2RK1A

Dhfr r67 complexed with nadp and dihydrofolate
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase type 2
publication title Crystal structure of a type II dihydrofolate reductase catalytic ternary complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rk1A00
3UDCA 2VV5A 2RH2A 2GQVA 3T9NA 2P4TA 2RK1A 1VIEA 2OAUA 3SFMA 1VIFA 2RK2A
chains in the Genus database with same CATH superfamily
2XDDA 1YI2T 3EGXA 2M51A 2X35A 1WFWA 4EDUA 5KYNA 2ED1A 2KDSA 3JCMQ 3CCQQ 1BI2A 1WHMA 1HXDA 1MNEA 1YJ9A 2CZ6B 1IREB 2A0FB 2PNIA 1VQOQ 2NUTB 1EX4A 1SF9A 2CSIA 2RJCA 3CBOA 3C95A 4FCYA 2FL7A 3FEOA 1RABB 3X20B 3KBGA 1YJNT 5DLOA 1YWOA 3T9NA 2EYXA 2O9SA 1N8RR 1VOMA 4N4IA 1MGQA 2DD5A 2FG0A 3UWNA 3VUZA 3CCRA 4L59A 3VU3C 3VYGA 1ZUKA 1ABQA 4C92C 3BFMA 4IUQA 1YIJA 1TXQA 2BZXA 3M0PA 1AOJA 1UHFA 2GF7A 5KCHA 2K3XA 5I2MA 3CMET 4M4ZA 1JO8A 2K2VA 4FU6A 4PLIA 1QVPA 4HVUA 2DK3A 2FVUA 2JJ9A 1TSFA 1Y71A 2NUPA 1QWFA 1WXTA 3S6WA 2QXFA 4XTZA 1UFFA 1BCOA 3CMAQ 2DM1A 4JZ4A 3QWXX 4M7AA 2V1RA 3FC3A 2DLPA 5LL6S 2MOXA 4X9CA 1N6AA 1VQ4A 2YRVA 4LUEA 4AG1C 4QQGA 4BB7A 4J6WA 4DOWA 2K7AA 1BI1A 4RTUA 2DO3A 1UG1A 5EC7A 2AZSA 4AMCA 1I5OB 2GTOA 4BACA 5M9OA 4XTXA 4DBFA 4J9BA 2LRQA 3CPWP 2VYTA 1JBMA 2XKOC 3V8LA 1VQ8T 1B34B 1HYOA 2K5FA 1PHTA 3OB9A 4ZN1A 4HXJA 2LQNA 2QQ9A 1TTHB 4OB3B 4E7IA 1GRIA 1YJWA 3OYIA 1T0HA 5GJWB 1YJ9T 2AKKA 2JTFA 2E6NA 3FJPA 1JQQA 4M75E 2RI3A 1X43A 3J7AF 2H3EB 1RUWA 2DL3A 2DJQA 1FX7A 1NPRA 2XU8A 4FM4B 2KVQG 1KHCA 3UA7A 5CO7A 5KH6A 1M9SA 1YI2Q 2ZZDA 2YT6A 1VQ7A 1WX6A 2J6KA 3RMQA 3A1PA 3EFOA 3CCRT 2EYZA 4C8QD 4M7DC 4JDSA 2DPPB 2LCLA 2LQWA 1YIJT 1H92A 1NEBA 3HKSA 2AT1B 3WVDB 2VV5A 2DE0X 1WNLA 3Q1JA 1Y7XA 3SEMA 1YJNQ 1NJIR 2XHCA 3C0CA 2BTTA 3JAME 4ZGJB 4RTTA 3EH1A 2FYKA 3H9NA 1NBEB 5C6SA 2XDBA 2VWFA 4F7UF 4LD6A 1M27C 2PVOB 1M1GA 1Q86U 2DZCA 3JCMX 1KC8R 2FHDA 3FDRA 3OYCA 3JCMg 2YWWA 4JRPA 4R56A 1VQ4T 3QZ5B 3CMEQ 4PKCC 3JB9J 3SB2A 2E70A 2E1HA 1F1BB 3LW5E 1Q86C 2DAQA 2C06A 2RQVA 2FO0A 1UDLA 1ZQ1A 1MMNA 2PTKA 2DXCA 1ZA2B 3HHTB 2COYA 4J9CA 5IH2A 2H8HA 3MP8A 3HRUA 4X34A 1MMDA 1I07A 1K0XA 2J6OA 1Y96B 5DY9A 2M02A 4FSXA 4M78E 2F5TX 1YJWT 1JJ2A 2ED0A 1OU9A 4ZN3A 2K57A 4PJOF 3OBYA 1MMGA 3BDUA 4C8QA 1NJIC 1VQ8Q 4KUDK 1VQ7T 1FMWA 1IRXA 2CZ1B 2CP2A 1WA7A 2JTEA 3GNGA 2DL4A 3JCMe 2JMAA 4KUIA 5KYUB 1YJ9Q 4RG8A 4NOYA 4OGEA 3O5ZA 3OSVA 3C4SA 3HFNA 2PVDB 2MIOA 3H41A 4GLMA 1XNIA 2KE9A 3QJ6A 1QCFA 1P92A 3CCRQ 2KT1A 1UEBA 1KD1R 2FPDA 3JSCA 1KQSS 4HCCA 1B3QA 1YIJQ 5KYXB 1UGPB 4MMLA 3CCEA 2QI2A 4M75B 2VB6A 3GNFB 4CRIA 3JB9D 2KMTA 1WI7A 3MO8A 2JTMA 2DYBA 3L2VA 1QVGP 3A98A 5KYUA 5HK3A 4PFZA 4A4KA 3X28B 1TS9A 2MAMA 2VGMA 3DB4A 