R6VA 4OLOA 1S9FA 2QTWA 3SYPA 3AOBA 3IAYA 2GTSA 1DAXA 4DV0O 2QV6A 2NNUA 2H3OA 1JPXA 2AZ0A 3G80A 4LBHA 5A2QU 3HXMA 3F5TA 3QO9A 3DN9A 5K14B 4UOCA 4KO0A 2H51B 1NQTA 4JI0F 3IG1B 1PKXA 2KN4A 5KT7A 1JVMA 2XYGB 5BZBA 4UCVA 3JAMU 4J11A 2ZBPA 3MAAB 2LXFA 2DPJA 3FNNA 4A8FA 4X64B 2MYFA 4DR6B 1RSOA 3HHKA 4DV2J 1YVWA 1X4EA 2FHJA 1LW2B 2UV8G 4URQU 2N82B 4JTAB 4E98A 4YEAA 3QZ8A 4ZIWA 2QM7A 3ZX6A 3AH6A 1SJ4P 1VR6A 2MGZA 3ZZRA 1JLBA 1S99A 4B9NA 2RKIB 3CCMS 4URSA 3VCDA 4OZ0A 1SA0B 3RB3A 2M9KA 4PHZA 3FBEA 3RW6A 2IYIA 4NLWA 1YJTA 4C2MA 1YSCA 3LUTB 5M2UA 5D5PA 5KT2A 4O3OA 3VAJA 3G8SA 2GHWA 4Y2CA 1HHQA 4NE9C 4U6PA 3DRSB 3H2UB 4J9UE 3NNHA 3OBIA 3M2VB 4CLWA 1RKJA 2CH7A 3TYTA 4D7TA 2QG9B 4O3RA 2KG1A 3HJVA 3RYFA 3HKWA 3OHBA 4GUNA 3QG5A 3T1YO 1LK5A 2BOAA 1PCAA 4WYWA 5B0GA 3EVOA 4HNAA 3MMCA 1BL8A 1DARA 5IJ9B 1CJUB 3C19A 2HZCA 3ILOA 1WB7A 3ILLA 4ZLNA 2XNDG 3LOUA 5B1BB 1RADB 3BSNA 2CDQA 2Q3PA 3T1HJ 5DQIA 1MWYA 3G6EV 3QGHA 4FNIA 4BW5A 2FJVA 5KT3A 2X3DA 3FMWA 1ZM2A 1DTTA 1FE4A 5CA1A 4A5UB 4CH6A 2V50A 5KFPA 1BS3A 4FF4A 1NK9A 1CJTB 2CA9A 2OEJA 4LVNP 1J5EF 2QMXA 3T9ZA 4HR2A 3GLJA 1LW0A 1JFFB 3CEIA 4FYYB 2KG0A 3N9UC 1R1BA 1KD1W 2DEIA 3QO8A 3G71S 4KHPB 3A4TA 2DNMA 1DK1A 4JF3A 3JYCA 2HR3A 4DV5B 3MECB 4USTA 3VTIA 1RKIA 2KH9A 4WTYA 2FLNA 1SQFA 4KXRA 5EHHA 3M8WA 2AP6A 4YY3O 4MKAA 3TJAA 4D6TH 2AT1B 4MK9A 3BREA 4CIOA 2QA1A 4TUYB 4JI0O 2B8QA 1TL1A 1D9AA 1GTEA 4Q7AA 1KYOF 2B6AB 2R9AA 2O5DA 3CJ0A 2JL9A 1XN9A 2MHEA 2KZMA 3WBZA 4TQFA 5HP1A 2CG4A 2CUGA 4GZRB 1AI4A 2FY1A 1H2VZ 3RRHA 3DRRB 2BVZA 4ZKIA 2OMOA 2IDLA 1T3NA 4TLQA 2CQDA 4DX8H 1S1XB 1EP4B 3RBXA 3HJFA 4FS2A 3I32A 5H2FZ 2HHWA 1K5SA 5KHJA 1NM2A 1RYSA 3RT3C 2G0JA 1YITS 3H1IH 4O44B 3GYXB 3ILJA 4DV5O 3OHAA 2DNPA 2BQRA 2HHHO 2BQUA 3CCTA 1RTHB 1FI4A 5EZYB 3SPGA 3T1HO 3E51A 2YH1A 2WLKA 5KA6A 