2RJZA

Crystal structure of the type 4 fimbrial biogenesis protein pilo from pseudomonas aeruginosa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
SLKQQFSTKAFQAANLEAYKAQMKEMEESFGALLRQLPSDTEVPGLLEDITRTGLGSGLEFEEIKLLPEVAQQFYIELPIQISVVGGYHDLATFVSGVSSLPRIVTLHDFEIKPVAPGSTSKLRMSILAKTYRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PilO protein
publication title Periplasmic domains of Pseudomonas aeruginosa PilN and PilO form a stable heterodimeric complex.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 40
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2rjzA01
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rjzA02
4JI5F 2PUSA 5K1PA 4DR5F 4LF6F 2R70A 4LF9F 2B7CB 1FKAF 2UXCF 1XNRF 2VQEF 4JI3F 2YIBA 4DV0F 1G7CB 4ZIBA 4CS4A 4GKJF 2ZNJA 2VQFF 5LMNF 2Q7GA 2ZNIA 4JV5F 5K1XA 1G1XA 1N36F 1O9GA 2YY3A 4X62F 1N34F 3T1YF 3VQYA 1XNQF 2Q7HA 2E5LF 4B3TF 1CQMA 2F4VF 4DR7F 4Q6GA 1I94F 2RQ6A 1IBLF 3ZZPA 2KJWA 3VQWA 3DSQA 2JVDA 1N33F 4KHPF 2R72A 2ZIOA 2UUCF 3QTCA 4DUYF 4LFBF 3VQXA 3ZEDA 4DV1F 1O9HA 4AQYF 2E3CA 2UU9F 4BW9A 2ZINA 4X64F 4LF7F 4DR4F 1J5EF 4LF5F 4YY3F 4B3MF 4B3RF 1IJFB 1XMQF 1HNZF 5BR8F 2YIAA 1CQNA 1IBKF 3T1HF 4X65F 1IBMF 2HEPA 2J5AA 3R3TA 1FJGF 1IJEB 2B7BB 4DV5F 2ZIMA 1F60B 4GKKF 2UUAF 4NXNF 4LF8F 2UXDF 1LOUA 1XMOF 4LF4F 1HNWF 4CH4A 5LMUF 4JI6F 2UUBF 4JI4F 2KJVA 2Q7EA 3VQVA 2UXBF 4JI2F 4DV7F 2BXJA 1G6UA 5AJ3F 2QJ1A 4DR6F 4K0KF 2ZCEA 4JI8F 4DV2F 4YHHF 2RJZA 4DUZF 1HNXF 4DV4F 4CH5A 4JI7F 2HHHF 1N32F 4CS2A 2YIBD 4X66F 4CH6A 1QJHA 2YI9A 4TQDA 2YI8A 4DR3F 1GH8A 2PGGA 3BHPA 4CS3A 1RISA 4DR1F 4LFCF 4DV6F 4BWAA 3OTOF 4B3SF 4JI0F 4DV3F 2BVZA 1VMBA 2ZM6F 4DR2F 5IWAF 1HR0F 4LFAF 1B64A 4OX9F 4CH3A 4NXMF 4JI1F 4JYAF 4TQFA
chains in the Genus database with same CATH superfamily
1NH2D 4JB8B 1U2CA 3H42A 3QLHA 5FPOA 2Z2YB 1IBMO 2AEMA 3G6XA 1RDRA 2WLNA 2RAQA 2E5LF 2JDJA 3JARB 5HK4A 5BXZA 2PA3A 1WWHA 1X4FA 3ISNC 5BYRA 1Q5YA 2HNYA 5BYSA 4CZCA 4J9NA 1UWBA 5GW7A 3A8EA 4IL6Z 2IVFB 2ZOMA 1ZM2A 3LP1B 1IBKB 4YB1P 1X60A 2Q5ZA 2BABA 3QIPA 5EWGA 1WHVA 4I2QB 2AGPA 1LWFB 4DQPA 1R3LC 4LF4B 3OR7C 5LMUB 1LOUA 2HEKA 2DN9A 3HVTB 4WCEQ 2XWYA 3DLGB 2RKIB 1XNRO 2CUYA 1EQ0A 2VWJA 4P2XA 4IUFA 4OJ3A 1SQFA 1PNLA 1H2LA 1EIYB 5D8HB 5IJ0A 4OZ1A 1MMDA 3K9AA 4AE5A 3PKMA 1ZYQA 3OEEG 4C8MA 3ZS8C 4FYXB 3JASB 2IJFA 1GXUA 3A8IA 2A2CA 2AW0A 3MMAB 1HBOB 1VQLV 5LJ5Y 2ZXWC 5D0HA 1BMQB 3QBCA 3R1LA 1AI4A 1QU7A 2FJDB 4WFXA 1ZAWA 3GTYX 5FPRA 5F3ZA 4NA3A 1D5NA 4K3AA 2FHMA 4YEAA 3O6QA 3MPDA 3K8VA 2AHOB 2CPDA 1YKWA 4DR7B 4O2AA 4B9VA 3H9VA 1KKDA 1YVWA 1HPZB 3QGPA 1Q82T 2XZDB 4URSA 2DMXA 5LXRA 3R5AA 3CHXA 1WC5A 4ATNA 1VBXA 2RQMA 2ZUAA 4DR3J 3RYIB 1BZKA 4G1QA 2QWQB 5IY5B 1I1GA 1SKUB 3MPUB 2CA9A 1PYTA 2B8QA 2KFZA 1JLQB 2YIAA 1KP2A 3O8WA 4NLTA 3DLEA 3HP6A 3B09A 3SFGA 2NPIA 4TU8A 5DRKA 2OSQA 2P6TA 1CJKB 4C8YA 4LP8A 1H7XA 3GIIA 4CO2A 4YMEA 4DR5O 1VF7A 1R8AA 2RD5C 3M32A 1BWVA 3KG0A 2DR9A 2HIYA 4CO5A 1NTKH 3BRCA 3VGTA 2MW2B 2PMWA 4ES1A 4FYDA 5LHGA 5CD4A 3ABLC 1O5JA 2HHPA 3OL6A 4DLGA 5JJNB 2VG7A 4PG6A 3CWJA 5D4LA 4B9LA 3DDKA 4PA3A 1NTZH 2BE3A 1NHUA 2DNRA 5H6RA 3ZXWA 4UF4A 2KL8A 4KFMA 5DQHA 1O9GA 4L87A 4U8YA 4RU9A 2Z3YA 3VV2B 1I94B 1UWBB 3HZEA 1VHIA 4LF8O 4KC5A 1N0VC 5CYQA 3FMWA 4PYAA 1FX4A 3VOUA 5JH7A 3KK2A 1UVMA 1S57A 2FUG9 1PL0A 3HKDA 3HJVA 3SSRA 2HBZB 4V19X 2DNYA 4K0KO 1Q78A 2CH7A 1S72V 4C8ZA 2W4CA 1LW2B 1HBNB 4ZP9A 5A2QU 4F67A 1S99A 5L9XA 2R7TA 2QEXS 3KLEA 1BHBA 2DR8A 2VL1A 2HG5C 4QOTA 5E3CA 2GMLA 3GWCA 4NYKA 3D3CJ 2CTWA 3OHBA 5IJ0B 3BKTA 4ECVA 3GZ7A 3G86A 1CC8A 4Z2WA 4FZ0A 2ASYA 3NCQA 4ZCIA 3E8HA 1FWLA 1RU2A 1JOYA 1ZM4A 4C98A 3M30B 4DYLA 2M52A 4JI7B 1CULB 3M6UA 4DUZF 3JQJA 4X1KB 2AJFE 1SIZA 4B9MA 3MHYA 4JOUA 4M5GA 3G2XA 1Q7YT 1HNZO 3OV7A 3FCHA 3QGHA 5LOQA 2J0QD 3QO9B 3JS9A 2XSFA 1L3UA 4GCZA 1FI4A 1QCEA 1J5EJ 4LFAB 3NWRA 1D3WA 1V55C 3C46A 2APOA 4BWMA 1IWAA 5BMVA 3OD4A 4FM2A 3E2EA 6AT1B 2COLA 3G8TA 4DSJA 4EBEA 3GWKC 3MEGA 1X4EA 2UUBJ 1JB0C 1IXBA 1N34B 4RBUA 1BL8A 2ZUGA 1OZ0A 2Q73A 4G1QB 3ZNUA 3JD1A 2GS8A 2RB7A 3CO9A 1PJ7A 4ED5A 3K59A 4DF4A 3KK1A 3DLEB 3MF5A 5KT4A 2QLXA 4AL7A 2IBZH 2EBOA 5E2QA 4Q44A 3OMIB 1IUJA 4OV1A 1YI2S 1YZBA 5KUKA 2XHCA 3M32B 2M5YA 2FY1A 3SI8A 3WG7B 4ECTA 4DV0J 5IWAO 3ETMA 3B8HA 1P6TA 1S9GA 2DQ3A 4KHPO 3M05A 4LFBO 2FLNA 5LL6Y 3QFHA 1KFSA 3MUMP 5I42A 3I6PA 2AWZA 1N32F 1RHUB 3I96A 5KAFZ 5D0GA 1HBUA 2A2DA 4CLPA 1GH8A 2PGGA 2OMOA 4Q20A 1YJWS 3CCMV 1LK5A 4LF7J 4NXMB 1UFLA 1X8DA 4BIZA 1RBLA 2MZJA 4EZ9A 4X4PA 3MGJA 5CYQB 2CWKA 4LH6A 2NXCA 3KK2B 2Q6BA 3HKDB 5B1BC 1RT1A 2CH7B 3T1YF 2DEJA 1L5UA 2HZVA 1CQMA 1P7BA 1JQGA 2UUAO 4RUHA 5GAGI 1YRXA 3L71H 2RQ6A 3CCUS 2WOMB 3W62A 1IDSA 3DNCA 3KLEB 1KEKA 3VGVA 4ZVRB 1D9FA 2DNKA 1NS1A 2BZ2A 2FLLA 4X4SA 4PV1B 3LTOA 2HS0A 4CYUB 4LF5F 1R8PA 2DHAA 1URFA 1SQBH 4PDRA 4QR1A 4P2FA 4YJ2B 3D36C 3OFEA 4M94A 2UXDB 2G2YA 5J1NA 2C2DA 2ZE6A 5IT9N 2FKXA 1L1FA 1U1MA 4CH4A 3L9DA 3DRYA 1VMGA 5H6QA 2MQ8A 1RBOB 2MY8A 3NMAA 2QA4S 4K4YA 4JASA 4R0EA 4DN0A 4X62O 3W61A 4JI5J 2HHHF 5DJBA 4YOEA 2CKWA 4CLWA 1U8WA 4OLPA 5BMVB 1YCIA 4DV6B 3FBBA 3AG2C 2DJWA 1BS3A 1AI5A 1ZPWX 4DV3F 