2CT3A 1VQ5A 3PIPA 3M53A 4IUTA 1SHGA 4M75C 4F7UG 4VUBA 5ECAA 1SSFA 2EW3A 2KY9A 1UGQB 1VQ4Q 2OTLA 2LTOA 4IUPA 1VA7A 2RJFA 5IHNA 5GAOl 4MDWA 3INZA 1I8FA 1Q82U 2L2PA 4CC3A 5CKFA 4KT0E 2BE7D 2CGHA 1SEMA 3H8ZA 4Z88A 1QVFP 1BCMA 4M77G 2FZKB 2GFUA 4DBQA 4BE0A 4HCBA 4ORZA 1W2BP 5EG2A 2KRNA 1N27A 2Z0WA 3CPFA 1D09B 2L89A 3M0TA 5GMKl 1YJWQ 4D8DA 4FT4A 2L3QA 5CK9A 1V1CA 4E7KA 2QQRA 2DFUA 4DQ2A 4IUUA 4C0DB 1OX9A 3L2QA 4DBHA 2DRKA 4Y28E 3TQ7P 2AHJB 3OYNA 1ACMB 3JCMb 1QKWA 4PJOG 3OW2P 3EG0A 4J9DA 1OX8A 1GL5A 1R0CB 1VQ7Q 5CCAA 4OMQA 3MHXA 1YITA 1LNXA 1R0BG 4M7AF 3CPWA 1K0SA 3P8DA 1OEBA 1S1NA 1PKTA 3CCET 2HSEB 3J81E 4WCIA 4J9GA 2B86A 4J8OA 2EQIA 4B6MA 5KYYB 4FYXB 3QXEB 4JRQA 1IHVA 1M5Q1 3JB9H 2K9GA 4M78C 1VQ5T 3NTHA 2KXDA 2YUPA 4KH1B 1H3HA 2GTJA 4EMKA 2QGGA 4E7SA 2OTLT 4KBMB 3EG1A 5GAMf 5GAN5 5GMKe 2ZGWA 5LJ3h 1RAAB 2B8AA 3OYAA 2DXTA 4FT2A 3M4YA 4N4GA 2HAXA 3QDFA 2RO0A 2L8DA 2ZCFB 2O2OA 3ME9A 1IGQA 3VS3A 2QASA 2V8JA 3OYGA 4BE2A 4LDVA 5KYYA 2EYQA 3QBYA 2KROA 5GAMg 1W70A 4BDYA 2CDTA 1K9MR 2DVJA 1ZSZB 3M0SA 5CKEA 4E6RA 4JLIA 3REBB 2EQJA 2DRMA 3UT1A 1RLQC 2MWOA 1GBQA 3PFSA 3CXCP 1RLPC 1U1SA 4J6YA 5CR2A 1K8AC 3HP9A 1V76A 2IPOB 1BI3A 1YITT 1O9SA 5IXBA 2OAUA 2QGFB 2DD4A 1ZSZC 3L1AA 3PTAA 5LJ3f 2HKQB 2CKKA 2HL5C 1M2VB 3VKIA 1KJWA 1UE9A 2K6DA 4KH0B 4Z89A 4BI4A 2JM9A 2QA4A 1KG1A 2EVRA 4J9HA 3OYBA 4LD9K 4MZPA 2C0OA 1M1KC 1K73C 3I56A 4KULA 1OU8A 4F16A 2EIFA 1K4US 1T0JA 1TUCA 4J9EA 2BIVA 2I0NA 3CCVA 1TU0B 1NYFA 4C92D 4LDXA 4Y91A 3RKYA 2EAYA 1AEYA 2DEQA 5LJ3g 2PUKB 1LJOA 5GANg 1VQLA 2QDYB 5LJ5g 1RL2A 4M7AG 5I21A 3CCEQ 3HRSA 4OMMA 2AK5A 2LT1A 3RKWA 4J83A 2F1LA 1ABOA 3CC4A 1AWXA 1M2VA 1K76A 4AFUC 2DL7A 4C8QF 3L2WA 3MP1A 3S3MA 2E3HA 2JVVA 4LUDA 3X24B 4PJMA 4K11A 4XTWA 1VQ5Q 4C92B 3RMSA 1WQWA 2E64A 1AVZC 3CCSA 2RB6A 1PWTA 4BD3A 4OMFB 4RTWA 2O9VA 2OTLQ 2MYSA 3G71A 1KFZA 5CKBA 3NHNA 3SHWA 2ZPHB 3OS0A 2E3IA 1OOTA 1Q81C 3U23A 2VASA 2YLBA 4LNPA 4Q5WA 1W1FA 1W4SA 2RQRA 5I11A 4AG2C 2P0QA 4XQ3A 1BIAA 5GMKj 5FLXE 2Y4XA 3GBQA 4HCZA 1FMVA 2RK2A 4AFSC 5KYWB 1QVGA 2FZGB 2V1QA 2YUNA 3P8BB 2KAFA 5GANe 5LJ5e 3CBPA 2VKNA 2KEAA 5HCKA 3S3NA 3RR6A 4HT8A 3M4GA 1U1TA 4WF2A 4BE1A 1WJRA 1Q95G 2C0IA 3X25B 1AHJB 2NUTA 2WSFE 1UHCA 4OMPA 1RAGB 2LP5A 2QA4T 1Q7YC 1TUDA 3RIRA 4C92A 2L3RA 4IIOA 5D7UA 5A2QE 3I56T 4JJDA 1G3YA 2CREA 3PT9A 3PNWC 3CCVT 4M7DD 3LWHA 1YITQ 3META 2JXBA 3NMZC 1X75C 2CYZB 1AWOA 4XK8E 1QVFA 5FWBA 2MI6A 2KNBB 4P5NA 1VQLT 3EG9B 5GJVB 3OBWA 3CD6A 2EJGA 4QVCA 1W2BA 4WTOB 2F2VA 2LNVA 3CBMA 1TOVA 2D0QB 3RBBB 5KYWA 2RHUA 1YFNA 1AD5A 3JB9I 4PJNA 1N8RC 3BY7A 1QCNA 3CC4T 2DA9A 5FW9A 3ZFJA 2DTOA 4GLKA 1X01A 2DBMA 4DOVA 3VUBA 