4RUFA 5L39A 3KMQA 2V63A 3R5CA 5KG0A 4TVAB 4J9SA 3PN1A 1GQEA 4M5LA 4HNAB 3MMCB 1JQGA 3UCGA 1S97A 4LF5J 3TANA 1CJTA 4PD4F 4J80A 3CC4S 1SB6A 4OI1A 2FLPA 3ADAC 2HFUA 2I6WA 4X66F 2IM3A 3K03A 4ZVEA 3IWLA 4JYAO 4PA9A 2AX0A 5A76A 2ZINA 3Q23A 4JI1B 4NZ0A 3RTVA 2GAGC 1FFWB 2RUGA 3B40A 1NJZA 2YEVB 5CA3A 5IT9N 2C22A 4FXDA 3EPIA 4MTFA 5HMZA 4L87A 1R89A 3DOLB 4F6EA 1AXQA 2ZOMA 3PXGa 3VQXA 1BSMA 1M93A 2VQFO 1KWMA 2MQLA 3N4WA 3SZ2A 2RU9A 3QRQA 1WC0A 1AUSL 2V9WA 1WG5A 2HAFA 2EJRA 4F8RA 4PA3A 4JI3F 2UP1A 5C42A 3ZMSA 3TI0A 1N33J 2JVOA 2VA2A 4A46A 5ETTA 1RBAA 3TVYA 3DU6A 1VQOV 4JI6F 2FZKB 3D6HB 1SUQA 2LDYA 1S57A 1SJQA 1N56A 2UXBJ 1S79A 3OR1A 1B7YB 3T5KA 1EN6A 3FB7C 2UU9O 1Q3EA 4WCEV 3RBZA 1B64A 3EICA 4F67A 2J7UA 1N5VA 2DYSB 2VG6B 4CYUA 1N0JA 1SERA 2CZ9A 1COWG 3STZC 2YWHA 4DOZA 3M7MX 1VIOA 3PEJA 2BUNA 4CO5A 2B1IA 4M94A 4HYOA 2IAJB 4M5KA 1XL4A 3OVSA 1BD6A 3I96A 4ZK7M 4P72A 1QQCA 4QIVA 3SIPB 3KK2B 1IBCB 5DS7A 5KHHA 4HLBA 5F9LA 4ZJOA 1K9MT 3DGPB 1S9GA 1GXUA 3M8YA 2UU9J 4CBCA 4FZVA 2FIUA 1YBUA 3ZJZA 4I50B 2Q7EA 2ZH4A 3ENWA 1VI7A 3NGKA 2FJDB 4LFCB 5H1SV 1SZXA 2XTJP 4MVMA 4EU0A 1RE1B 5H6QA 1JNRB 4N8NA 1IR1A 5KG5A 1NSAA 3TA0A 3GYGA 1QVFU 1Q53A 1LWEA 1NTMH 1K7DA 1BQNB 2W7AA 2C3UA 1FXRA 4PV1B 3FBCA 1HI8A 3AXKA 3OJSA 3CDAA 2FGCA 2GJ2A 1XWLA 3LF0A 5EN1A 2FPHX 5KFDA 3MM7A 1RP3B 1U1PA 3BCCH 2Z4PA 1RT2A 3ZNUA 5DN6G 4C48A 2NREA 2RQMA 1OCZB 5D3GB 2IFXA 1XERA 2CPXA 3HHLD 4OZ3A 3EGZA 2JJ4D 4JYAJ 4YR0A 4DUYJ 3NWGA 2VFVA 4X1YA 3QFWA 3UR0A 4NXMB 2IRYA 4ZOSA 1JLAA 1NNDA 4DR7J 4AXIA 2FC8A 5HMXA 2V5HG 4IR9A 4W4LA 2HLTA 3U10A 3KZIZ 4OYZA 3OEEG 1JLGA 3JAKB 4NL5A 1NH2B 4PA7A 3FFQA 2E5LJ 2OTLS 3R3TA 4LR9A 2VPWB 1QM9A 3BGRB 3OTDA 2DR9A 2F9JA 2UXNA 2XB2D 1V3SA 5E79Z 3MM7B 4ZPWR 4EO6A 2EZOA 2FB5A 4EEQA 2G0CA 2WRMA 1FJGB 2YIAA 2A6MA 2VG7B 