4A8QA 3MR3A 5I3QA 2OIGA 1MABG 3PVXA 2AU0A 1KP6A 1T94A 2E5GA 1CBKA 3KCXA 3WX8A 3H1LH 1YRTA 5DO2A 1TUBA 2ZC3A 5A0YA 2H65B 4ICLA 4E98A 2JRSA 4X65O 1UAWA 2H3EB 3R8YA 3VWSA 1RLDA 3OSPA 2QKSA 3MFHA 3NNCA 2RH3A 3BGRA 2PEBA 2G1DA 1M5IA 5T7LA 2K9PA 1BQNB 3RW7A 1S0NA 3M99B 5B09A 3DLJA 3U1MA 2MLXA 4YHHO 4HDGA 1FFTB 1SCJB 1S9GB 1NK7A 2ZXWB 2GCFA 2HMIA 2QG9B 2CQ1A 2XZTB 4HYKA 1R0CB 1GM9A 4JPRA 3KXDA 4B3SO 3GG0A 1KQGB 5I42B 1AR5A 2P5OA 2IRXA 2YX1A 3UN2A 1I6JA 3K57A 1YIJV 3ABUA 2JLEA 4K5SA 3T5HA 3CW2C 3OVBA 4JI4F 4HHHA 3M8PA 4O4IA 4ER8A 3CCLV 3ZMSA 1UZHA 3P49B 5HN0A 3JALA 4CH5A 1IM6A 4ECWA 3K58A 4LF6J 2JZ5A 1NK9A 4IG0A 2V34A 4OHWA 1RLCL 1BHAA 3N79A 4KUMA 2AJ0A 4BIOA 2IA0A 1VQ9S 2Y0SD 4I4TA 5MAOA 2O5DA 1TELA 2MKIA 4FPRA 2EKYA 1H2GA 1RB0A 1XNRB 2DISA 5E5NA 4LF9F 1WORA 3ADAC 5A76A 5HFLA 3BPSP 3DRSA 2DRBA 2DY9A 1T9UA 1LWEA 3LGHA 3DDNA 1TAUA 4V1Ak 2VIHA 1XEQA 2F4VF 4HNAA 2MZTA 2YX7A 2ATCB 1FA0A 4ANDA 1VC0A 4JI2O 3Q22A 1NTMH 3NLCA 2NLWA 3EXYA 2ZD9A 1B3TA 4B3OA 1DHMA 1G2EA 3ABLB 2UXCO 2B51A 3EGZA 1B70B 2QT7A 3WIUA 3GJRB 1RQ0A 3PW4A 1JLGB 1AW0A 1CJTA 5B1OA 1SV5B 4F4YA 2GTAA 4ZCLA 2C3YA 2DITA 4U95A 5DEDA 4CWBA 5CBHA 2PGCA 4WF9Q 5KAIZ 3HSDA 5HMXA 2Q66A 3J81N 4EYHB 1RT6B 1KTQA 4FZ1A 1C4AA 2C3MA 5DG9A 2J6SA 3KKYA 2YWGA 2M4MA 4D3HA 4A8WA 1SESA 1QJHA 3LF0A 4DFJA 1EN5A 1RM1C 5A0YB 2JLGA 4W92B 4I64A 3JD0A 4F4LA 2ZDIC 2BOCC 1R0AB 1N36J 1FAFA 1VC6A 1VMBA 3FC9A 2JH3A 5CZXA 2QSWA 2VPZB 4JI1F 4RAIA 2NN4A 4DR5B 3GCXP 2R4FA 2ZHOA 3BGRB 5GVQA 5T7LB 3CJ3A 2ILMA 4GKJF 3OR1A 2J8AA 1S7HA 2CFXA 2DCLA 4UY85 5KFSA 3D36A 2W9BA 2PIIA 3A3NB 5IM0A 3FD9A 4CO4A 1WKKA 3G6YA 2HMIB 2Q6CA 3SCIE 3IAYA 2HQDA 3C3SA 1KKHA 2WW8A 2R2TA 1UJWB 3CYOA 4NA2A 1YHQS 4WCEV 1ZM9A 2A0FB 3ETOA 5HVHA 3ZZOA 2DPIA 3H1HH 3M8PB 2QGNA 4FYYB 1V55B 1A0OB 2XS2A 1EARA 2BSKA 2MKKA 4DSIA 2ZZNA 3JALB 4KHRA 3PW0A 4DV5F 2JK5C 4LF8B 1R3KC 4M5HA 4IG0B 2CUGA 1N33O 2YKMA 4HVZA 2DH7A 5KT3A 1VOMA 3HF5A 4K0KB 4L72B 1Q8LA 3A4TA 2RRBA 4TV9B 4I4TB 1HNXF 5KFBA 1KN6A 3CCRV 4NXNB 1N0UA 3RVZA 3QT5A 4L3NA 2LO1A 1G6BA 3BQ1A 1Q6HA 3J80U 3DRSB 2B9XA 3ZZYA 2FYXA 1TKDA 1VQ6S 2XMAA 5FLXU 2CNNB 2C2RA 1K1SA 3D28A 3I9V9 3AQOA 2YKQA 3PG9A 5CAAA 3DC5A 3NGTA 1G7CB 4OIXA 4JV5B 2ZNJA 1HYSB 2L9NA 1G1XA 2F9JA 3AOCA 4FYWB 1S6UA 4B3OB 1Q5VA 2LFVA 3MPYA 4ECRA 1PJ5A 2EK1A 1GMUA 1WF2A 3L72H 5D0EA 2BRKA 2A79B 2HBYB 1CJTB 3TVKA 5GMKa 4DDFA 3ENWA 2A06H 3DRPA 1BQMB 4LR9A 3CC2V 4DR1J 3DHXA 1U8SA 1VQPS 3PACA 4R8CA 4DRXB 1VIXA 2EWHA 4OZJA 3CT9A 3DRRA 4I56A 5IXUA 3QYYA 4LRFA 2LECA 4QQBA 3BBFA 4YS2A 4ELUA 4J80A 3OL7A 3OFHA 2CGOA 5B1BB 2HFEC 3K06A 3QQCD 3OJUA 1U1LA 3C6TA 4KGKA 2LVWA 3DU5A 4DV4F 5IYBO 2JS5A 1NJXA 2NR5A 1EN4A 3CRQA 1YX2A 3GFHA 2YNFA 3EGNA 4BLGA 4CT9A 3OR1B 4WKYA 5IWAB 3WB2A 1C0TB 2C2NA 2Q69A 3DFEA 1B64A 2BMBA 1IKWA 2W9BB 3JD2A 1H8EG 5IM0B 1NU1H 4Y0FA 1M56C 1SJ1A 2R2RA 3TA2A 5J1EB 2OCCC 1UW4A 5JJJB 2KKHA 4CS4A 3SSSA 3OD2A 4WU2A 3OUSA 2ZH9A 1LWCA 2VBWA 3N6MA 2WSCC 4DR3O 3LQVA 1MWZA 2YIDA 2BRLA 1NLKL 5C25B 2BSKB 3CWBH 4XIUA 8ATCB 3AG2B 3VAGA 5LM7E 1ZL8A 3PYFA 2AGAA 1K1QA 4GC6A 2ZE8A 1FRMA 4DQSA 4CO0A 1RA6A 1KVKA 1AT1B 4R25A 2GGPB 4EFEA 2YVSA 3VAJA 8RUCA 5DETA 1WI6A 2UUAB 1D9AA 4PQUA 2IJIA 1X0FA 1Q95G 3L73H 3JSBA 3IWLA 2ZDIA 3KG1A 1IN0A 2W1BA 4LC1A 1KLMA 3HHLD 4Q0BA 4C0HA 4WFAQ 4R7CA 2VC1A 3BV8A 4C3MA 5EWEA 4X1YA 2OD6A 2CDYA 2DB1A 4JAAA 1EHWA 5F8LA 2PI4A 2K06A 3M8RA 3S8SA 3TZYA 4H54A 1G1XB 3TI0A 4OGQB 2DHSA 4CI0B 3CCJV 5B0CA 1RWVB 2XAJA 4FLZA 4I7FA 1IBLJ 3CTRA 2GIQA 2J76E 2HHUA 4TVAB 4N7TA 3HXMA 4DUYJ 3HK2A 1ROPA 1SKRA 4J7KA 1S1TA 4TY9A 4X62B 1RUSA 2GHWA 3EVOA 1T11A 1IQTA 4A8YA 4TWKA 4ILRA 1QUPA 3ELHA 4HACA 3M8AA 2XZWA 2M2BA 5IT4A 1BC6A 3DRRB 4OHXA 2KRRA 5JJBA 1QQCA 4R6ZA 1ZA1B 2KT3A 1AI6A 4DV7J 4YY3F 1F5AA 1BQ0A 2QWNB 1N6QA 4X65B 4HHUA 2ZR2A 3C6TB 2R8GA 4YP3A 1FEEA 3OTFA 4Y28C 2QRRA 4NXNF 3Q83A 3SZ2A 2HRUA 2M0GB 2FYUH 5KT6A 3G9CA 2IYGA 5ITZA 4CLUA 3ZRSA 2ZBIA 3HKZD 2YNFB 5D4NA 4YHHB 1X59A 1KOHA 1U1KA 3B8MA 1KHVA 3RZAA 1B3QA 2D9PA 1H8HG 3SSQA 1IKWB 3NGUA 1J5EO 2AMCB 3IGAC 3AG7A 4NLSA 1R3NA 1N5YA 2QTSA 2CJ9A 4M95A 2QLBB 3SFUA 4B3SB 2ZH5A 4DX7A 2JNJA 3MPWA 1HR0B 1RT7A 4UZCA 2HGLA 1LWCB 3N5FA 3T5LA 1WP8A 3LP2A 3M8ZA 2CQGA 4H4OB 2V8DA 5K8NA 2N82B 1L8DA 4CLSA 3C19A 2QWRB 3I55S 1ZL8B 3K5NA 1NKEA 5CA1A 1YBUA 2UV8G 3OTBA 3JATB 1A9NB 3LH2S 1S76D 5KFXA 4PQUB 1RM1B 1KR4A 6FD1A 4RUEA 3CX5F 2HKOA 4DV0O 4B08A 2X3GA 5LSOA 1TVKA 4Q0BB 3KWMA 1ZA2B 2E66A 2ZWPA 1BXNA 1VIBA 2X6BA 4X1YB 3MM5A 4NI2A 4JI2B 4FMTA 3WQPA 2ZNZA 4DFMA 4FM0A 3KLHB 3JSYA 4EK2A 3T3FA 5F8NA 2Q6AA 4I7FB 4BC9A 2I1RA 4F04B 4K8RA 2YWEA 5D4OA 2EFGA 6FDRA 5HMYA 3T2MA 3UR0A 3KG2A 1IR2A 2E76B 1BT8A 4DR2F 2EW9A 4K8XA 5AG2A 2A9HA 3UDVA 2QMUB 2CTQA 3GFYA 2ITCC 4HACB 1RHJB 3D6TB 2QLJB 1HNWJ 4MH8A 5E79Z 1MW7A 3TUPA 3TJAA 5TISZ 3DGPA 2R3VA 1NDPA 2RUGA 4ZP7A 3J81Y 1TU0B 3H7HB 4DW0A 2E3CA 3THTA 2ZR3A 1N0NA 2GMHA 3GYNA 5E3PA 4A8SA 3AK3A 1M90T 3CGIA 3OE7G 2J0SD 5ITZB 2LA4A 3ULHA 2V69A 4ZVEA 1R8CA 4MTGA 5CB4A 3QGGA 1TP7A 3IC9A 2QSAA 2J9DE 1YF2A 1LWXA 3N28A 3SYZA 5LHIA 1Y5NB 2OFGX 4MVMA 3MUTP 2YXYA 3GIMA 4JI5O 3M8QA 1N5YB 1VC5A 