1AT1B 2YHTA 1BBZA 2CH4W 2A28A 4YTLA 3MEAA 5AYFA 4M7DB 1I4K1 1NZ9A 3OY9A 2LC4A 3CCST 2K4YA 3OW2A 3QWYA 2X4YA 1M1FA 1WQ7A 1UUEA 1U3OA 3KUFA 5DLQE 2DTHA 2JUFA 3VS7A 2GQIA 1EZZB 3UATA 3FRNA 1SHFA 3G71T 3L2RA 4RTXA 1SKUB 4JRIA 2W0ZA 2EYYA 2KI7A 2LX7A 3I5SA 2AIRB 4RCBA 1MNDA 1UB4A 1IHWA 1PKSA 2FRYA 1A0NB 1E7OA 5GANd 2GGRA 4C8QG 1VIEA 1Y57A 1B34A 5J26A 2DTIA 2R5MA 2E5KA 4N0AC 3JB9F 4MMKA 3HFOA 1VQKA 2F2WA 2YRDA 3MEWA 2HBPA 3EG3A 1G3TA 3GLXA 4M7DA 3OA6A 1M8MA 1KSWA 2W10A 4J5YA 2KK4A 2HZYA 1IB8A 1JB0E 4MZMA 2M1HA 3C94A 1D1CA 1NG2A 4JPBW 2K5IA 2KGTA 4RTYA 3ZL7C 3M55A 1JEGA 2X4XA 3MPUB 1RAFB 4RG2A 4BUGA 4RTZA 4F7UE 4RUGA 5GANj 4M77F 2F2XA 3SDZA 5LJ5j 2ROLA 2QA4Q 3CD6T 2RN8A 2K2MA 5AT1B 2VVKA 2P0KA 3I56Q 4PLLA 4J9IA 4ZNXA 2J6FA 5L23A 4JJBA 2YLCA 3EAEA 1M3CA 2HQHA 3CCVQ 4M77E 2V8KA 5J3BA 1NJIU 5IXFA 4QVDA 3V7CA 1T3LA 1VQLQ 3EH2A 1OQKA 3CXCA 2PUOB 2DF6A 3OSSC 5I2SA 1X2QA 1NLOC 2KSSA 2CZ7B 2SRCA 3DKMA 4OB1B 4ESRA 1O75A 1WHHA 3CC4Q 2P0PA 3URGA 4PJOE 4IIMA 4C5GA 1KC8C 2VC8A 4M75D 1XTDA 2F5KA 2ESWA 3H0FA 4XTVA 2NLUA 3CCSQ 8AT1B 4JJCA 1H8KA 1GCQC 3DLMA 4N4HA 1YHQA 2ZPEB 5HKCA 2WACA 1Y96A 3G71Q 2X51A 1VQKT 1WPYA 3GF5A 2CUDA 1I1JA 2O31A 1WZOA 2HBWA 4F14A 2YDLA 2D9TA 2LQKA 3L2UA 3CC7A 2L0AA 2OAWA 2D8HA 2K3YA 2R57A 1RI9A 1YCSB 4KGVB 1RI0A 2O88A 2HD0A 5IT9E 1Q82R 3OS5A 5CQXA 1OV3A 1M8VA 4JS4A 4NL2A 2G6FX 4IKFA 3HRTA 1N9SA 2FPEA 2M16A 1G5VA 3M9QA 3JB9G 3EGUA 1RAIB 1DJ7B 1VQ6A 1WHLA 1NLPC 2LMJA 4JUVA 1M90R 1SRLA 3CEYA 4RCCA 4II1A 1QCOA 1JXOA 3PMTA 1JJ2S 1XQHA 3NGPA 3FB9A 2QAZA 3OMCA 1MV3A 1YBYA 4BI3A 1U5SA 3CD6Q 5FU6C 1BI0A 1D0YA 1MV0B 2CH4A 3E2UA 1SSHA 5KYXA 4M75A 1QMCA 3LH5A 3DLLA 2CZ0B 4L6V5 3J80E 3UPUA 1VQPA 3JCMd 3QKJA 4M78D 1SG5A 3JV3A 1KD1C 2KQWA 1NEGA 4R0KA 2QQBA 5GAOq 1G8XA 1PM3A 1QP3A 3ASKA 3NTKA 5IHIA 1PD1A 1Y07A 1YHQT 2MCNA 3VS2A 2A36A 4RKUE 4C0ZA 3QDRB 2IIMA 1PCXA 2QK0A 1H641 4FYYB 5HY6A 5GAOm 4C92F 4E2FB 3CC7T 3ULRB 3OYMA 1D1BA 4OMNA 4M78B 2K3BA 4DEXA 4PJJA 3OMGA 1TH7A 2RHXA 1FWZA 2FRWA 2DX1A 1VQKQ 2RH2A 1PRLC 4O6JA 4M7AE 2H3JA 1ZSGA 1D3BB 7AT1B 1AZEA 5GMKm 1VQ6T 1PD0A 4A4FA 2RJDA 3WXMB 4M77C 2M0OA 3LGFA 1CKAA 2ATCB 2KT8A 4BY6B 2KYMA 3KXTA 2DIGA 1N9RA 2QQAA 4RTVA 4HVWA 3EG2A 3L2ZA 3QYGB 4XTYA 2L3PA 4J7FA 2GCXA 4PFOA 3PIOA 3CCMA 1CSKA 3MCAB 3O8VA 2JNGA 4M78A 2PZ1A 4ZGEB 2NWMA 3MKDA 4KRTA 4BY6C 2ROTA 4PJOC 4LDUA 1J3TA 2COZA 1VYUA 1KQSP 3NFCA 2FB7A 3A5ZB 1VQPT 4O5VA 3S3OA 1T3SA 1D3BA 4B9XA 4FW2A 2EQKA 3M54A 1S72Q 2KR3A 2NYSA 1K8AU 1XOVA 4OMLA 1U06A 3H6ZA 1RACB 3QHSA 1JRIA 4XTUA 1HK9A 2DVEA 2LCSA 2IVWA 2OX7A 1UGSB 1SRMA 3A8OB 1KHIA 5GAN4 4FIBA 3CPWS 4ELYC 3RKXA 3V8JA 1M1KU 1K73U 2LDMA 