2C2RA 1N36F 3T6BA 5D3GA 4H44B 1CS4B 3BV8A 2EIJB 3IR7B 1X7VA 2P6JA 3UQSA 2GCFA 3KKYA 1JLCB 4KT0C 1OCCB 2I0XA 5LXYA 4I50A 1VQYA 4LF9F 2CQ1A 3M7VA 3J81U 1GH8A 5F0UA 1JLAB 4F4ZA 3GZ7A 2HBQB 4LCUC 2RNEA 2YICA 1M1GA 4FF2A 3BSAA 2EBEA 2P6TA 2DNHA 4JASA 1VC0A 1QVGR 3OMNB 5IXUA 2K06A 3LGMA 4CT8A 1XR7A 1R8AA 4MVSA 2YX1A 2F3JA 4DSEA 4ZPVR 2ZH5A 1AJPA 3QF7A 1RCOB 1TUEB 5G0RB 1F6TA 3HVWA 1YDLA 4FLZA 4EUVA 3GR1A 3JAWA 4N8OA 5L46A 3CSKA 2YC0A 1IKWA 4Q5VA 3CJKA 1HNXF 2ZJPQ 1F1BB 3MURP 4TY9A 1OSCA 1L0LH 1RT2B 4UW2A 1HR0F 4P7VA 3TA2A 1AA1B 1LKZA 4UCUA 4W4KA 1VRUB 4ALZA 4I0XB 1QTMA 2OD4A 3POTB 5ITZA 2PA8D 1Z2LA 1LWEB 1BHBA 2HGNA 2HJFC 3W8GA 1K8AW 1O9GA 3FEXB 5L3DA 2P9CA 1GMWA 2IU3A 3HD1A 4QWDA 3QSIA 3R7BB 3MUTP 4DR2F 2CQPA 2YXYA 3FRZA 2ZJQQ 3UD3P 2UXDB 3GWOA 4RBTA 3PYGA 2NSBA 2E5LO 3TWZA 2XO7A 4MYTA 4WIQA 4N47A 1QLNA 1WAZA 1TQLA 2NN4A 1KR4A 3LGNA 2FZGB 2P2CB 3E2EA 1T11A 5JVGQ 4JI2F 2FYXA 4ECTA 2GDSA 1WI8A 4G1IA 2OHDA 2VG5A 4JYYA 1YCIA 1XNQJ 2QR4A 3MR3A 3PIOQ 1HBUA 2UXXA 4FM1A 1FESA 5ETNA 1UJ5A 4K2JA 2HFVA 1T8EA 4J9MA 1VQOS 4JV1A 2FLOA 3B2EE 3W60A 4OHYA 4YP3A 1CVJA 1US6A 3VGVA 2MQPA 3FQKA 4FKYA 1PSDA 4CLZA 4PG7A 1NB2A 4MKYA 3CSXA 3U1MA 4WPAA 1LWCA 1KC8T 1NSQA 2DRDA 4HTIA 1JX4A 5DM6V 2CRLA 1ORQC 4GKKO 3QGPA 1L3KA 4F0MA 2DH9A 5D4PA 2APOA 5LOQA 5AXKA 2ASYA 5EGYA 3UDCA 4B3MJ 1U09A 1F5CA 2PT0A 4BCAA 3KHRA 2PY5A 3AEIA 4KKOB 4P9OA 1MSDA 2CVIA 4KH1B 3KFWX 4PI0A 3Q2SC 3OSPA 1H2MA 1P8GA 4I5SA 1OCZC 2C2KB 1V55B 4TYAA 1DGSA 1HD0A 2I5JB 3BDEA 1QAYA 2FD2A 2C2MB 3TJTA 1ZETA 4X89A 2F1MA 1WOPA 3FD9A 1QLEC 5ETVA 3M1VA 4OLPA 4DFJA 1S72V 3D0GE 3MGJA 3DRXA 2HQFA 3NEKA 3L9DA 5ETOA 1VQSA 2AYMA 5KFNA 1N6QA 3G6XA 3VZHA 2AU0A 2V2KA 2WA4A 5KOWA 3PRVA 3KLEA 1SJRA 4GKJF 1NKCA 3SFGA 2EZPA 2QM8A 1JQ0A 5LA6B 3E22A 2ARHA 1Y74A 4WK3A 1FPOA 2FL4A 