5EDWA 1HWLA 1M5PC 1RT7B 5D6GA 2YQ3A 5D78A 3OW2R 1S9EA 1GNKA 3LP2B 3ZRVA 1BWEA 2B6AB 4ZPTR 4DV1J 2M8HA 4WBNA 2W0XA 2H4WB 5KX5A 1AJNA 5B0AA 3W2WB 2A6OA 4CS3A 3PYEA 1KMIZ 3F44A 3R6LB 1RCOB 1T9VA 1ZX3A 1Y67A 5CA1B 3AOAA 1SJRA 3GSIA 1VQLS 1FDAA 5C24A 1F5CA 3GV7B 1TA8A 3DOKA 1XOUA 2UXBJ 3FEYB 2KXFA 2Y1RI 4Q6GA 3AODA 3CJ8A 1EFRG 1U1PA 5J2TA 2JVDA 1U0SA 2ASLA 3CCQV 3RR7A 4B02A 3Q86A 1TVKB 2EJRA 2BJ3A 4R5PA 1Y66A 3MOJB 3IM8A 3Q4HA 1Y4MA 2AYGA 4X64F 4WJBA 4CP5A 3N6LA 5H9FJ 2GBOA 3CRCA 1IJFB 1L3VA 5BR8F 2E1AA 4MVOA 2FC9A 1S9FA 3A8KA 4G1PA 1M56B 4F3MA 2OCCB 4NLOA 3OVSA 3KDOA 4P2SA 1US6A 5CCLA 3ZC4A 4ZLLA 1NCLA 4UVBA 5D3GA 3KDNA 2G13A 4LF6O 3CCTA 1KQKA 4OXSA 3G8SA 1EP4A 4FYVB 5B08A 1G8MA 4ID8A 1W2BR 4FXVA 4DMZA 3TQ1A 2XMMA 4OYXA 2ADCA 3IP0A 1PPJH 2IM2A 1WTBA 5U47A 5DN6G 1XR6A 2PMHA 1V9PA 1IBKJ 2W8LA 3VF0B 4JAUA 1I51B 4PXCA 1YWXA 4AFFA 5B0GA 2M7SA 2W7AA 2VASA 4KIAA 5LMUJ 2NSCA 2O67A 3BCCH 1XHZA 3B77A 3FJ2A 4DZDA 1B7YB 2Q68A 1HHSA 3WIVA 4LSLA 3IC1A 3HVAA 2C2AA 2Q4PA 2R7RA 5CB4B 5JCOA 1WC6A 3CEDA 3A8TA 1O8BA 4MW8A 2ZWOA 2GV9A 3GV5B 4OYOA 2BCCH 4XAKA 1V5VA 3SBMA 4PEOA 1JMTA 4BWJA 3M8QB 5EWFA 3AJ1A 1QBZA 3L4BC 1S72S 3RB4A 1FKPA 3HT3A 3W7XA 2PDAA 2RNBA 3SR2C 3CXCU 2W01A 1DF4A 5LYJB 4DUTA 1S9EB 3UCSC 3SPIA 4WBNB 5KX5B 4PDMA 1J27A 1DLBA 1FPOA 1B04A 1FS0G 3BSCA 1MN9A 3F41A 1AILA 2H5IB 1DLOA 4IH5A 1N36O 1L3TA 5M2PA 1JLEA 2RILA 4IRKA 3NAIA 4AXJA 1K8AW 3D4JA 2WCXA 2U2FA 3AFGA 3PYGA 3TVYA 5AXLA 1C0UA 1F23A 3DOKB 1MG1A 4R0JA 4JZ2A 3RAXA 1KDNA 4USHA 4UCUA 4WKRA 2CJAA 2B4UA 4MTPA 5J2TB 3BR8A 2C2EA 4RL1A 2XGPA 3KMSA 2QN6B 4ED7A 3ILOA 3S7RA 2GNKA 5HJXA 4ZIBA 2AV5A 3CIZA 1IM4A 1FJGO 1HI8A 4R5PB 4MAKA 3BEHA 1NQTA 3QAEA 2QA1A 4A47A 2JFDA 5B3SB 2IM1A 2BJ9A 2JOQA 3NS6A 3CIMA 2G0IA 1WC0A 5KFQA 1VJQA 3KOAA 5D3GB 4RWXA 1TVRA 5KFFA 3CMQA 2BANA 1YRUA 3EE3A 3H2LA 2HHHJ 4P9SA 4E4EA 4FXWA 4RKUC 2DNOA 3FYEB 2Y1IA 2UZAA 2AJQA 3GP9A 4DV3J 3ISND 3FSYA 1I94J 5ETVA 5HVFA 4JI8F 1I5XA 2EIJC 2PEHA 4ZVGA 3FKSG 1XI1A 1NH2B 2RQ4A 4X88A 4H33A 3M7MX 4BR6A 2H4YB 4DN9A 3U0ZA 2UXNA 2B56A 3SDLA 4LSLB 4P9OA 3NXZA 1NT2B 3CCMS 2NXJA 2QFIA 4A8XA 2I6WA 1CJVA 3CNQP 1KKCA 4QW8A 1OQ6A 4MFBA 3STZC 4QJVA 1CG2A 3HHNB 2JRIA 3DXRA 5C5JA 1XERA 4JI7J 4U96A 1RT4A 2UUCF 1FKPB 3PX0A 1YK9A 2KYXA 2V94A 4DPXA 1VBKA 3PFOA 4HL9A 2HURA 4RW9A 3FCVA 2ZH2A 1UETA 4ZVQB 1RAOA 1D5AA 1NB7A 4LFAJ 4B3MF 2F1FA 3BGLA 2G9OA 3HULA 2VONA 1Q90D 1DLOB 3M9MB 4ZI7A 2NREA 1JLEB 3TAQA 3FBCA 5D4PA 3CB2A 1XQ8A 1N34J 3BABA 3IMQJ 1C0UB 1AFJA 2UUWA 3LA0A 2CTPA 1FK9A 3I82A 2IC3A 2MQNA 4FFBA 2ZH1A 4P71A 1EZJA 1K73T 1XEZA 4H44B 1HWJA 1WD6A 4UUWA 4ZLNA 4J7CA 5EN1A 1HQ2A 3A13A 2MDAA 4H37A 3FYIB 4ZVPB 4IT5A 2IM3A 5IT9U 2YNHA 4USIA 4O3SA 3FEXB 5EGYA 2MZ1A 1K0TA 2BR0A 3NXSA 1YZ6A 1I3OB 2EIMC 3R9LA 4JI3F 5EBWC 1B0TA 3FGVA 3KLVA 3HPLC 3WB0A 4U7UK 2FB5A 4XPEA 1RTHA 1PC5A 3CMES 4NASA 4FXDA 4JAVA 3HKCA 1TVRB 4F2SA 3RFRA 1CLFA 2N7CA 3HSGA 2P06A 1JLCA 2RHSB 1TL4A 2KYZA 1ZAXA 1MWQA 3BH7B 4WFBV 1U0HA 1GX6A 4O4HA 2ZH4A 3RRKA 4NXMJ 1GAXA 1YZ7A 4DFPA 3R3TA 4JZGA 1YITS 4FLVA 1CPYA 4ZVOB 1MROB 3FRYA 3HFVA 3ML0A 2HPUA 3KUEA 1GMWA 2E5IA 4Q2MA 1W26A 4F50A 3TNVA 4NTYA 1ACMB 5LBQA 1WEXA 3PJ9A 3SPCA 4JI1J 1EKRA 1YIJS 3TANA 1ROFA 2OGUA 3VQTA 1TUWA 1SZTA 1T03A 5KFEA 5DLGA 4AILC 2YKNA 1V5IB 1IBLO 2CNLB 3LUYA 3U02A 2XCPA 1H98A 4GKJJ 2ROEA 4QPXA 1CJVB 1S6QA 1YJTA 3U1LA 4MFBB 3MR5A 4DUYO 1X4DA 4JI5B 1YSJA 3STLC 5GONA 2OJ3A 4F3QA 1H7WA 3S3WA 2A18A 4PUOA 4UVCA 5KFZA 3JAMU 3M7VA 1FX2A 1RT4B 2VQFB 4YIPA 1RWOB 2IDLA 3I0SB 4RW9B 1XNQF 2ZM6B 5DM6V 3P3NA 1DTOA 1NHKL 4R8UA 1U1RA 2AZ2A 1Q86W 2Z0AA 4F0HA 3FVYA 1RAAB 1R43A 4DV7O 4DR6O 3RRHA 4USMA 4TSFG 2RIJA 4A8FA 2PFDA 4HDHA 1RWMB 2DNLA 1RT5A 4FIPC 3UVJA 2KG7B 4UCOA 1IXMA 1YSCA 3ICXA 2YPYA 1HNXJ 2VC0A 1FK9B 3RR8A 4CO1A 2IC3B 1R73A 4FFBB 1DAXA 3RAMA 1NI8A 1XMOF 1RKJA 2OMLA 2GVDB 4JI6F 4XBFA 4MTXA 3SGIA 4RNMA 1WEZA 3GB7C 2HFVA 2E9TA 1GMVA 1FVSA 4IRCA 3BR9A 2YNHB 1XR5A 1OY6A 1RWWB 2BQ3A 2YH0A 2KT2A 5DS7A 5ETRA 3W7BA 2BW2A 1SL0A 1M9NA 3MM8B 1P9YA 1UPGA 2B8PA 3UFCX 2OP5A 3TVZA 2B4VA 1MU2A 4XK8C 2ZE7A 1NM2A 1KBHA 1RTHB 4DJBA 4LF6B 1DTQA 2IYIA 4KRWA 1VR6A 3B54A 1LUWA 4OI2A 5JUMA 5L3CA 1JLCB 1VK3A 3N6NA 4B3TF 2QWOB 1NJIW 4NL5A 3ZZPA 2IU0A 2DHGA 4HEA9 1GXLA 3DDIA 4F8RA 2WA4A 4QWDA 2W0FC 3TETA 3X3UA 2IM0A 2JIZG 1BE3H 4WXOA 3HD2A 3DMJA 3THOA 4ZOLB 3CRAA 5ETNA 3ZZUA 4IRDA 2OT5A 3CRMA 1CQNA 3G82B 3I31A 1WUUA 4DV4J 2MEWA 5KG1A 5KHJA 3T5JA 5IV4A 1T03B 4OI0A 3NR7A 2DRAA 1FCAA 2YKNB 4EKWA 1KONA 2Y69C 4NRUA 1S6QB 2FL4A 3OTCA 1E79G 3NGDA 3OVAA 3RB0A 4WFZA 1MWYA 2MKJA 2E75B 4DG1A 5D0RA 2FTRA 1T9WA 4J9KA 2IH3C 2QZ8A 4DXLA 1P27B 5JVDA 2R8IA 1JJ2R 1SRYA 4EEQA 3EICA 4JI0F 3QZ8A 1HNWO 3P3DA 1OWXA 4R8UB 5CN0A 4DHVA 1WJZA 1UA0A 2R8HA 2B0GA 3TX8A 3LSQA 4FBUA 2MGZA 3BAAA 1N36B 3O9OA 2CADA 2WBRA 4F6RB 3BEGB 4IH6A 4MYUA 1M1HA 4MVRA 2ZZMA 2M7WA 3BB5A 5J2NA 2EIJB 3UVJB 3VAFA 1WHYA 1Y3JA 2P8IA 4G28B 1OSCA 4WP8A 2PZSA 2BOPA 1SJFA 4PA9A 3MFIA 4GX1A 2HS3A 2V9KA 4ERDA 3PR4A 2QGFB 2EILC 1RTIA 3RJMB 5IT0A 1FJGB 1SB6A 2QV6A 5H9FK 1NK0A 1RWKB 3CC2S 4CT8A 3MHHC 2FHKA 4DR5J 3MCNA 2QMWA 