1QWEA 1K9AA 3LX7A 3VJPA 2CSQA 4C5EA 2R5AA 5FRNA 1E6GA 4EMGA 4XU0A 2DXBA 3VS5A 3SWNC 1YHQQ 3EGXB 1LCKA 2ZAEA 1WLPB 3G4SA 4EIKA 3GP8A 3QG1A 4ZTJA 3I9QA 1PSFA 2BE9B 1CKBA 1ZSZA 4EMHA 3CC7Q 2P4RA 4NS5A 4X1VA 2DL8A 5GAMe 4MZTA 4C92G 3TU4K 3GOXA 1MMAA 5D6WA 3ZBDA 5GAN6 3AT1B 3UDCA 2HDAA 4C0FA 3OQ5A 1K9MC 3CCLA 3V8KA 3HL8A 3CC2A 3VYHB 1M30A 2QYZA 2VUBA 4DA4A 2VXFA 5A0LA 3CCMT 4V2SA 4JS5A 1VQ6Q 1PC0A 2JMCA 3SFMA 1NE8A 2DERA 3MJXA 3PE0A 4PL6A 3QJYA 1QP2A 2RK1A 1NYGA 2A7YA 3JCMV 4Y92A 2DJZA 1Q81U 2JM8A 5GAOn 3M5AA 2HQXA 3H0IA 5IAYA 5GAN8 3RDVA 2K5LA 2NUPB 4C8QE 2R58A 2MF2A 4AFZC 4JZ3A 3JCMP 4ZTFA 3QO3A 3G6EA 2GNCA 4IUVA 1YN8A 4M7AB 5KE2A 2GBQA 2EKOA 2RI5A 4B9WA 5LJ3e 2X9HA 2BZ8A 2LCCA 4KGXB 4QT7A 4CC2A 1Q7YU 3OYHA 1AZGB 1VQPQ 4F04B 1WHGA 1X69A 1AWJA 3L42A 1OPKA 1OPLA 1TWBA 2L5QA 1MUZA 2JS2A 3E9FA 3E9GA 2XDPA 3EHRA 4PNOA 3OYLA 4M7AC 2LT4A 2D6FA 3TEEA 2BZYA 2E4HA 2LJ1A 3M56A 1JU5C 5D6XA 2V26A 3DB3A 1FMKA 2XI9A 3OYYA 4FL6A 1WDXA 4Z02A 5I22A 3G4ST 1Z9ZA 1PNJA 3REAB 1ZBJA 1E6HA 1B7TA 2AZVA 1QQJA 3QSUA 5GAMd 3R6OA 3THKA 3EGDB 1N8RU 2DL5A 4M7DG 1G3WA 2YXYA 2RF0A 2ZPBB 3JCMW 4IURA 3CCLT 5FU7B 3CC2T 1G3SA 4R55A 2HCKA 3QIIA 1IXDA 1OZ2A 3RUXA 3EFOB 4CC4B 2EJ9A 2DETA 1TG0A 4OB2B 4PK4A 2HSPA 3JCMh 4M75F 4JRKA 1D0XA 2I2LA 3JCMc 1UJYA 4LDYA 3MEVA 2A37A 5CIUA 1VQMA 1WJSA 2J7IA 2HQEA 1D1AA 2Y90A 4DBRA 3CCJQ 3JCMJ 4AT1B 5FU7C 1X27A 3NPFA 4L5GA 2LNHB 2E12A 5GAMj 2CP0A 3M57A 5CKDA 5J39A 4XU3A 4HT9A 5D6YA 2E65A 3OS1A 2FEIA 1Q86R 3CCMQ 3EGDA 2X3WD 1VQNA 3G6ET 3M59A 2ENMA 3EG9A 3M0QA 3UA6A 1QVGS 4E7ZA 5LJ3d 3ZEHA 4A54A 3BW1A 5LJ5d 2JOYA 3V7SA 5CVIA 2RA2A 3VS0A 1I81A 4E7HA 1M4ZA 3CQTA 3PMIA 1QW1A 1UTIA 4QQDA 5IHKA 4KGZB 4QQ6A 2EYWA 2QEXA 5GAN2 3CCUA 2KRSA 2RQUA 3JCMf 3C12A 4J9FA 2OJ2A 3M0UA 1RAEB 1UGVA 4PJLA 3RESA 5GAOr 3I55A 1D0ZA 1BIBA 4N0AA 3M58A 2OTJA 4LXCA 2DMOA 8ATCB 1R77A 1QVFS 3AHUA 1HJDA 4CI0C 4HKEA 5GAN3 5LJ3j 1HD3A 3MEUA 1W2BS 2F69A 1I5LA 4OB0B 4C8QB 2HMAA 2J06A 1KQSA 2M0YA 1UGRB 3OYEA 3FJ5A 2EGCA 2D0NA 5A0GA 1BK2A 2EGEA 4GY5A 2QQSA 1X6BA 5L8RE 2IG0A 4FSSA 3G4SQ 1R8OB 1M2OA 2ABLA 2OI3A 2YUOA 4M78F 4OMOA 1KIKA 3A8LB 1ARKA 1KQ2A 2FZCB 5CKHA 2WSCE 3VS1A 3X26B 1S72A 2BUDA 3OW2S 1FXXA 4C8QC 1XJWB 2QDLA 1VQMT 1BYMA 2XMFA 3MP6A 3I5RA 2X4WA 1KC8U 2DILA 3H0HA 2YRCA 3CCLQ 2DZ9A 4J7IA 3CC2Q 1OYXA 1LPLA 4QVZA 4UC4A 4E7LA 2E10A 4A4GA 1C6VX 1X6OA 1VQNT 1G83A 2D8JA 3TREA 2EGAA 2GQVA 1RAHB 2EBPA 4HA8A 1ZUYA 4ELZC 1GCPA 2XICA 3R6NA 4BI8B 2XD0A 1LOJA 2DIQA 3VV0A 1ZX6A 5FRMA 2DBKA 2KRMA 2BKDN 4M75G 9ATCB 1IZ6A 1GBRA 2X3XD 1M3AA 4D6WA 2WSEE 4FYVB 1VYTA 4X9DA 4HVVA 1PSEA 5KE3A 2QEXT 3CCUT 2RHYA 3G6EQ 2VGNA 1IO6A 