4MVZA 3AOCA 2BMBA 1FVSA 4U7UK 1XI1A 4GVLA 4LP8A 1FS0G 2ZEJA 2BOPA 3NCQA 4KFBA 4YQWA 1TAEA 4OQJA 2MB0B 3B4DA 5BR8J 2WVEA 1AB8A 3E8GA 3NBPA 2ZE7A 4E4EA 4TUYA 3RGBA 3JSMA 4PXCA 3CMAV 1GEHA 4KKOA 4BIUA 2CQ3A 1NVPD 2M5YA 2V6AA 2QEXV 5KMGB 3K58A 1MMLA 1OO0B 2W6IG 4BC9A 1Q79A 2GW8A 3CB4A 3KJNB 2K1EA 1BQNA 2NYHA 2W9CA 3OJUA 3ZNJ1 4X65F 2JX2A 5KFLA 1VF6A 3Q86A 1YTYA 2Y1JA 2XBPA 1YI2V 1MZEA 2ERRA 1Q82W 2CQ0A 1GMUA 3GWKC 5A8RB 2XGPA 4AUKA 1PILA 4DEZA 3MHSC 1ELOA 3K0GA 1VQ7S 4DV6J 3VV2B 3OFEA 1NPPA 2DITA 3AB4B 2DO4A 4DCPB 4ED4A 3BA9A 5JVDA 2D74B 2OPRB 4DUTA 5BJRA 4X8AA 1HMVB 3ZTQA 1XR6A 3GFXA 3BM7A 4BIZA 3HSGA 3N5FA 5HQLA 5KHIA 5EWFA 2A18A 2J76E 5B1NA 1FJGF 1H2SB 3PO4A 1F7YA 2JGDA 4MFBB 2M6YA 4FK5C 4ED6A 1Q81W 4C4WA 3DFEA 5KFQA 2E29A 4I2PB 3TUPA 2HG5C 4MTOA 2MMYA 1M0SA 4RUCA 3PFOA 2DIVA 3SFUA 2HWTA 4F4AA 1JLEA 4CO2A 3ABKC 2JH3A 2IC3B 2GVDB 2BRKA 4R8UB 3UT5B 3CJ3A 4K3AA 4P52A 3RRKA 5KFSA 1AT1B 4BWAA 1TAUA 1ZL8A 3SJBC 1P27B 1YBAA 3ZXWA 2OIEA 3NRBA 2YKQA 3IN5A 4KHPJ 4DR5J 5L1JA 2OSQA 4F2RA 1RAHB 5D4LA 3L95X 1K33A 3NBPB 2X6AA 3QJPA 1V54B 3EVKA 3U02A 3R5AA 2CQCA 3CCUS 1W25A 3ZHQA 4LF2A 3ENQA 1CJKB 2W2MP 1LFWA 3GE9A 4EZ6A 2P06A 2OCCC 1S1WA 2R2SA 5KMGA 4MAKA 3GSDA 2GTAA 3BEHA 1RT3B 2CDRB 1IJEB 3A8TA 2J9DE 2LQBA 1WPXA 2L6LA 1JJOA 1IX9A 4O4HB 3W5XA 3DLBA 4OI6A 3D1HA 4PI2A 4XDKA 1Y11A 4ZKAA 3OL7A 3RYCA 1QAXA 2DHSA 3DLKB 3CJ4A 2BKOA 3KUGA 4MYUA 4AXJA 4G2KA 3CB2A 2WW8A 5T14A 2VDIA 1SCJB 4EEYA 1SC5B 1LR1A 2DWDC 2P7TC 1RHQB 3ET6B 3QATA 5AE2A 2N7CA 2QEXS 4I6YA 3CD6V 1FRLA 2POKA 4OX9B 1IUJA 2A3JA 4WBFA 2XAQA 1IM6A 1HNXB 2XEXA 4CI0B 1RWMB 1MROB 1EBOA 4OFZA 4IG0B 5D77A 2IM9A 2EIKB 3LSQA 3BB5A 1RAFB 1XNRO 1ZWIC 3RVYA 4RW4A 3DMJA 2DD8S 5KAIZ 4NLDA 4WP3A 4R5PA 2R42A 4OYXA 1XJWB 3CCES 4JI5F 3GFHA 2XAHA 3EFFK 2P22C 1J5EB 