2BKPA 2FJBB 4FN5A 5E3QA 3EVMA 1T5EA 5AE3A 2DGOA 4KR0B 5EX0A 1S77D 3CVKA 1WHXA 4BW5A 1TFWA 5E7OB 4QGPA 1MU2B 3A8JA 3BBBA 2E9RX 1Y10A 4PCQA 4PG4A 5HJYA 2P5VA 4M5DA 3BBCA 1DTQB 4AL5A 2HIQA 3L74H 2QL9B 3T19A 3FBFA 4J42A 2CQ2A 3JCUZ 3W3SA 4JTCB 2ZM6F 3TZXA 3HHLC 2Y4UA 2JEFA 3GIRA 1GN2A 3ZZRA 5DQIA 3UCUP 4LNUA 1D8YA 3M6XA 4MIBA 4YB6A 2F3JA 3IBFB 3LDDA 4KJIA 4M5LA 4FF3A 4PI0A 2QKCA 4IO9Q 2VG6A 1U1QA 3BSAA 5LA6A 4GRSA 4YY3J 2Y8YA 3DMJB 5F8MA 2RE1A 3QTCA 2QMXA 3TA1A 3CD6S 2GAGC 4W4LA 3NGRA 4NXNJ 2ZHBA 3V6DA 3W1YC 4DUZO 3AOBA 4I9QA 3U7JA 2XCAA 2FVRA 2DWDC 3SQOP 1HNZF 1NH8A 2JVOA 2EIMB 1FYJA 3MTKA 3U1NA 5MLCV 1WSRA 4PG5A 4MTFA 3GJSB 5GAEU 4DOZA 4ES3A 4JV5J 4FLWA 4PAAA 2BV3A 2YX4A 4K4SA 3GR0A 5JVDB 2RDIA 1FKOA 4TYBA 1NK4A 4RZRA 3G67A 1RP5A 1JLFB 4Y34A 3W66A 5KOXA 1FD2A 5IE9A 1WDDA 3TO8A 3R7BB 2IJNA 3V81A 2GHYA 4DSFA 2XUMA 4ED6A 1GK9A 4RU2A 4PWDA 5LMUO 2V4RA 2OWOA 2QA4G 2C3PA 4LR3A 5J2NB 2P4KA 1VISA 3OFNG 2HVJC 3OGIB 3CCJS 3OPKA 2EKNA 4QIWD 4B9SA 3FNNA 2UP1A 2CG8A 5HLFA 5HAOA 4KFBA 1RWNB 2JEGA 2XAGA 1JIHA 1PNMA 3NS7B 3BSOA 2DIVA 4KHPF 1R31A 3G87A 2BX6A 4P6QA 4J9LA 3OUYA 4LFBF 1LNQA 2HRYA 2X1GA 2EG1A 1N54B 1NH7A 4X4NA 4NLQA 4WIQA 4X4UA 1PIEA 3KTQA 1PKXA 2DGUA 4USVA 4DQQA 5IWAJ 3SPJA 4S0MA 1M5SA 3CCVV 1NRKA 1WI8A 3CP1A 1RFYA 3K7RA 3B82A 4IFYA 5ETMA 4ID5A 4NLPA 3S01A 1NVPD 4M5DB 2C2OB 2YKPA 3DC2A 1GT8A 2XAQA 3IJ4A 3R97A 1GKFA 1BY9A 3ZX6A 4YFUA 2U1AA 4CLYA 1VQ7V 1HD1A 2MHNA 4UT4A 4ZK7M 3T1YO 4X66F 5BZBA 1WDTA 2LGQA 4QR0A 1VBZA 3BGUA 3WB1A 1AP5A 4A8MP 1KQFB 2Q0OC 2GC8A 2VG6B 5B0BA 2J0WA 5LA6B 4LREA 3CCWA 3CE8A 4I0XA 4LF5O 4QIFA 1APSA 1NMEB 2UUAJ 2ADPA 3OTDA 1VQOV 3ZRWA 3QGIA 1RYSA 3EDRB 3HKEA 1SBRA 4G65A 1SQQH 1AA1B 1IBLB 3D0IE 3GU0A 3MM9A 2N05A 4DUYB 4I68A 3PW5A 4J41A 3GLJA 2B5JA 3L7PA 3APQA 3WC0A 1PCAA 2HHHO 3BZQA 4KH0B 1XBLA 1XMQF 1RE1B 3W9IA 2V50A 3RYFA 5B1AC 3DCAA 4PA6A 4KTQA 3D6HB 3A0BZ 4DV3O 5KFDA 1CC7A 3IS9A 5LGNA 3CDAA 1NSPA 2A1BA 4DV7B 4X62J 3U27A 4DR6B 3LAKA 3V81B 3M8YA 2H94A 2QWPB 1O51A 2ACMA 5J1PA 2W8KA 2CJQA 2Z56B 3QWPA 5RUBA 2XTAA 4QCLA 1FTCA 4PWDB 1J95A 4DS5A 3GIJA 4C4WA 3PJWA 5L1IA 1RAIB 2VU5A 3CB4A 2DO4A 1K33A 2V8PA 2IJKA 2MQOA 4LFCF 4LUBA 4U7OA 2GVZA 3LDCA 4ZCKA 1W2IA 2XSJA 1E1QG 4WFEA 3DLKA 4KFBB 4C11A 4DPTA 4KE5A 4ZCMA 1VQ8V 1EKSA 3N5BA 2F9DA 4E2FB 4F7VA 1K92A 3TX0A 4EGLA 4WK3A 3OUYB 4M1KA 1S0VA 2Y69B 4JI7O 2E5LB 4X64J 2D3UA 3MD1A 1NU4A 5BR8J 1RPOA 1QLNA 1LUVA 3E51A 4RR5A 4JV1A 1SKVA 4LFAO 2YH1A 2ZE5A 4IFYB 1PAEX 5L3DA 5EIBC 1AXQA 4AQYF 2VJUA 4ID5B 1H6KX 3DYAB 2UU9F 3T9ZA 2BJ7A 4B3SJ 3JSRA 4WE1B 1HR0J 4LRDA 1Q82W 4CTAA 4ECUA 3SIPB 5IYDO 4ELTA 4RBTA 1S4EA 2CQ0A 1U09A 1N34O 3D9BA 3H98A 3MR6A 1N5QA 4TY8A 5A8RA 2XHWA 2IAJA 1VIOA 2L08A 2DGSA 3ZMTA 4X4OA 1GAOA 4NE9C 2N7YA 4DV2F 4NZ7A 2FVCA 5KFUA 4MVZA 2DE0X 2ABYA 5ETPA 4I0XB 1TL1A 1TKZA 2V2QA 1F6TA 1HA1A 1PYOB 1RISA 3ZRWB 5L3EA 2DR7A 3EGVA 1VCTA 4P73A 3SCLE 1HIYA 4J9VA 4DI6A 3Q24A 1BQXA 3HKEB 3HMJG 1TZ0A 2HHVA 5CA3A 3HCXA 4ECQA 3MM9B 3OT9A 3MEEA 4RNFA 4OV6A 4ZLPA 2MKSA 2UXCF 2VQEF 5BYQA 3WBZA 1GX5A 1NSAA 1RAFB 1QNMA 4H4MA 3RBZA 4K7QA 5LXTA 4RW6A 4Y00A 4JI2J 1RGVA 2H51B 1XBWA 5K14A 2VHGA 4A8KA 3SYQA 4UY8T 1PD3A 2HW3A 5GTHZ 3RYFB 2EFNA 3HZGA 4NXMO 4KT0C 1AVMA 3IS9B 4HBNA 3L3CA 3QWUA 3CCQS 4WFHA 3T1AA 4MVUA 1NO8A 3HHLB 1FXLA 2DYSC 4WIIA 2XO7A 1THZA 1ZH5A 2DNZA 4ZPCA 1SUQA 4JI1O 5EYPA 2V8VA 4LR8A 1SL2A 1SA0A 1YTYA 3E83A 4KP4A 2GVZB 2KO1A 4GKJO 2XSJB 3RB3A 2R7OA 4C11B 3DLKB 1OYDA 1Y74B 3T1CA 1SC4B 1H2TZ 4IYIA 2XT9A 2LDIA 3BQ2A 1LW0A 1FFXA 1NUEA 3ETGA 2LW7A 2ZD1A 1WNEA 3G8QA 2R8JA 4KGVB 3DGVA 4G2KA 2Q3PA 3D2WA 3PO4A 1RXOB 2AJ1A 2BKNA 5LXYA 4L3KA 1Q7YW 2VFTA 2GDSA 3SJBC 4DL0C 2AHZA 2LEAA 2R7WA 1SC1B 3KJVA 3OEHG 4KGXB 2L6LA 2XAFA 1YDLA 2ILYA 1SJ4P 2WVFA 4C6AA 1S97A 4AYBD 3AXMA 2ADBA 1XMBA 2NR0A 3QJPA 1N33F 2VD3A 4CTAB 3EMTA 2L9WA 4ZPBA 2EBGA 3LP0A 1VQYA 1FVQA 1WF1A 4F2RA 3NP5A 4N76A 2K8GA 1HNXO 1NAQA 4TY8B 5A8RB 1WB8A 2IAJB 3MMJA 3GIKA 5H1SV 1FJEB 2ZBPA 2DGWA 4JI8J 1HDJA 3C90A 1Q81W 3UCZP 3ETDA 2M8DB 1NR1A 5AE2A 2QDOA 3E01A 4P7TA 3PTWA 1T9XA 2HK2A 3KLIA 1TL1B 3RW6A 3W65A 2RNEA 1W25A 2FHJA 3CUNA 1RTZA 4G3IA 3NCRA 1AZSA 4DUZB 3L7OA 5IYZA 2B9YA 3OR6C 3MEEB 4O0IA 2H54B 1EJ7L 3BKFA 1OCCC 1QR8A 3M6VA 1Y76A 4GUNA 1QD1A 3HHKA 4H4MB 4Q8EA 2PC6A 3M2VB 5CZVA 3J7Z5 5K14B 4UUJC 1V3SA 3VQSA 1Q3EA 3TAMA 2GQ2A 4I2PB 2UUCJ 1P1LA 1RBAA 4ES2A 1FJ7A 4JUZA 2UVRA 3POTA 3FRZA 3H1IH 3MZIA 3QNWB 1S5ZA 1N5TA 3IBWA 4O4JB 3BA8A 2Z0GA 4F36A 1S49A 3QSYB 4Q8FA 1SH2A 5E0OA 1HNIA 1Y00A 4B3MJ 2A10A 5A9GA 2G0CA 5A2QN 3ONQA 4ZLJA 1TMJA 1D9DA 3N9UC 4ELVA 3H2VE 2AYBA 1QSYA 3NGKA 3ZFVA 4DV4O 2CQIA 1RPRA 5EYPB 3HI9A 5J2UA 4OHVA 3P30A 3EYZA 4CLLA 4RW4B 1CXZB 4TKTA 4PG8A 1SA0B 4DL6A 2J9CA 2MHEA 1SKWA 2YWHA 2ZKOA 4DQIA 3TXQA 5KHHA 2WTFA 1T8EA 1U47A 1L0NH 4PA7A 2DXDA 2E5JA 4LRBA 4HI2A 1EBOA 3ZTRA 2KZZA 4I6AA 1M57C 4J91A 3BS9A 1LW0B 1FFXB 2RN9A 3ZZTA 3N2GA 4Y2CA 1EQMA 4HLBA 1XK8A 1N32B 2YNGA 4JI3J 3LANA 4ZHQA 3PRVA 3I5BA 4DR3F 4OI1A 4Y2KA 1FO1A 1L3KA 3KJVB 5F8GA 3R6GB 2FJAB 3ITHB 5B1AB 1VDHA 2HS4A 3MUVP 3W2VA 1HKAA 1FKAF 3ICLA 2DY1A 2X1BA 3SPHA 1F3VA 