3FLGA 3UF4A 2X4JA 4F17A 1VQ9A 5IN1A 2MPXC 2PU9B 1Y0MA 1NM7A 4A63B 3V7RA 3I55T 1GCQA 2EFIA 2JW4A 4OF1A 3KFVA 3LWIA 2OTJT 3D7SB 2KYBA 1X6GA 2XK0A 1GXIE 1BU1A 1OI1A 2E41A 4NL3A 3G1JA 5GMKh 3A8GB 1WXBA 2ECZA 2RPNA 3P8HA 4J6XA 5FU6B 2CP6A 4ZGDB 2RM4A 4C0GA 2CP7A 3QZ9B 3TSZA 3RERA 3LLRA 4TVRA 1W6XA 4C5IA 2J05A 1N5ZA 3QYHB 4GBQA 5C0MA 2RHIA 2EQMA 3CCQA 2MMPA 3LH0A 1WXUA 1VQOA 4Z8AA 2P4TA 1WYXA 3HTRA 2HEQA 1S72T 3CXCS 1PRMC 2JZ2A 3GIBA 4OVAA 3JRZA 1KD1U 2CT4A 4ANJA 1VIFA 2LJ3A 3LGLA 2JN0A 2AKLA 4XU1A 3GPLA 1QKXA 1KK7A 4XU2A 2O01E 2HNIA 4XAXB 2RQWA 4M77D 2EQUA 1K1ZA 2G3RA 3HPWA 4HCKA 1EIFA 2D1XA 5CAIA 2Y4YA 2DYIA 4M78G 2O4XB 1Q82C 2QTXA 1VQMQ 4F7UB 4RMOA 1G2BA 2ZPIB 1ZUUA 1M90U 4A4EA 2RQTA 3TCJA 1PG5B 2DKGA 1UECA 3QUIA 1OULA 1M90C 4PJOD 3VS4A 1WHJA 1SPKA 1TUGB 1ZLMA 3G7ZA 5GMKi 3N5BB 1VQNQ 3CMAA 3VRZA 4M77B 1VQ9T 2RMOA 5GAMh 4EMKB 2CP3A 4JLGA 4BDZA 4CC7A 1H3ZA 1VYVA 1ZA1B 1NPPA 5CQYA 3FIFA 2YSQA 4C92E 3VS6A 5GAN7 1UJ0A 1YP5A 3PGGA 4E7JA 2EPDA 3QPHA 4C0DC 2P84A 2MWPA 2QEXQ 2JS0A 3CCUQ 1U8RA 2O4XA 5HK0A 4A4HA 4F7UA 4EMKC 3OYJA 4PJOB 2C0TA 2LX9A 1WGSA 2V8IA 5A0DA 3CCJA 3I55Q 2DEUA 2NUZA 3IQLA 3A8HB 2OTJQ 2FPFA 2XG8D 2HKNA 3CCQT 1C0MA 2PVGB 1K8AR 4D8KA 4PFPA 2VXEA 1VQOT 1ZBXA 2QTVA 2CP5A 2LZ6B 4M77A 1VUBA 1V29B 1BB9A 2K79A 1RADB 1YWPA 1GFDA 1WHKA 4ME7A 1M1KR 1YI2A 1K73R 1WIEA 2JT4A 3PVLA 1GFCA 2L3SA 5GANh 6AT1B 2LVMA 5LJ5h 1HSQA 3OYKA 2ZPFB 1Z9QA 2KXCA 3TSWA 5DM7R 3I35A 2HL3A 1KQ1A 2DXUA 5FWCA 4EPCA 1QLYA 4PJOA 3OYFA 3BDLA 1B07A 2M9UA 5GAOp 3TVTA 2LQ8A 3F70A 1LVKA 3SWNB 4DEYA 3M0RA 1YJNA 2GFAA 2RJEA 3ER0A 2CUBA 1OZ3A 4M7DF 4OP0A 2E6ZA 1JJ2P 3CMAT 2YUQA 4MDXA 2RI2A 3E1SA 4QKUA 2DNUA 2RHZA 4A53A 2KBTA 4LDWA 3PVQA 2EWNA 1X2KA 1JXMA 1M3BA 3HSBA 2A08A 2EJFA 3OYDA 3CMEA 4ATOA 3LYIA 2PQWA 2RNAA 4M7DE 3BE3A 2A3LA 2MK5A 4JJNK 2RD1A 4LN2A 3VRYA 5GANf 1EFNA 5LJ5f 2EKHA 3E19A 1K9MU 1C1AA 1Q81R 3A8MB 1MHNA 3WVEB 1I0CA 2QG9B 4FYWB 2LJ0A 1VQ9Q 3RNJA 3CCJT 2ZPGB 4FW1A 2XIDA 3SWNA 4C5HA 1WJQA 4E47A 3OS2A 4M7AD 5KCOA 3EFSA 4QW2A 4OGCA 4AFQC 1IGUA 2E5QA 1YNZA 3EHQA 1BKBA 1FYNA 2CS7A 3EFRA 1AWWA 5FROA 1Q7YR 2SEMA 1YCYA 2COWA 3NTIA 4LE9A 3SD4A 1ZHIA 1VQ8A
chains in the Genus database with same CATH topology
2XDDA 3CC7A 1YI2T 5LJ3d 3ZEHA 1M5Q1 4A54A 2K3YA 2R57A 2X35A 3BW1A 3JB9H 4EDUA 5LJ5d 2JOYA 3V7SA 2KDSA 5CVIA 1RI0A 2RA2A 4M78C 3JCMQ 1VQ5T 1BI2A 1I81A 1HXDA 2HD0A 1YJ9A 5IT9E 2CZ6B 1IREB 3NTHA 4E7HA 1M4ZA 3OS5A 5CQXA 3PMIA 1QW1A 1M8VA 3OW2A 4QQDA 4JS4A 4NL2A 2RJCA 4IKFA 3CBOA 3C95A 3HRTA 4QQ6A 4EMKA 2FL7A 2OTLT 1N9SA 2QEXA 5GAN2 3FEOA 3CCUA 2M16A 4KBMB 1G5VA 3M9QA 5GAMf 3JB9G 5GAN5 1DJ7B 5GMKe 3JCMf 3X20B 