3MOJB 1FT8A 1NJYA 5KFYA 1U1NA 1UPMB 4CNYA 4I7FB 4TXSA 4WFAQ 3RJMB 2D3ZA 4JI3O 1JCHA 1RU1A 3TVZA 4JTCB 2K2PA 4U9RA 3DGPA 3ZZZA 4ZVRB 3GYNA 5FD1A 1FJ7A 5DZ6A 1X5SA 2MY8A 4XIUA 4O2AA 4OX9J 4FYXB 4IRDA 4Q6GA 3WHIA 1X4BA 3NMAA 2IPOB 3ABUA 3SDEA 3A8KA 3CJ8A 3QGGA 4F4YA 1HA1A 3P6YC 4FXWA 3CCLV 4IG0A 2ZFHA 4DV1B 1HNZF 5A2QY 2XHWA 2GO9A 3DOLA 2AJ1A 2JGUA 2X7RB 2AF6A 3H2LA 2XQCA 1EP4A 1SPBP 2YBVA 2X1GA 2KHCA 4OGQB 2KXNB 1VQKS 4ZHRA 3J7YI 1TKXB 2DXFA 3JQKA 4ZPCA 5F0WA 3IP0A 2F8HA 4F0KA 3UO2A 4DUZB 3CCRV 4DL6A 4WXWA 1TK5A 2DNOA 1SXLA 5LOVB 1HWUA 4FKXA 3U7JA 1VISA 4CO0A 4A48A 1SI9A 3VQSA 5CCLA 4WFBV 4B3RB 3OQ2A 7FD1A 2EPIA 1CJVA 1S1VA 1Q86T 2HFSA 1EKRA 2VPXB 2J6TA 1NBMG 3T5LA 1OPZA 1G8MA 5J2UA 1X60A 3A13A 3F73A 4QIWF 1EN4A 5B3SB 3FKBA 3C3SA 2F9DA 1M56B 4B08A 2Y8WA 2BE2B 3JAMY 4OX9O 1IWGA 3S01A 2J9DA 2ZH1A 1K1QA 1NU4A 1U96A 4I4TA 4GCZA 2LA6A 5LMUB 3ZTRA 2R7WA 1HIYA 3FAVA 4YR3A 2F7VA 3TARA 1RAOA 4ATNA 4M1KA 1AZSA 3I9ZA 1NH2D 1SIWB 2ZXWC 3KKFA 2I8EA 2NYIA 5L3BA 3K7RA 1N36O 2XAFA 4JI6B 1RABB 5KFKA 3G82A 4ZI7B 1FJGJ 3DMJB 1DTTB 1TA8A 2B1GA 4RKUC 3GIJA 3HPLC 5CABA 2C2EA 2PMWA 2V4JB 4ELVA 2IVYA 4ZN3A 2UUAF 1A0OB 4J9ZB 2I38A 3MEEA 4AQYB 2V9KA 3L3CA 4ICLA 1RHKB 5GONB 4KY3A 4DMZA 1UEKA 1Y4MA 3L9ZA 4GX5A 1LW2A 5DG7A 2QO3A 2ZCEA 4JI4J 3VBBA 4AHCA 2Q8VA 3SYOA 3RYHB 3CXHF 2WONB 1DQ9A 3ZMUA 3MF5A 1QSYA 5ADZA 1JJ2R 2EJ7A 3SYAA 4C98A 4JZGA 3CT9A 4G1QB 4LBEC 3SYQA 2ATKC 4EWTA 1OQ3A 5EX0A 5LGNA 4UCSA 4OJGA 3KLFB 2JRSA 1XMBA 3OTOO 2DR8A 1XMQJ 3L75H 1C1CA 1VQPV 1MG1A 2RCVA 3PW4A 4I0XA 2B3TB 4JI8B 2JFKA 4RU9A 4C11A 1WC1A 4PWDA 3SQGB 2QIFA 1QR8A 2AWZA 5A0YA 5IM0B 1MW7A 5C8YB 3CJTA 1U1OA 2CPEA 4L8JA 2CJ9A 2DYRB 3SYCA 4P9SA 2C2OB 3LALA 2RQ4A 3EGWB 2GNKA 1FXDA 3SSQA 3GWCA 1O8BA 1F2GA 4B3SB 2IBZH 3KLHA 2Q73A 5L9NA 1VQ8S 4X62F 4LNUB 