4GZRB 3ZMZA 3BQ0A 3SV3A 3T1YB 3HPOA 1FT8A 4UCTA 3MDSA 4USTA 2HRTA 2CJKA 4PZVA 4GX0A 3TARA 4I50A 5HFMA 3FX7A 2YXLA 2CPEA 4TUYA 4J10A 2DNGA 2V2KA 2J9DA 2E1CA 3OGCC 4DL3A 4O2BA 2EFPA 3C6UA 1AB8A 2ADQB 4HI1A 2CIMA 3GILA 3E01B 4OJ1A 2E1RA 4JYCA 4LF5B 3KLIB 1GXTA 4L73A 1T9YA 2DO0A 2EPIA 4I9WA 1B0VA 2HFUA 2UVUA 1SETA 2YWFA 5LHHA 3CDUA 1X9SA 1UA1A 2H5EA 1VARA 2BDPA 5IYZB 2EXUA 1RKIA 2K1RA 4DQRA 4HAMA 1YI2V 3QLHB 1PM9A 1JX4A 2AKWB 1RWPB 3K5PA 2XTJP 1Y76B 2LGWA 2FJEB 3KZIZ 1U2FA 2WVBA 3QMQA 3HR0A 2HHHB 4ZBMA 3FDSA 1VBYA 4CCHA 2XC9A 3VAKA 4MKVA 2WLMA 5CHCB 3TAMB 4FKYA 2CPHA 2HNYB 1K8AT 3MR7A 4C48A 3GVMA 4DV3B 4BWAA 4LRAA 3O65A 3RGBA 1I7FA 3QIPB 1YJWV 2RCVA 1JJHA 4KBIA 2MLYA 1QAIA 3HD1A 4F02A 2B5UA 3OAAG 4ZVFA 2YIBA 4YY3O 5G4DA 1M5HA 1TR0A 4DEZA 2BEFA 1NXIA 2WK4A 5KFNA 1M1KT 2YTCA 1WKJA 3KJFB 2CPZA 3TXSA 4NXNO 3W5XA 3PN1A 2QYGA 2LFSA 4TOIA 4ZVHA 4J9YB 1WACA 4N8NA 2G2OA 5IQ6A 1HW8A 1SH3A 4A48A 3W60A 2CVEA 3NRBA 3UO2A 2GIFA 3CF5Q 3PZPA 3KFWX 4OHYA 1J5EF 3BY6A 3CD5A 1LFPA 2Z2ZA 3S3XA 4JV5O 1VI7A 4HH0A 4ILMA 3N2GB 5E41A 4EFBA 4UUXA 2OTLV 4UOHA 1HL6A 4CM0A 4DPWA 2DR5A 1R6KA 2VS0A 1Z1ZA 1FF2A 2YNGB 2VFVA 3O5TB 4JI4B 1Q7LB 2UUBF 4ZHQB 4FLTA 2J8SA 1KVIA 5IS2A 4O2AB 3QO8A 3AJ2A 1BGXT 2A3QA 1E6VA 4ZJOA 3KHLA 5L1KA 3JCZA 2AYMA 3W2VB 1RTDA 2CVIA 5E1AC 2E7VA 7FD1A 3JSNA 1H74A 2LDYA 1DF5A 4PPZA 1YJNS 4B3TJ 3R1HA 2DYSB 2WHOA 2B4OA 2JJ1G 4I50B 3D0HE 2J6UA 1ZOTA 4TUYB 4LF9B 1F1BB 1JXVA 1CEZA 2D3O1 4DV0F 2BTOA 4ZVTB 2BJEA 2PYLA 3DHWC 1TKTA 3C6UB 3FEZA 3OSNA 4J11A 3ZCCA 4F6EA 2F4VB 1PBUA 1KRPA 4GX5A 3ZNJ1 1S0MA 1YTFD 1NKBA 4N23A 4KB7A 2WAQD 1SQPH 1PNKA 2E1PA 4IDKA 5GAEI 1M0SA 3DSQA 1FE0A 1XC9A 4LF2A 2KXHA 2R2SA 2XOKG 2CAZC 3CJKA 3FFQA 3JTOA 5LMNB 2HVKC 1GMWD 3C16A 4LF7F 4J7JA 2R9IA 1K9MT 3N01A 7AT1B 2MQPA 3NNAA 3ZN0A 2VG7B 1FFSB 3AY0A 5L39A 3UR3C 4GKKF 1GMGA 4LBEC 3CE2A 5KT5A 5K20B 2CQ3A 3RVYA 4IIJA 5DZ6A 5KHGA 2V4JA 3OHAA 4K2XA 5CA5A 2DNHA 1R6NA 2BXJA 4JI0J 3VALA 5JVHQ 4FBTA 1Q0NA 1OV9A 4W4MA 1OPIA 1VRTA 2AZ1A 4FM1A 1WC4A 2CJXB 1UVJA 2JFKA 5JH7B 1TK8A 4CQ1A 2RU9A 1U02A 4IG3A 3V4IA 4JI1B 2FHOB 1FRXA 3DM2A 2HR3A 4HYOA 4X9QA 1QVGR 2Q79A 5GMEA 4NVPA 2N3OA 3U11A 2B7CB 4DSKA 3ASNC 1WA8A 4GKJB 1OYEA 3EJMA 3TRGA 3B8NA 1KD1W 4A4JA 2LP4A 1VHFA 1RYRA 4FS2A 5C2CA 4QWBA 2AT1B 5AJ3J 4ETXA 2NZ4A 3QT8A 1IWGA 1YQHA 2HHQA 3W64A 4MW3A 4LSZB 4N21A 3T6JA 2HQFA 4FFKA 5ETOA 3JSMA 3ZEDA 1OCCB 3OBIA 4PQAA 2VODA 2RQCA 4XTTA 4E2LA 4NYOA 4FF4A 4OQJA 3DI6A 4KYZA 4Q45A 2JVRA 3T1HF 4DV5B 2QA2A 4ICGA 3FAVA 2VQFJ 1RTDB 3MEGB 2H1YA 3GSDA 9ATCB 2ZM6J 2JX2A 1HNXB 5KFLA 4DF8A 2EFOA 1FNMA 1GQEA 3F56A 5F8IA 5FDLA 3TUZC 3SDEA 2FJXA 5IV3A 3KK1B 1GTHA 3UDLA 4ECSA 1X4AA 2KHCA 1HW9A 3EDQB 3TEHB 4QNHB 5F9LA 3B40A 5L3BA 1S79A 4X64O 1J5OA 2ASDA 3CPWR 4DW1A 4OZ3A 3KLGA 3T41A 1Q1KA 2Z58B 2X1FA 3ZTOA 5BR8O 3ZHQA 2WWWA 4UOGA 3CJKB 1M57B 2QE5A 4I5SA 3CEIA 3C16B 2YQ1A 5CQGA 2A0LA 4RUFA 2WLLA 1RAJA 2OPRA 3CRRA 1O6XA 2HQIA 1W59A 2JJ2G 2H3OA 3F73A 1HR0O 4PHZA 1HWIA 1RTJA 3C3LA 2DWEC 1PO6A 5SZTA 2KXNB 4KKOA 1HBUB 2B1IA 3UT5A 3TWZA 3HO1A 1PV0A 2V4JB 3ZTQA 1P8GA 1EZZB 2E7XA 3GJQB 1YHQV 3UM7A 4M5NA 2QL5B 3U10A 2HK3A 4LVNP 3RRGA 4O3RA 1VRTB 3H1JH 3OLAA 1NDKA 2ZBQA 2RQKA 1RT1B 4EMDA 4IG3B 4EZ6A 4CH1A 4DV4B 3V4IB 5KFTA 1F9FA 2P22C 5ADZA 5IDJA 1U2RA 3W7UA 5B0DA 1TAQA 1SI9A 1UEKA 4ZN3A 2Y3YA 4DL4A 2YQ0A 5KMGA 3JTNA 3K0JA 1SERA 3CJ5A 2GQQA 5A2QY 2AXTZ 2OUGA 2QR4A 2CNKB 4CH3A 1WOPA 2V67A 4GC7A 3TAPA 4ABMA 2G4BA 3L70H 1FD8A 2VUGA 2LYVA 1VQ6V 4PDVA 4K4ZA 2CG4A 3I56V 1X4GA 4ZMMA 2DTJA 1MMNA 3HVWA 5LMNF 4RW8A 2HHWA 5EHHA 4N56A 3K5OA 5EZYA 3H5UA 3DI6B 4M5JA 1NJIT 3VQWA 3CDWA 2DHXA 3FB5C 2ZIOA 2V68A 3HFKA 3OQ2A 2XY5A 3LDEA 4UCSA 1PKUA 2M9KA 3NKYA 4HT7A 1RHMB 3AD8C 4FDFA 1VRQC 5F0UA 1CS4A 2D3OR 1TQLA 2HEPA 5HQMA 1XWLA 3LW5C 1U1NA 4I6WA 2B9EA 3HT0A 4RNOA 1VQPV 4X66J 4BIUA 3LOUA 4U6PA 1TUBB 2BE2A 3SDEB 1N5SA 2G1HA 4ICLB 5IJ9A 1NSQA 3ET6A 2BM0A 3UQ8A 1U49A 5DDQC 3BDEA 3NOGA 4ED3A 3SMZA 1G4CA 3WZ0A 1ZBTA 2RU3A 2BJDA 4OYIA 4PXBA 2MQMA 3M2RA 1J5OB 3KLGB 1S1VA 1JR9A 3TCUA 3G6BA 1PP9H 2HBRB 2BTQA 3MCSA 1ITPA 4LT6A 3G4SV 4DPYA 2W6JG 1DURA 2CPJA 3FZ2A 1FJGJ 2CPIA 2YDEA 3DKDA 3CJHA 1W0KG 2CAJA 4NB5A 4Z7YA 3PDNA 1B4SA 1RTJB 2ZBRA 4KKOB 4FPPA 1S6PA 3MEDA 3UT5B 2B4PA 3TJ8A 4O4IB 3ZTSA 2L48A 2ZNYA 2ZFHA 4C8OA 2DW4A 2ZEJA 4C9DA 4U7UD 4DS4A 1MSWD 2K3KA 5KG5A 5LP6A 1V6HA 4IKAA 3Q8VA 2WSEC 4BCAA 1R8BA 3CJ2A 4JI8O 3SYOA 4YY3B 3H20A 2D1CA 4B3RF 2YUAA 4AHCA 4E8UA 1FE4A 2GO9A 2IPOB 4ED2A 2XULA 5KG7A 1ZWIC 3Q2SC 5K5MA 5DDPC 3CCVS 5A8WA 3I5CA 4HKQA 5KMGB 1LWEB 3GONA 1MZFA 3PEHA 4UZBA 2MQLA 1QLEC 4I7ZB 1D1UA 5ETSA 4HNAB 3ENQA 1ELOA 1UW9A 5AXKA 3PW7A 1VQ7S 2Q43A 4HTIA 4ZIVA 4DR1F 2IU3A 4DZ6A 2UUCO 2DVIA 4RW8B 3CMAV 1PYSB 2XY7A 1HARA 4DU8A 3AHPA 2KB1A 5EZYB 4V19J 2XLIA 5DZ7A 2XI2A 4JYAF 2GTSA 1FESA 2DIUA 2QE7G 1EB0A 1UZDA 4B3MO 2MZRA 1IVZA 3T4DA 3KMQA 1ORQC 4USWA 3VR1A 5CABA 2KI2A 1ENVA 3HKBA 3D54A 1VQOS 2IMOA 5M2UA 1T02A 5B0FA 4J9RA 1QM9A 1FXHA 3QPIA 1FXDA 2JEXA 1NJYA 4JYBA 3RW0A 5C2GA 4ZP6A 5IJ9B 1VQ4V 2V4DA 2RT3A 2O1PA 1RT2A 3ET6B 3WX4A 1LFWA 5KHIA 1PG5B 4RO2A 4W4KA 