3C12A 2ZGWA 3KBGA 1YJNT 5LJ3h 5DLOA 1VQ6A 4JUVA 3T9NA 5GAOr 3RESA 3I55A 2B8AA 3CEYA 4RCCA 2DXTA 4FT2A 1BIBA 4N0AA 4N4IA 1MGQA 2DD5A 3M58A 3UWNA 3VUZA 3CCRA 4L59A 2OTJA 3VU3C 1Q86U 4II1A 3VYGA 3M4YA 3PMTA 4C92C 1QVFS 3BFMA 4N4GA 1JJ2S 3AHUA 4IUQA 2HAXA 1XQHA 2RO0A 2L8DA 2ZCFB 4CI0C 3ME9A 4HKEA 5GAN3 5LJ3j 3FB9A 1YIJA 2V8JA 3MEUA 3OYGA 1W2BS 4BE2A 4LDVA 2GF7A 2EYQA 3QBYA 5KCHA 2F69A 2K3XA 1I5LA 5I2MA 5GAMg 3CMET 4OB0B 4BDYA 3OMCA 1YBYA 4C8QB 1KQSA 1UGRB 4BI3A 2K2VA 3OYEA 4FU6A 4PLIA 5FU6C 5A0GA 1QVPA 1BI0A 4GY5A 5CKEA 2DK3A 2FVUA 1Y71A 2QQSA 5L8RE 4JLIA 2IG0A 4M75A 3S6WA 1R8OB 3DLLA 2QXFA 4XTZA 2CZ0B 2EQJA 4L6V5 4M78F 3UT1A 2MWOA 3J80E 3PFSA 3UPUA 1VQPA 3A8LB 3JCMd 4M7AA 1KQ2A 1U1SA 3QKJA 4J6YA 5CKHA 5CR2A 2WSCE 4M78D 3X26B 3HP9A 3FC3A 2BUDA 1S72A 3OW2S 2KQWA 5LL6S 1KD1C 1FXXA 4X9CA 1N6AA 4C8QC 1BI3A 1YITT 1O9SA 1VQMT 2OAUA 1VQ4A 2DD4A 2QQBA 2YRVA 3L1AA 5GAOq 3PTAA 5LJ3f 1BYMA 4QQGA 3MP6A 2CKKA 4J6WA 4BB7A 4DOWA 3VKIA 2X4WA 1KC8U 1BI1A 1QP3A 4BI4A 2DO3A 3ASKA 3NTKA 2DZ9A 2QA4A 1KG1A 4J7IA 1Y07A 1YHQT 3OYBA 1OYXA 4LD9K 4MZPA 4BACA 4RKUE 4C0ZA 5M9OA 4QVZA 1K73C 1KC8C 1M1KC 4UC4A 4XTXA 3I56A 2E10A 4A4GA 4E7LA 2LRQA 3QDRB 1X6OA 1VQNT 2VYTA 4KULA 1JBMA 2XKOC 1H641 3TREA 3V8LA 5HY6A 2GQVA 4HA8A 1B34B 5GAOm 4C92F 2EIFA 1VQ8T 2K5FA 4ELZC 3OB9A 4ZN1A 3CC7T 2XICA 2QQ9A 3OYMA 2BIVA 4BI8B 3CCVA 2XD0A 4C92D 1LOJA 4M78B 2DIQA 4Y91A 3RKYA 2EAYA 3VV0A 4OB3B 4LDXA 5FRMA 2DEQA 5LJ3g 3OMGA 4E7IA 2PUKB 2BKDN 4M75G 1YJWA 3OYIA 1IZ6A 1LJOA 5GANg 1YJ9T 1VQLA 1TH7A 2QDYB 2JTFA 5LJ5g 2RHXA 4D6WA 2WSEE 2E6NA 3FJPA 1FWZA 4M75E 1RL2A 2RI3A 3J7AF 4M7AG 5I21A 4X9DA 3HRSA 1PSEA 5KE3A 2QEXT 1FX7A 3CCUT 2LT1A 2RH2A 4O6JA 4M7AE 3RKWA 2H3JA 2RHYA 1D3BB 1NPRA 2XU8A 2VGNA 4FM4B 2KVQG 4J83A 1K8AC 1KHCA 3FLGA 5GMKm 3CC4A 4A4FA 1VQ6T 2RJDA 5CO7A 5KH6A 1M9SA 2X4JA 3WXMB 2ZZDA 1VQ9A 1VQ7A 5IN1A 4M77C 2M0OA 2PU9B 3LGFA 3RMQA 3V7RA 4C8QF 3I55T 2EFIA 3L2WA 3MP1A 4BY6B 3S3MA 2JVVA 3CCRT 4OF1A 3X24B 3KXTA 3LWIA 2OTJT 2DIGA 1N9RA 4XTWA 2QQAA 4C8QD 1ZHIA 4C92B 4M7DC 3RMSA 1WQWA 2E64A 2XK0A 3CCSA 2RB6A 3L2ZA 4JDSA 1GXIE 2DPPB 2LCLA 1OI1A 2E41A 4NL3A 1YIJT 4BD3A 3QYGB 4OMFB 4HCCA 3HKSA 5GMKh 3A8GB 4XTYA 3G71A 5CKBA 3WVDB 4J7FA 2GCXA 2VV5A 2ZPHB 3PIOA 3CCMA 1WNLA 3Q1JA 3MCAB 3O8VA 3OS0A 2JNGA 3P8HA 4J6XA 4M78A 5FU6B 4ZGEB 1Y7XA 4ZGDB 2RM4A 1Q81C 2XHCA 4C0GA 4BY6C 2YLBA 3QZ9B 4PJOC 3RERA 3LLRA 4Q5WA 4TVRA 4ZGJB 3JAME 1W4SA 2FYKA 4LDUA 4C5IA 2P0QA 4XQ3A 3QYHB 5C0MA 1BIAA 5GMKj 5C6SA 2RHIA 5FLXE 2XDBA 2EQMA 2Y4XA 2MMPA 3LH0A 3NFCA 4LD6A 4F7UF 2FB7A 3CCQA 3A5ZB 1VQPT 4HCZA 2RK2A 1QVGA 3P8BB 2PVOB 1VQOA 1M1GA 4O5VA 3S3OA 2KAFA 