2WB1D 3ZHUA 4O2BA 4DV1J 4HDHA 4WFEA 2YVSA 5B0EA 4KGVB 4UZCA 4DG1A 1X59A 1OSDA 2L3MA 4FFBB 5CB4A 3CO0P 2M3DA 3KUHA 4X4RA 3UCSC 5CYMB 2MGZB 4UV9A 5B09A 1K9MW 2GC8A 5A8WB 4FF1A 4YB6A 3THOA 2ZH9A 2FVPA 4CTAB 4O4HA 1TTHB 2FKXA 1Y7PA 2CNNB 3BGOP 2IH3C 4FS1A 1K73T 3C66A 1F9FA 4QE9A 1KFSA 3M30B 1HWIA 2HRYA 5J2TA 1UWBB 2XMUA 5IQ6A 3BH7B 2J0SD 4PA6A 5IYCO 1N5SA 4A47A 4UF4A 4DR3O 3U1LA 2KYZA 3RYHA 4UUJC 4L3NA 4S0MA 2FVSA 1E6VB 1MWQA 2W2NP 4DPYA 5LP6C 5ITZB 2E9TA 2GMLA 1WB8A 4EFEA 2V34A 2KU7A 3SGIA 3HKDB 3BEGB 2UVRA 2QTSA 4LF8J 4EBCA 2FDNA 4RUBA 2RB7A 4C3KA 3HHNB 4B3RF 2A6OA 2CDYA 1QVFR 1CLFA 2Z2ZA 1ENVA 3IRWP 1MNGA 2HRUA 1U2RA 2B4OA 1L3VA 3ISND 3JD0A 1UA1A 1WJZA 3QIDA 5KLVH 2W7OA 3ZRSA 4ERDA 3DLKA 2QE7G 4OX6A 4MKVA 1X4TA 3CJHA 4P2MA 2QGNA 2IAJA 1FKAO 2BV3A 1W59A 4LC1A 5T41A 4J7ZA 4N7TA 3OMAB 1SC4B 1TVKB 4C3LA 1JLFA 2V2ZA 4PAAA 1BLUA 3WU2Z 3C90A 4J10A 2MXYA 3OT7A 3OV7A 1UVMA 3RYIB 3M8PA 2BANB 3AA8A 2DHGA 1F2HA 5KUMA 2WLJA 1VQ7V 1AB3A 5E3RA 2PUSA 2HHHF 2CXEA 1HNVB 3PIPQ 3I87A 4DU8A 1JA8A 1F5AA 4O4IB 4P9PA 3CC2S 1PL4A 3GIIA 4YY3F 1G3OA 4J9VA 2QWQB 3DRSA 3OFHA 3FVYA 4J7CA 2RE1A 1EQ0A 4HI1A 1G6BA 4GKJB 1Y0HA 2A0LA 2AJ0A 3JQJA 3NMRA 2JEIA 1Q86W 1SC1B 5CYQA 1DTQA 4IO9Q 1JLQB 2XLKA 2CE4A 1CP9A 1T3OA 2ZVIA 2YIBD 3JCZA 4P73A 4F04B 2UVWA 3QTCA 3W7TA 1DFDA 2ZNYA 4A8KA 1HNIB 3EPGA 1C0TB 4XBFA 4NLYA 4UUWA 5EX3A 1HR0J 4AD6A 2ZHAA 4WFYA 4W90B 3W2WB 4UQTA 3DHWC 5IY5C 1Q90D 1GXTA 2N4CA 3J81j 1B7FA 3SPJA 4CQ1A 2R8JA 4C6AA 2R7OA 1FX4A 1DJ0A 4QIWD 2XYHB 5E0OA 2Q79A 3P3DA 3N27A 2ZBCA 3W7SA 1I5XA 1HR0B 2QT7A 3N2KB 2EFNA 2ATCB 2R8GA 1TMMA 3ZHRA 1K8AT 5HFMA 1PG5B 3Q8RB 5B1BC 3NY0A 2CUYA 2IM1A 2LXIA 1YWXA 3F7YC 1RHUB 2YIBA 2R4FA 4Y2IA 4NYZA 1YF2A 1RTJB 4KC5A 3MMAB 2Q67A 2HS3A 4Y34A 5K8MA 3G9CA 5J2MB 4NX9A 4ZVOB 5KHGA 3D4JA 1BQMB 