1FRLA 3ASNB 4P72A 2GV1A 3VVTA 1BQZA 4ZIWA 1T7PA 3D6MB 3E35A 2YPZA 2XQCA 3BM7A 3M2RB 1M90W 2KFYA 2VPYB 1S1VB 4JGSA 2Q7EA 3P3PA 2HLTA 1RAGB 1F5BA 2Y0IA 2ASJA 3EHBB 4JI3O 3G6VA 3UD3P 1B0PA 4D6TH 1S1XA 3ZHRA 1H2NA 3W7TA 2I38A 2XYGB 1OIAA 4CH6A 2AEFA 2VQEJ 3CJHB 2Z5UA 3C15A 2RRNA 4K5RA 3QJJA 3BHPA 4MK9A 2BKOA 4RLEA 4DR2B 2IBKA 3OFGA 1AJQA 4OX9F 2D69A 1S6PB 4TU7A 3MEDB 5K8OA 1TAEA 1P9QC 3OMNB 1S59A 2QC3A 1LWFA 3SV4A 1W0JG 4P30A 3MR2A 3CC4V 2V8GA 1VQ8S 3DLGA 1YJRA 3TOQA 4X4TA 2RKIA 2YKMB 4IYQA 1P7GA 1K44A 2MSTA 3ZRXA 2CQHA 4N8OA 5FD1A 3BH6B 2L35A 1N4CA 3A2FA 2IDEA 1H73A 3PO5A 1M4UA 3JASA 3KYLA 2WSFC 1MSDA 3KNAA 2LU2A 4B9UA 1RJJA 2Y4TA 4TLRA 5ETTA 5LSRA 1KQSR 2YSUB 3VAMA 1U1OA 4WU3A 3TJ9A 2ZJRQ 1XL6A 2AZ0A 1MMLA 3K9SA 3L7UA 3T9NA 2L41A 2QIFA 4OHZA 3ZO7A 2VRZA 3UO0A 4MJKA 3AJDA 1NBEB 2XEXA 2Y0BB 3TQEA 1UFKA 4I4BA 2LW1A 1RCXB 5A6PA 4FZVA 1JA8A 1WPBA 5KFRA 5JJEB 1HPZA 2I9SA 4X20A 4OZLA 4WFNQ 5E3AA 2Z57B 3TEGA 1JVMA 3CC7V 4TQDA 2WA3A 3D8CA 5CA0A 5IC4B 4FLUA 3CCSV 1F4NA 2HQ3A 5KAKA 2NPFA 3HVRA 3IXQA 3DRPB 1FDNA 1FFGB 1VEWA 3OJSA 2DH9A 4DK1A 3P96A 2J7UA 4J90A 3W9JA 5HMZA 2AD9A 1NJWA 1CJKA 3PHEA 2RMKB 3OTOB 1ZTWA 2YKAA 4RWWA 4DR6J 1PSDA 2FVSA 2XMKA 1IKXA 1Q5OA 4QIVA 2M70A 4RW7A 4OPAA 1NZ8A 3K79A 1S48A 2WLKA 2QM4A 5L1LA 2QTOA 2ACYA 3OM3B 4IR1A 4LBPA 1KLNA 4DCPB 3JQMA 1YEWA 1KVJA 4X64B 2KB2A 2W2PP 2J0XA 5D15A 3B4DA 4K35A 3RYLA 3DXBA 5CBFA 1YJVA 1U25A 3EFFK 5BR8B 1MMMA 2F8MA 5B7WA 3Q8UA 2XNQA 2HNDA 5B3SC 1F0XA 2D3OW 1S1XB 1UMJA 1Y7PA 4IYHA 4UQTA 1OQ3A 1WN7A 4EWTA 4QJFB 2O01C 1SQGA 3C15B 2OI2A 1NKDA 1A7GE 2MTLA 2E5LJ 2AYEA 3E22A 1F51A 3WDOA 5B5EZ 2UV8A 5JQGA 2HLDG 3QT7A 2MSSA 1YBAA 4L76A 4NEZA 4NKGB 4B3TO 2R2UA 1X4TA 2YI9A 5GADI 3AB2B 4X4RA 1LW2A 4ANCA 1HBNA 1TV6A 4ZPWR 3Q2TC 4EBCA 4QYRA 2DNNA 1XILA 2FJWA 2WB1D 3WFVA 5DG7A 1R27B 2WAMA 4J9PA 3VAIA 1PGZA 4QBUA 1FRHA 3RUBL 1SQEA 3I0RA 3BO2A 3BPDA 2W2MP 3O3LA 1DQ8A 4IR9A 1KLMB 1N8RT 2CNOB 1VK8A 3M30A 1CULA 1VQNV 4Q7AA 4X1KA 3HDSA 4OYBA 2HVDA 4PXEA 4K4WA 4QYZK 1ZAVA 4MVQA 5JCOC 1LR1A 3QO9A 3J80Y 3Q8PB 1TK0A 1NVPB 5HVGA 3K5LA 4KPYA 3QO7A 2BE7D 4DR4F 2R9AA 3ZJZA 1QE1A 3ABMB 5FLXY 4Y2IA 1FXKC 3GYXB 3I87A 1URRA 3GV8B 4JTDB 4DBQA 2XLJA 4O4GA 1SJ3P 4X20B 3OLBA 4JI0O 2L3MA 2F43G 2ZVSA 4C3LA 3CULA 1HNWF 2CJBA 2XAHA 5IYCO 1S1TB 4PABA 4UVAA 3K03A 5CA0B 3TZZA 2W6IG 4ZN1A 3OW2U 2M6YA 5KFGA 1RHKB 2KZMA 4F4XA 2PMZD 3W9HA 2WLIA 2FDNA 5HBMA 2BM1A 1K5QA 3JYTA 1TUVA 5L3GA 2I8EA 2HZCA 3MTJA 3EZOA 1FRJA 2FJVA 2R7XA 1H2UX 3PM9A 4MK8A 3GQCA 3OXGA 2HZAA 4PELA 2VFSA 2CQBA 1N6QB 2ZZTA 1Y9OA 2LEBA 1IKXB 1S1UA 2ZKUA 4RW7B 4EO6A 2DQ0A 5KFJA 2NNUA 1DARA 3RYHA 2XBPA 4RNNA 2Y1JA 5FJ4A 3NG8A 2HAIA 4CRJA 3PCOB 3R7NB 1QLEB 4XO0A 3RG6A 3F7VC 3EPGA 4GVLA 5H9EJ 3W5YA 2PY5A 1R3IC 3J7AN 4AXIA 2MKHA 2DK2A 3LWLA 2HNDB 4DV1F 4U8VA 2G38A 1ZSPA 1WC3A 2ZHAA 2ZINA 4ECZA 4U3FH 4WP3A 2FHJD 2GMJA 3MCMA 2MJUA 1GM7A 1DK1A 4WZMA 2GO8A 3R5CA 1R1BA 2Z4PA 2JL9A 2VQFO 3E22B 3PW2A 3UPFA 2KM8C 2ZM6O 5JQGB 3MD0A 5E33A 3H5YA 4P2MA 2C1EB 4NR1A 1TV6B 2UXBF 3R2DJ 1EZVH 1W2BU 5CD4H 4JI8B 1Z2LA 2WOMA 3FUYA 1KC8W 3D67A 5EIBD 4ED8A 2FB0A 3IWXA 3FQLA 2YBVA 5IQQA 3GG1A 3VGUA 4CYUA 4EUVA 3I0RB 3X1LB 3OTOF 4YJ2A 2W2NP 2F95B 4C7QA 4NX9A 1Z2GA 4KXRA 4X1IA 1RZMA 1Z4UA 2DT9A 1EM1A 1K73W 3OXFA 3PXGa 3CD0A 3KUGA 4OI6A 3MM5B 4WF9V 1G3OA 4NI2B 1SQXH 1OJHA 3MD3A 2VBYA 1BGYH 4IHJA 2V2ZA 1QE1B 2FLPA 4DUZJ 2UUCB 1JLAA 2VA3A 4O4GB 2ZVIA 2HGNA 2V63A 1Q8BA 4B3MB 3KCYA 5KFAA 3K0GA 4ALZA 1GFWB 1IBKF 4NMLA 3ZZZA 4Y65A 2J5AA 4ZPAA 3H2UB 1X5PA 1Q81T 4ZJQA 2WLIB 5HBMB 1KB9F 1IR0A 2OPPA 2ROPA 3H5XA 4LF4F 2JC1A 4ZPVR 3JYTB 5LMUF 5KFCA 2PTMA 3G6EV 3MPVA 3PFEA 3DGPB 2I2YA 1FNOA 1QTNB 2GAHC 4TLQA 1BQNA 3MM7A 4WP9A 1XN9A 3E8GA 3R5JB 1PL4A 1S1UB 2OEKA 4KV8A 4O44A 1K4CC 1T95A 3RYHB 2XYHB 2CK3G 2W9CA 2ZH3A 2DOSA 4QR2A 2W4DA 1U4BA 2ZKTA 3TR5A 3WHIA 2E5HA 4J37A 5KFKA 3BF4A 2MY7A 5K1PA 3FZBA 4JI3B 3E8OA 5IZHA 5KFMA 2XHBA 3PIPQ 3APOA 3PV8A 3IFXA 1XTZA 2AIRB 4NZ6A 2K1EA 2MXYA 2XM3A 1FXKA 2D74B 2E29A 2GHVC 5AXMA 4DR7F 4OMFG 2B3TB 2FGCA 1P4RA 4ZVUB 1N32J 3I32A 2MK3A 2OKQA 4GKKJ 2WW4A 4O3NA 4LQ3A 1H2MA 2IFXA 2HHSA 3HSJA 2XGQA 1X9MA 3IA0A 4X66O 2LQJA 2IBOA 1VQ5V 3R7SB 2XMJA 3Q0AA 1CSJA 4HR2A 1MA1A 1ZLZA 2B7BB 2ZOFA 3T4ZA 2C2KB 1B06A 4H0LB 3TUIC 5C24B 2HNZA 3T1YJ 2OTLS 2HSEB 3QG5A 1DTTA 2CZVC 1X9WA 3TYTA 3SEOA 1KBRA 4RUBA 4X1IB 2YIBD 2HQCA 4XDKA 4CZZA 3ZHSA 1FXRA 4TU9A 1WLEA 3EGWB 3LUTB 1VQKV 3Q4HB 2HFNA 3K08A 3DXSX 3I5DA 4LF5J 2H5JB 1T3NA 5KG0A 3FBEA 1JLGA 3LO3A 3ZHVA 3FSIA 1SV5A 4FNIA 4IHJB 3D3QA 4PD4F 2XG8A 1ZAUA 1JLAB 1UVLA 1FFWB 1XMQO 3I4HX 1U7LA 2ILZA 1XNQB 1R6VA 3E8BA 1RT6A 5GAHU 5CYJA 3IN5A 2ODMA 5HANA 1I94F 5HQLA 1EP4B 3T1HJ 3FMBA 3OXLA 4UCRA 1KYOF 1M5OC 3HHEA 4YB7A 3CMEV 3JQKA 1FWKA 1R0AA 4I67A 2OPPB 1LEOA 1AJPA 1QY7A 2VWKA 2OH2A 3NCPA 1FJCA 1URNA 2EZPA 3G71V 2XLKA 3AEIA 3T5KA 4LFCO 2ETNA 3MM7B 1XMOB 4PRFA 4XDCA 4JI6B 1X0PA 1WC1A 1Q8IA 4KV8B 4O44B 2O57A 2MPUA 1YITV 3ILJA 1DY3A 2W9CB 1GM8A 4ITSA 1WAZA 2YKOA 3MWBA 4QWAA 5C7PA 1IBMB 2Y0PA 2PA8D 3DU6A 4JI7F 2K2PA 2D41A 4GMKA 4NPOA 1PJ6A 2UUTA 1AYEA 2LA6A 2VPWB 4ETZA 