2DZCA 2P4TA 5GANe 2FHDA 3JCMX 3CXCS 1S72T 3FDRA 5LJ5e 1D3BA 3OYCA 3JCMg 4B9XA 4JRPA 2JZ2A 2EQKA 3CBPA 4OVAA 4R56A 3GIBA 3M54A 3S3NA 1VQ4T 3QZ5B 4HT8A 3JRZA 3M4GA 4PKCC 1U1TA 3SB2A 3JB9J 2E70A 1K8AU 4WF2A 4BE1A 1KD1U 1WJRA 1XOVA 3X25B 2E1HA 3LW5E 1AHJB 3H6ZA 2WSFE 1Q86C 2QA4T 3QHSA 2DAQA 1Q7YC 1VIFA 3LGLA 2C06A 1JRIA 2JN0A 4XTUA 3RIRA 4C92A 1HK9A 2DVEA 2L3RA 4XU1A 3GPLA 1ZQ1A 2IVWA 4XU2A 2O01E 5A2QE 1UGSB 2HNIA 4XAXB 3I56T 2DXCA 1G3YA 4M77D 2EQUA 3A8OB 3PT9A 1KHIA 5GAN4 4FIBA 3CPWS 4ELYC 3HHTB 2G3RA 3HPWA 5CAIA 1EIFA 3RKXA 3V8JA 1M1KU 1K73U 2Y4YA 3HRUA 3MP8A 2O4XB 2LDMA 3PNWC 4M78G 4X34A 3CCVT 1Q82C 2QTXA 3LWHA 4M7DD 3META 1Y96B 5DY9A 1X75C 2CYZB 3LX7A 4F7UB 4RMOA 4FSXA 4M78E 2ZPIB 4XK8E 2F5TX 1YJWT 1M90U 1QVFA 4A4EA 3VJPA 1JJ2A 2MI6A 4C5EA 4P5NA 1VQLT 2R5AA 5FRNA 3OBWA 4EMGA 4ZN3A 4XU0A 3CD6A 2EJGA 2K57A 2DXBA 3TCJA 4QVCA 3SWNC 1W2BA 2LNVA 2DKGA 3CBMA 2D0QB 4PJOF 2RHUA 3QUIA 3OBYA 3BDUA 3G4SA 4ZTJA 3GP8A 3QG1A 3JB9I 4C8QA 1M90C 4PJOD 5GMKi 3G7ZA 1N8RC 3N5BB 1PSFA 3BY7A 3CMAA 1NJIC 4EMHA 3CC4T 3ZFJA 2DTOA 4GLKA 4KUDK 4M77B 1VQ9T 1VQ7T 1X01A 4NS5A 4DOVA 3VUBA 2YHTA 5GAMe 2CZ1B 5GAMh 4MZTA 4EMKB 3GNGA 4C92G 4JLGA 4YTLA 4BDZA 3JCMe 3TU4K 3GOXA 1H3ZA 3MEAA 4KUIA 3ZBDA 5D6WA 5AYFA 4M7DB 4RG8A 1NPPA 5CQYA 1I4K1 1NZ9A 3FIFA 2LC4A 4NOYA 2K4YA 4OGEA 4C92E 5GAN6 3OY9A 3UDCA 2X4YA 3OSVA 4C0FA 1M1FA 3C4SA 1WQ7A 3HFNA 3OQ5A 1K9MC 5GAN7 3CCLA 3PGGA 3V8KA 4E7JA 3KUFA 5DLQE 3HL8A 3QPHA 2DTHA 2JUFA 3VYHB 4C0DC 3CC2A 2PVDB 2MWPA 3FRNA 2VUBA 3G71T 3L2RA 4DA4A 2VXFA 5A0LA 2O4XA 5HK0A 1U8RA 3CCMT 4A4HA 4JRQA 4JRIA 4V2SA 4JS5A 1XNIA 4F7UA 3CCST 4EMKC 3OYJA 4PJOB 4RCBA 3SFMA 2LX9A 1NE8A 3QJ6A 1WGSA 2V8IA 5A0DA 3CCJA 1UB4A 4PL6A 3QJYA 1P92A 1QP2A 2RK1A 2A7YA 3A8HB 3JCMV 2DJZA 2XG8D 1Q81U 1UEBA 3CCQT 2PVGB 5GAOn 3M5AA 2HQXA 5GANd 5IAYA 2VXEA 4C8QG 1VIEA 3JSCA 1B34A 5GAN8 5J26A 2DTIA 1ZBXA 2R5MA 1VQOT 1KQSS 2K5LA 4N0AC 3JB9F 4MMKA 4C8QE 1UGPB 4MMLA 3CCEA 2R58A 2QI2A 3HFOA 4M75B 2MF2A 3GNFB 1VQKA 4CRIA 3JCMP 4M77A 3JB9D 2KMTA 4ZTFA 1VUBA 1V29B 3MEWA 3MO8A 2HBPA 3QO3A 2JTMA 3L2VA 3G6EA 4IUVA 1G3TA 4M7AB 5KE2A 3GLXA 4M7DA 4ME7A 1YI2A 2EKOA 2RI5A 5HK3A 4B9WA 4A4KA 3OA6A 3X28B 5LJ3e 2MAMA 4J5YA 2KK4A 2VGMA 2LCCA 1JB0E 3DB4A 4MZMA 5GANh 1Q7YU 2M1HA 3C94A 3OYHA 1VQ5A 2LVMA 5LJ5h 3PIPA 2K5IA 3OYKA 2ZPFB 3M53A 4IUTA 3M55A 4M75C 2X4XA 3L42A 5DM7R 2L5QA 4F7UG 4VUBA 1KQ1A 2DXUA 4RG2A 4EPCA 1SSFA 2KY9A 4BUGA 1UGQB 2OTLA 2LTOA 3E9FA 3E9GA 4IUPA 4PJOA 2RJFA 3OYFA 2XDPA 4PNOA 4F7UE 5GAOl 3OYLA 3BDLA 4M7AC 4MDWA 2M9UA 2LT4A 3INZA 3TEEA 2D6FA 5GANj 5GAOp 1I8FA 3M56A 1Q82U 2LQ8A 3F70A 4M77F 3SDZA 5LJ5j 5D6XA 1YJNA 