2GIFA 2IW5A 1IR2A 1UWAA 4ZVHA 1PAUB 1U0HB 4K59A 2QDOA 3CJRA 2ZD9A 3LP2B 4JI2B 2EKNA 4NLOA 5HMYA 4YHHJ 1VMGA 3PZPA 3DOKA 1S1XA 3AJ1A 5LXRA 4PG6A 2EBGA 3CDWA 5J1EA 4D3HA 1BMQB 3CCVS 4ZIVA 4RNFA 3IGVA 4DR2O 2VC1A 3DI6B 1DBDA 2QTOA 4WCEQ 3M9OB 3ZMVA 2AEFA 1VQ8V 4GVBB 1BT8A 4BLGA 3VOUA 3HDSA 1JLCA 4KRWA 2E3CA 4DLEA 4WYLA 2KDOA 3IBWA 1R0BG 4UY85 5L3CA 2QA4S 2QL7B 3O6QA 1NEEA 3TUJC 4Y2MA 5JCOC 3MZIA 4DR5O 1JJ4A 3DDKA 4OZ1A 4DL3A 3CGIA 3ZS8C 1J5OB 4BIOA 3HKCA 2IHR1 4U7CA 1IURA 1JLBB 5AG2A 4PABA 2JIZG 3I0SB 3M4XA 3CTRA 4OHXA 1YJNS 2ZZTA 1JXEA 4MJKA 1C1CB 2EKYA 2ASLA 2CQ2A 1F4NA 4GKKF 2VJVA 1XMOF 2W24A 1U4BA 3K5OA 3B09A 3T1AA 3W65A 4JUZA 4TOIA 2XS2A 4G3IA 4J9YB 1VYAA 1IKXA 3T5HA 3SCLE 4NTXA 2BM1A 4F2SA 5DDPC 2RDJA 4I56A 1RT4B 4DF8A 2F4FA 4L73A 5LMUJ 3WB2A 1BMFG 1R43A 2EILC 5D0RA 2MKSA 3APOA 2MHNA 3ETQA 2MJUA 1UJ4A 5F41A 2YPYA 3H5SA 1B04A 5CBGA 2EC0A 4EYHB 2P4VA 4H4MB 5CZVA 3CJQA 1M5VC 4Z1MG 4ECWA 1SRYA 5B1OA 3WC0A 2DGOA 1FO1A 4C9DA 3RUBL 5K5MA 2H8PC 1ZM3A 1SIZA 1BQ0A 1URFA 2GQ2A 4UY8T 3C6UA 5KFTA 4UT4A 3G6ES 1MABG 3DRPB 3R7NB 1S6QB 1R0CB 2ACMA 5BR8F 3A2FA 4JAVA 2WOMB 3QT5A 1ZA2B 1KU9A 2G1DA 1IKWB 2WLIB 2IY5B 4NLVA 4HHUA 3CJ5A 4DFMA 2ADBA 4GKJO 3DLLQ 4LF8O 3I5AA 3AK1A 2K3KA 1IBMF 3VAGA 4J9NA 4WFBQ 2NUUG 4UB8Z 3US5A 4M5GA 1J5OA 3UD4P 4DR3F 4C7QA 1F4MA 1VF6C 2CNKB 1X8DA 3LO3A 2ZHOA 3CUNA 2UXDJ 1QBZA 3N6LA 1K4CC 3OXLA 1EETA 5EC2C 1EARA 2HS4A 4WTOB 3PM9A 4U3FH 1XNRF 1ROFA 1YJVA 3MECA 1PL0A 4LH7A 2VV5A 1YJWS 2LQ9A 2CK3G 1WKKA 1FXLA 1NHKL 3P45B 3FZBA 4JYBA 1RTZA 4ELTA 2VF3A 1HLWA 3GILA 1M57C 4P10A 2B43A 4ZP9A 3IO1A 2NQPA 3OR7C 1S0MA 3F44A 2ZR2A 4ZVSB 3CCLS 1IBLJ 2D9OA 2RF2A 1N0NA 1JLQA 3HCXA 2VG7A 3UVJB 4CM2A 3VAHA 4K35A 1XEQA 1YEWA 1I5OB 4C97A 4J41A 3W1YC 3HFZB 5L9XA 1Y76A 4OX7A 4QW8A 5LGTA 3BHPA 3R8YA 