5I3UA 2NXUA 3CJQA 3JXOA 3PY8A 4TYAA 1B6QA 5LT5A 3ETQA 1TUEB 2XMWA 4UW2A 1U6ZA 4RO0A 1FXKB 3JAMN 4LFAF 5KHKA 4BHQA 4AQYO 2Y8WA 1E6YA 2MZSA 1IURA 2UU9O 2LJ2A 2DGVA 4NLXA 5KT7A 1X4CA 4F4WA 4EU0A 4ZITA 4OJGA 5KA6A 4L74A 1HQUA 4KO0A 3O1LA 5EC2C 1ZTTA 3CJTA 4JI4J 4B3TB 3M2UA 1WG5A 4QIGA 1N34F 4RUAA 2HVEA 2JEUA 2C3OA 5ETQA 4A8OA 4WFAV 2YS8A 4TV9A 4ZP8A 1Y3KA 2C42A 2CJYB 4D7TA 2Z8QA 4TNOA 2DNMA 2DJVA 4C7UA 5L9NA 3MMCA 3P4UB 4DV2O 4NRTA 1R0BG 1M5KC 3J7YI 5E3RA 3PNIA 3VGSA 2R7SA 2HNZB 1BLUA 1NPRA 1DTTB 2YWKA 3BGFA 2HG4A 4LF9J 3JB9k 4I1TA 3THVA 2CZ9A 5EBLC 2L9DA 1HYSA 3GR1A 1YXBA 3SJQC 2XS7A 2PD1A 2F4VJ 4FPIA 2VQEO 5I4MA 2EFVA 2RJZA 3D7SB 1XDCA 1L3SA 3A3PB 4ILLA 2OEMA 1BQMA 4Z2XA 5FNVA 5LMNJ 3N2KA 4K2JA 4JI0B 4UV9A 4DRXA 3NS5A 1S7IA 3M8WA 2GZOA 5F8JA 3H01A 3QT6A 4NXMF 5T14A 4DPUA 2RDDA 2P6JA 2VDHA 2BANB 3ZMVA 2KM8B 1R6TA 5G0RA 3NBPA 2VA2A 4K4UA 4LIWA 5F2VO 3Q8SB 3WC2A 5CCMA 4WYWA 3LNMB 1REVA 4NLDA 5IOLA 4WTOB 5ETKA 4P2ZA 2O3DA 4DU7A 1B99A 1Y6XA 3MCOA 3QZ7A 2HWTA 4YXWG 4F26A 2Q1LA 4URQU 2EC0A 1C0TA 1OS5A 2JC0A 3MAQA 3CXHF 1I0HA 1N52B 2VKZG 1AROP 4UFZA 2CWXA 4P74A 5J1EA 3CCLS 2KT5A 2UXDF 3BDPA 2HP8A 4CC5A 5SUHA 4LBHA 3H8YA 5I3UB 4DX8H 2E9ZA 2G2ZA 5D77A 2AEJA 3CCEV 2CYYA 4TQRA 3EPIA 4NEYA 4YDXA 4CO3A 2WRMA 1RAEB 5C25A 3DXRB 1E6YB 3UKMA 5L1JA 5CMUA 3JD4A 2PFFB 3F0NA 5J2MA 1C4CA 4QPKA 1HWKA 4O4RA 1HQUB 2QTWA 1K47A 2GHPA 3PRBA 4KO0B 4DV6F 1JNZB 3Q8YA 2WPDG 2LXFA 4LRCA 2FVPA 4QPJA 3M2UB 3Q23A 2GX8A 2P4VA 2GGPA 3J81j 3QJLA 5J9PC 4DV5J 3ILIA 4QZVB 2AJ2A 4ZI7B 3J7ZT 3GMGA 3MMCB 3PYDA 4DFKA 4ZOSA 1KD1T 4Z37A 9RUBA 3ABTA 3I56S 1YJUA 5L46A 3N27A 4B3RJ 5HP1A 2WSSG 1P1TA 1TUGB 3GJTB 2ZDOA 2CPXA 1YLXA 1O9HA 2X3DA 2F1MA 1REGX 3GB0A 1AFIA 4LWSA 4B17A 1HNZB 4C97A 1MZEA 2IRUA 4KGZB 1QVFU 1Q8KA 3RGIA 4K4TA 1IBMF 4QE9A 3NGSA 1TL7A 3TZWA 4QWCA 2E5LO 5CXTA 1NDCA 1JFFA 2VF3A 4IGGA 5FNVB 3N2KB 1HWUA 4IO1A 1KSPA 3FFIA 3RTVA 4Y6IA 3LPYA 2AHYA 1VLYA 3HKCB 3J81U 4JYAJ 1HP8A 2KHDA 2FPHX 1UFIA 4CLKA 1JJ2U 3OL8A 2NXNA 4N41A 2OYQA 2F5GA 1FEHA 2KDOA 5G0RB 3NBPB 4C8NA 4DL7A 3V6HA 5BY1A 4ASUG 1IVSA 3VBBA 4W98A 1U0HB 1YTFB 4O4HB 1UPPA 1REVB 5HMWA 3NNHA 4FP9A 2GUZA 1XNRF 4U3JA 3G4SS 3UE2A 3AQPA 2HYIB 1H2VZ 4RWUA 3W8GA 1FRKA 3CJSA 1K7DA 3VCDA 3MHSC 4KHPB 1LV5A 2HJDA 3BN7A 3LGNA 4LFBB 1QVFR 5H9EK 3IGVA 3OFFA 1NK8A 3DRXA 2W9AA 2B43A 3B6BA 3FB8C 4O3PA 3CD6V 1SIWB 2P67A 4YB5A 3AA8A 2DYAA 2HHXA 2Z2MA 3RU0A 1X7VA 4IOCQ 1WEYA 5B1NA 3K8WA 4H4OA 5GONB 3KHRA 4PUOB 3H5SA 3H40A 4UB6Z 4O23A 5J2MB 4K4XA 3MDFA 1TL3A 1YG0A 4N77A 2EVZA 3W8PA 3OL9A 3CCRS 1FKAO 5KG4A 2GQCA 1V3RA 2LQTA 5KFWA 3JATA 4OX9J 2RDCA 4NLYA 3CS5A 1VYAA 4X66B 1VJWA 4KHMA 3RWRD 4RNHA 4J5OA 1ZTEA 2V7QG 4JBCA 2X0LA 3TUJC 2F66C 3Q8RB 3ABKC 4PKDB 1RT5B 1MOFA 3GFXA 5KG6A 4GLXA 4TQFA 5HP1B 4DR5F 3CMAS 1NPPA 2HWIA 2KN4A 3GYGA 3LAMA 3KLHA 4GVBA 3EWGA 1TFYA 2VV5A 1VQMV 2XI3A 4LWSB 5C8YA 3PKYA 5C93A 4WTYA 3A0HZ 4ZA1A 2F23A 2LFRA 3A12A 1GN4A 1TL7B 3CD7A 2LMIA 1Q6UA 1KWMA 4ED0A 2QLFB 2AJ4A 2YICA 2CDRB 1VGYA 2XNRA 3UW1A 2VFUA 1XMQB 1JFFB 1V54C 1S12A 1WG4A 4DCOB 3M9NB 5IT9Y 3ENAA 4OFZA 1CP9A 2MZQA 1QR9A 1S5HC 3FFIB 5DQGA 4RUCA 2IVMA 1JQ0A 2N4DA 1VQ4S 2AW9A 4LF8F 2W24A 4NTWA 3ILLA 4OZ5A 2EIKC 4PG7A 1RWUA 1SQVH 4HZ3A 1WNSA 4MK7A 1HMVA 4K0KF 2AGOA 1VRUA 4J9MA 1JJOA 2LQ8A 5K8MA 2ZH8A 3JAWA 3S1TA 3AT1B 2KVIA 1N0JA 3HX9A 2GUZB 2BJ1A 3AA9A 4PWUA 4LFCB 4U3JB 1OCZC 4PI2A 5H9CA 3NL0A 1QUVA 2OSRA 4A5UB 2KG1A 2BACA 4WFBQ 3ZTPA 3JAKA 3IO1A 4L8JA 3W7SA 2UVWA 4C0BA 3UDEA 3N0VA 2ZJPQ 2GA7A 3CDBA 4NYZA 4C8KA 1GN3A 2X6AA 3X2QC 2RVJA 4X4QA 4JV5F 5K1XA 1S4FA 2POKA 1OHHG 1RAHB 2D2CB 4NZ0A 1HI0P 3IWNC 2OD4A 2ATLA 3L75H 1WOSA 3CC4S 2HAFA 4WFYA 3ZN1A 2UUBO 1SJQA 2QX0A 2B6AA 3D1HA 1SXLA 3MAHA 4OZNA 4AQYB 1GTEA 4O3QA 4DG1B 3W2WA 1FHTA 1FXVA 2UU9B 1H72C 4NLUA 3KHHA 2EC2A 4ED4A 4F4KA 4ZVSB 1TL3B 2LKZA 4ZHRA 1WF0A 2RF2A 4Y2MA 2ZIMA 3JAMY 2ZH6A 4TXSA 1UJ4A 2MGZB 4GT1A 3A3OB 5LSLA 4MSWC 3UD5A 2F8HA 2QM7A 2EI5A 2KJVA 4QWEA 1F9EB 5THWA 4Y3CA 5DM6Q 4DV2B 2M88A 3DOMA 1X31C 3E86A 2K3IA 3ZMUA 2OPSA 4LVOP 4Z1VA 2HBQB 3ZHTA 4OYWA 1ICEB 2V4QA 5F41A 2FC8A 2UVVA 4PPDA 1HQEA 1Q16B 1ZUQA 1UVIA 1D2DA 1F7YA 2BUNA 2EX3A 2M3DA 4GVBB 5IWAF 4NWBA 3RBEA 3CC7S 1M93A 3US5A 3HFZB 2NXEA 3C14A 5EBMC 5JMNA 3CCSS 1EX8A 5C8YB 1RTIB 4HH1A 2UXCB 3UCGA 3J7A1 2VQEB 3UNGC 4LF7O 2J9EA 2PYJA 4GYCB 1N32O 3SJAC 4DR4J 4GKKO 4ANEA 1OCRC 3EVKA 3RBXA 2LQ9A 4X89A 3AXKA 1UVKA 2MQQA 3ASOC 3ZIAG 2EFQA 4UB8Z 3L9ZA 5AXNA 3M1VA 4TT3G 4BC7A 2BOBC 3F5TA 4DR2J 1NPKA 2PF4E 2F63A 3VHQA 3R2CJ 1HMVB 4UQGA 1VRUB 3KLFA 2J6TA 2VG5A 4LNUB 3P32A 2UUAF 3BGOP 2VB6A 3JAWB 5DGAA 2D7SA 2ZC4A 3D1OA 4G1IA 2QKAA 2AP6A 1Q53A 1T9TA 4MT1A 2VPXB 1AR4A 1E1RG 3CO0P 2FY8A 3JAKB 3ZBHA 3DLHA 4M5IA 5ETLA 3R65A 4I0WA 2XNDG 3SJCC 1X4BA 1IXKA 3MEKA 3V6DB 2PT0A 2IY5B 4YQWA 2BVZA 4JV2A 3V6JA 4I55A 4LR7A 3AAWB 2IHR1 3BYRA 2EINC 5LYJA 4F0KA 3UQSA 1WKLA 4ENOA 2ZNIA 3T1HO 1WJ9A 3RB6A 4X62F 4LF1A 3V5RA 1HNVA 4OLOA 4U7CA 1ZZFA 1YJ9V 1ZS6A 1FKOB 1N33B 1OO0B 4X2BA 2Q9LA 2D3ZA 4LJMA 3MXHP 3D68A 4YJ3A 4ZKIA 4ZHRB 2KG0A 1UTAA 5KFYA 2RF2B 4F4AA 3LSUA 3QVNA 1VQNS 2VBXA 2IM9A 2ALYB 