3HKCB 3DYAB 1CQMA 3AFGA 2QGFB 4B3OA 2HK2A 4JI8J 4K4WA 3KDOA 1WJ9A 5C93A 5LYJA 4KAIA 3DNCA 1WHXA 3BQ2A 2CPHA 3K3WA 3CCQS 3OFGA 1GM7A 1D5AA 4RX6A 4Q8EA 1EFRG 1TVRA 4U3JA 1F3VA 5GMEA 1R0AB 1T7PA 4JV5J 5A9GA 3MM9A 2W4DA 1DTQB 2ZITA 2HKEA 4FYDA 4I0WA 1IBKJ 5M2RA 2NCKL 4GKKJ 4M63A 2YWFA 3Q2TC 3JYTB 2ABYA 4RO2A 3E35A 5K9FA 2Q69A 3OD2A 3TCUA 3JALA 1QD1A 2MK3A 1CPZA 1ZAXA 3TOQA 5BXIA 5DG8A 3MFHA 3T1YB 2HEKA 2ZNZA 3I4PA 3M6WA 3L70H 2XHBA 4C8KA 3Q8UA 3EYZA 5MLCV 4IOAQ 3THPA 4D7SA 2E1RA 4PR6A 1RT6B 3OUSA 4DW1A 5JQGA 3E8OA 4Z7CA 4ZIBA 1RWOB 4YFUA 1Z2ZA 2BXJA 1B3TA 2QMWA 4EMDA 3WIVA 5FLXN 1AILA 1VK8A 4OX9F 5L1LA 2R70A 1LOUA 1J5EO 4LSLB 1PM9A 2F40A 1NKEA 1BE3H 3IBFB 1AFIA 4IH6A 3CWBH 1KECA 3ZZOA 2P5VA 3OL6A 2O3DA 4RNMA 2RRAA 3H7HB 2B7BB 3GMGA 1IQZA 2U2FA 5FDLA 1FWKA 1NKBA 3TP2A 1HMVA 2Z56B 4B3SJ 1N32F 1VQ4S 1MU2B 2FMLA 5A6PA 5HBMB 4MIBA 4M5DB 2QLBB 3UO3A 3W7XA 1D1UA 2CADA 5DECA 5KFRA 2RN9A 1NJWA 4Y3CA 3HHEA 3MR5A 4JYCA 1QJHA 5T7LB 4H4OA 3R97A 4I9WA 1FVQA 5GAGU 2C2NA 4DV0F 1VHFA 4OI2A 2RDIA 1OCRC 4RUAA 4PEOA 3S6EA 1TL7B 1RBLA 2HG4A 2ZQMA 1U1MA 4FLXA 2DGQA 4CZCA 1FKAF 2EFPA 4OZ2A 4I69A 3Q8SB 4YY3B 2P67A 1IBLB 3IA0A 2QKAA 3QT6A 2DCLA 2BR0A 1B6QA 4KGXB 1NO8A 3GFYA 1VQ6V 2YKMB 4F25A 1VQ9V 2Y0PA 3BN4A 5HJXA 3AB2B 4RZRA 2I5JA 3K2YA 2L9DA 3FGVA 2FTRA 2K3IA 4YB7A 2YNFA 4DL7A 1ZL8B 5AJ3F 1KSPA 4TKTA 4MVUA 1KKHA 3H1JH 2V8GA 3D7SB 4NLQA 1H2LA 5LJ5Y 1TL1B 4KH0B 5BMVB 2R2TA 2AMCB 1H72C 2IVMA 4ES2A 1VDHA 2UUBO 5IWAF 3ZZUA 5IYZB 4LF6B 4CH1A 1SQQH 2UUWA 3LANA 2CJXB 2HK3A 2PYLA 3GVMA 2BZ2A 3TGUH 2VD3A 1DURA 3MAQA 4BS2A 3QQCD 2H4YB 3B4MA 1M4UA 1RCXB 4LF8F 2HHHJ 4R50A 2KB2A 4ETZA 2UXBB 1HWJA 2XZTB 1UL3A 2HHVA 4J37A 1NTZH 3PCOB 2AYGA 2KJWA 2EILB 3Q83A 1IKYB 3AD9C 2KT2A 5F8MA 1N0VC 1FDAA 3H5YA 1LQ9A 1VBYA 4O2BB 4DPTA 2J9EA 4RWWA