2Q67A 2RS2A 4K8ZA 5B0EA 1JCHA 2MJNA 3GCWP 3H4DA 1MN7A 4Q5VA 4X65F 3DOMB 4XDDA 4EB6A 3QSIA 2OPSB 2XO6A 2ARHA 3H4BA 1S3JA 1RWXB 3M9OB 2AF6A 1HQEB 3OTOJ 5GTIZ 1KNZA 5HLFB 3QRRA 1S0OA 4YHHF 5GAHI 5LJ3Y 3R5GA 4ZS6A 3C14B 3BN4A 4MIWA 5EC1C 3HJFA 2MYFA 4YR3A 1HBMA 2IA6A 1ZM3A 4B3SF 4NCGA 2RDJA 1HR0F 3K3WA 4J9SA 2CQPA 5BXIA 3RN4A 4JI4O 1FRIA 2NS1B 2PUSA 5ITHA 4OZ0A 2BBEA 3ZZ0A 2BYCA 3V2UC 2WONA 2PSZA 4TV8A 4NOHA 1QAXA 2ZDPA 4QIWF 3M1VB 4USKA 4WK1A 2HVZA 1C2PA 5CH7B 3LALA 1D09B 4YIOA 4FF1A 1GN6A 3KLFB 4DLEA 3CJ0A 2VG5B 3RBDA 4LF4J 5L3FA 3SXLA 2Z30B 4BS2A 4LF9O 1F3FA 3HSZA 4OI4A 5I3PA 3ABKB 1IKYA 1N88A 1Z5WA 1BSMA 2X1AA 3GWOA 2KRBA 3SCKE 2ZH7A 2MLZA 4FVCA 2XS5A 4PA4A 4USUA 2DD8S 2F4VO 5HATA 4ZDNA 5D5PA 2OTJV 1ULRA 2R8KA 3MI7X 3J7AU 4JI2F 5LGUA 3WU2Z 1Y5LB 5AT1B 3IGNA 2H9ZA 1F9HA 5LMNO 4I55B 4OX6A 4DWIA 2CRLA 3FCWA 1VQSA 4DR3B 4GO7X 3KK3A 2ZITA 3CJ4A 2B5JB 1TKXA 1V54B 2F4FA 4DR7J 1N48A 1CVJA 3VAHA 1HNVB 2AGQA 2ROGA 1RK8A 2NYHA 4L6V3 3D6FB 3B4MA 4YJ3B 2CQ4A 1D0EA 5EX3A 2EIKB 2WB4A 1RACB 4RX6A 4F0MA 1NR7A 5J2PA 1N5VA 5JXSA 2ZBCA 5KFVA 3SPGA 4M63A 4A46A 1SL1A 5LL6d 1ZZNA 2MB0B 4XDJA 3H1KH 4JV0A 5DM7Q 4EB6B 3T6BA 1BCCH 2F93B 2RS8A 1OCZB 4NLWA 1M1KW 2DGTA 4DO2A 5AE1A 3PX4A 2BQRA 3CCZA 3Q8QB 4WBFA 4I6YA 1V3ZA 2DRDA 4MKBA 4AI8A 3L09A 1AB3A 4C3KA 4F25A 1SVDA 2FZKB 2BOAA 5DG8A 5DLFA 2A6MA 3X2QB 1EN6A 2DH8A 1QSSA 3CXCR 3JD3A 3BA9A 1SH0A 1HBMB 2DEIA 1RT3A 5F8HA 3NMRA 5KLVH 4NCGB 1T05A 1WG1A 4DL5A 3I5AA 1KS2A 1VF6C 1UKUA 3G6ES 5KT2A 2JJ4D 2NSBA 4IQMA 1AP6A 3MOZA 3E89A 1NKCA 4DV5O 2GW8A 2WONB 4TV8B 4ZJLA 2QO3A 1UWAA 5H2FZ 1OY8A 3L95X 1RABB 2C22A 1NJZA 2JGDA 2VKRA 5C42A 2DHHA 1MROA 4KGMA 4B3RO 4C2MA 4ECXA 1IBCB 5HI7A 4IQXA 2EULA 3RYCA 2P90A 4OJHA 5T41A 3EXAA 1IKYB 1WOOA 4J9QA 3QRQA 1ZPVA 2GIRA 4WWSA 4B7KA 2W25A 4F4ZA 2RSQA 1TKZB 1Z2ZA 3NY0A 1J5EB 2XB2D 4X8AA 4ZPDA 5KG3A 3O44A 2LLZA 4GO5X 4L75A 3AG3C 4DR1O 4WPAA 5L38A 3AK1A 2OCHA 1VQ5S 2UUBB 2EEYA 3A1YG 3I0SA 3KK3B 4JYAO 1X5OA 3QRPA 1K9MW 4IH7A 1YDXA 1OCRB 5LXTB 4RW6B 1TKXB 3W63A 1HI1A 1WELA 4CLFA 2CDQA 3BYPA 4MIAA 2HFOA 1KC8T 3ASOB 2XMTA 3LPEA 4OZ2A 1EETA 4QW9A 2E7WA 2YI8A 2IVYA 1XIQA 3VTIA 4B7EA 1QHTA 2LP7A 3R5BA 1JXEA 2KG7A 1YVFA 3AH6A 5J2PB 2NZCA 4WYLA 1FNXH 5A6WA 1I5OB 1UEUA 4JF3A 1VQKS 4DV0B 4UV8A 1Q79A 2HGMA 2GJFA 2GVDA 1S10A 1LQ9A 3FK4A 1SUQB 1R6YA 2XWXA 3DGEA 4KY3A 2C2MB 3SYCA 4WFGA 4F3OA 1FTRA 1I5YA 2CPFA 4BBYA 2FLOA 3MM8A 2PN6A 4PR6A 2QEXV 1HFEL 4MTOA 2G0JA 4LF7B 2ZD1B 3AK2A 4CNZA 5H5NA 1RT3B 4Q43A 4OX7A 4ZKAA 4NLVA 1QDUB 1DRZA 2HVHA 3S6EA 1T05B 1S5JA 2EINB 4GKKB 5GMDA 4JP8A 3PRDA 2ZJQQ 5EK0A 5LOVA 4OX9O 3G71S 3OUFA 2EK6A 1M5VC 2QLWA 2NUHA 4MKAA 2YC0A 2UXXA 1T3OA 3BJYA 4U7NA 3V6KA 3R27A 1KFDA 2OPQA 2AZ3A 3PR5B 1DQ9A 1K4DC 2B9WA 3LWMA 1YBTA 4QU7A 3H25A 2ALZA 4OPHA 4H4KC 1SF9A 4CS2A 3P45B 2JGDB 2P9CA 4WFFA 5C42B 1F2GA 2W2QP 1HLWA 1IQZA 5HQ8A 5DDOC 3LP0B 4FKXA 4I69A 4NCBA 2HKEA 4ZOLA 2IJHA 1KHWA 1I08A 1R7IA 3G82A 2X51A 3BFRA 4LSNA 2QM8A 2JGUA 1S1WA 3RYCB 1YJNV 1NK6A 2KVQE 2C2ZB 1IZ3A 3UDCA 3H90A 4LBIA 4MKYA 4G27B 1AZSB 2KJWA 2VFRA 5KG2A 3ETEA 3C8YA 1HWYA 4IOAQ 1Q43A 1G4YB 1VLOA 2E1MC 4IFVA 2UXDJ 2XMUA 1BMFG 1OPZA 1YGYA 2V9WA 2N04A 1UPMB 2VOOA 1BE4A 4OX8A 1VF6A 3VZIA 4FK5C 3T1HB 4O4LA 2GFFA 1OCOC 1HHQA 5KOWA 3OMAB 1NNDA 4P9PA 4MYTA 3ENVA 4CLZA 1ZETA 3DN9A 3DLLQ 2VDIA 1EETB 3POTB 2PI5A 4F6RA 4RBVA 4DV6J 1XNQJ 1R8HA 3OR2A 3KHGA 4Y2AA 3BO4A 1DJ0A 1XR7A 4DPOA 1HNIB 1R89A 1Q6IA 2WZ1A 4FLXA 2DGXA 1JKHA 1VF5B 1NK5A 4DXWA 2WLHA 2R42A 1RSCA 2JHEA 2N74A 3K89A 5J2UB 4HHJA 5GADU 4K4VA 2LQBA 1SS3A 3RT3C 4EO8A 5F9NA 1U24A 2IMWP 5KFHA 2R9LA 2AQ4A 3D3BJ 1XMOJ 3CCUV 7FDRA 3VVUA 4JI6J 1LXNA 2Q7GA 2WBMA 3AG4C 3QFWA 1AUDA 3TGUH 1AUSL 3NOCA 1RP3B 3D3IA 1IBMJ 2XYPB 4PXDA 1X5TA 2LXUA 4M5MA 3TK1A 1UP1A 3PHTA 3MMBA 5LOVB 2KQXA 2IJRA 3ZHUA 1H2KA 4W90B 2EBEA 3O2IA 2OPQB 4ECYA 2HFZA 2WVCA 5K8PA 4DK0A 4P75A 2V2VA 2QA4V 1GK8A 2PE8A 3D1QA 4D7SA 2HQGA 4J9ZB 5F0WA 1DZ5A 3AG1C 2ZT9B 3A0RA 3F5WC 2NCKL 1NBMG 1K34A 4LSNB 1C1BA 4M5KA 4O2BB 1S1WB 4P10A 1Y5IB 1XNRJ 3IRWP 3CCES 2A3JA 3P5BP 1QVGU 5KA5A 3OT7A 2DBBA 2KU7A 4AD6A 1XHXA 3IAM9 2JEJA 3D5MA 3SQGA 2NLJC 4DR4O 1Y0HA 4G6VB 2RHQB 3TW0A 1FD9A 2YNIA 2K1RB 4IFVB 2N4CA 1F4MA 2KKWA 2R7QA 3I4PA 3SYPA 4NCAA 3M6WA 2GSMB 5HROA 1U6BA 3PIOQ 1JLFA 3MAAA 1LKZA 2KSDA 4BDPA 4UOFA 1X5SA 4O4LB 3GFZA 1SC3B 1UL3A 1CPZA 4DR2O 1K0VA 2ERRA 1VP7A 4BW9A 4USJC 2LXIA 4BAYA 2HJFC 4CH0S 4OI3A 4H4KA 1TTHB 3IRXA 3OR2B 2DKOB 1U48A 2C28A 1U96A 1IJEB 4JYYA 2LCWA 4EYIB 4K50A 3FSXA 3UD4P 1OMSA 4TQSA 3NEKA 1V9OA 3AD9C 2E44A 1MG7A 5DGBA 1JKHB 4CH7A 2B9ZA 1FDBA 2W7PA 5HL7Q 5AJ3F 3DC6A 2QJ1A 4YR0A 2FD2A 2AX1A 2QL7B 2V6AA 4OL8A 2HWHA 1VQ9V 4UXNA 2WVDA 1K5SA 4Z1MG 5BJRA 2CQDA 2QSFA 3QF7A 4J9OA 1PILA 1DQAA 4KAIA 4LMZA 5KFPA 2CPYA 3SCJE 2Z2LA 4DV1O 3CPWU 4QYZJ 5CYMA 2I5JA 3AG3B 3K04A 4JI5F 1KUQA 3P5TL 2R70A 4PDLA 4PWWA 1JPXA 3JSLA 3NAHA 5K9FA 2E74B 2VQFF 4OYMA 4FF2A 2YY3A 3KJNB 3MMBB 3VQYA 2F65A 4EEYA 2GJIA 1RA7A 1VS3A 4XDLA 1E6VB 2UXBO 2FQQB 4J9UE 2P9EA 4OYZA 5KUMA 1NEEA 1VFJA 2VICA 4LF8J 5LP6C 4KQZA 4NTXA 2HFSA 3W7WA 3FKBA 4DL2A 3ISZA