3SWNB 3CD6T 2GFAA 3DB3A 2RJEA 2XI9A 4FL6A 3OYYA 5CKFA 4KT0E 4Z02A 3ER0A 1OZ3A 2CGHA 4M7DF 3G4ST 2P0KA 4PLLA 4OP0A 2E6ZA 3H8ZA 3OYAA 3CMAT 4M77G 4MDXA 2GFUA 2RI2A 2YLCA 3E1SA 4BE0A 3EAEA 4HCBA 3QSUA 5EG2A 1N27A 5GAMd 3R6OA 2RHZA 4M77E 4A53A 4LDWA 2EWNA 2V8KA 3CPFA 1N8RU 3HSBA 5J3BA 2L89A 1G3WA 1NJIU 4M7DG 2EJFA 5GMKl 3OYDA 3CMEA 4ATOA 3LYIA 4QVDA 2ZPBB 2PQWA 4FT4A 3V7CA 4M7DE 5CK9A 3CXCA 4E7KA 3JCMW 2QQRA 2PUOB 2A3LA 4DQ2A 4JJNK 2RD1A 4IURA 4IUUA 3CCLT 3OSSC 4C0DB 5FU7B 3CC2T 3L2QA 5I2SA 1G3SA 5GANf 4R55A 3QIIA 1OZ2A 5LJ5f 4Y28E 3RUXA 2KSSA 2AHJB 2CZ7B 3E19A 3OYNA 1K9MU 2EJ9A 3A8MB 1MHNA 3JCMb 3DKMA 4OB1B 4PJOG 3WVEB 1O75A 4OB2B 2P0PA 3JCMh 4M75F 3URGA 4PJOE 5CCAA 4JRKA 4C5GA 3CCJT 2ZPGB 2I2LA 3MHXA 3JCMc 2XIDA 3L2UA 2VC8A 4LDYA 3MEVA 5CIUA 3SWNA 1YITA 4C5HA 1VQMA 1WJSA 4M75D 2HQEA 1LNXA 1XTDA 2F5KA 1WJQA 4E47A 2Y90A 4M7AF 3CPWA 4XTVA 3JCMJ 2NLUA 5FU7C 3P8DA 3OS2A 4L5GA 2E12A 4M7AD 3DLMA 5GAMj 4N4HA 1YHQA 2ZPEB 3M57A 5KCOA 5HKCA 3EFSA 4QW2A 2WACA 4OGCA 5CKDA 1Y96A 5J39A 4XU3A 3CCET 5D6YA 4HT9A 2E65A 2E5QA 3OS1A 1VQKT 1BKBA 2CS7A 3J81E 1WPYA 3EFRA 3GF5A 5FROA 1VQNA 4J8OA 3M59A 3G6ET 1YCYA 3SD4A 3NTIA 1VQ8A 2D9TA 2LQKA 1QVGS 3QXEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UDC A;  2VV5 A;  2RH2 A;  2GQV A;  3T9N A;  2P4T A;  2RK1 A;  1VIE A;  2OAU A;  3SFM A;  1VIF A;  2RK2 A; 
#chains in the Genus database with same CATH topology
 2XDD A;  1YI2 T;  3EGX A;  2M51 A;  2X35 A;  1WFW A;  4EDU A;  5KYN A;  2ED1 A;  2KDS A;  3JCM Q;  3CCQ Q;  1BI2 A;  1WHM A;  1HXD A;  1MNE A;  1YJ9 A;  2CZ6 B;  1IRE B;  2A0F B;  2PNI A;  1VQO Q;  2NUT B;  1EX4 A;  1SF9 A;  2CSI A;  2RJC A;  3CBO A;  3C95 A;  4FCY A;  2FL7 A;  3FEO A;  1RAB B;  3X20 B;  3KBG A;  1YJN T;  5DLO A;  1YWO A;  3T9N A;  2EYX A;  2O9S A;  1N8R R;  1VOM A;  4N4I A;  1MGQ A;  2DD5 A;  2FG0 A;  3UWN A;  3VUZ A;  3CCR A;  4L59 A;  3VU3 C;  3VYG A;  1ZUK A;  1ABQ A;  4C92 C;  3BFM A;  4IUQ A;  1YIJ A;  1TXQ A;  2BZX A;  3M0P A;  1AOJ A;  1UHF A;  2GF7 A;  5KCH A;  2K3X A;  5I2M A;  3CME T;  4M4Z A;  1JO8 A;  2K2V A;  4FU6 A;  4PLI A;  1QVP A;  4HVU A;  2DK3 A;  2FVU A;  2JJ9 A;  1TSF A;  1Y71 A;  2NUP A;  1QWF A;  1WXT A;  3S6W A;  2QXF A;  4XTZ A;  1UFF A;  1BCO A;  3CMA Q;  2DM1 A;  4JZ4 A;  3QWX X;  4M7A A;  2V1R A;  3FC3 A;  2DLP A;  5LL6 S;  2MOX A;  4X9C A;  1N6A A;  1VQ4 A;  2YRV A;  4LUE A;  4AG1 C;  4QQG A;  4BB7 A;  4J6W A;  4DOW A;  2K7A A;  1BI1 A;  4RTU A;  2DO3 A;  1UG1 A;  5EC7 A;  2AZS A;  4AMC A;  1I5O B;  2GTO A;  4BAC A;  5M9O A;  4XTX A;  4DBF A;  4J9B A;  2LRQ A;  3CPW P;  2VYT A;  1JBM A;  2XKO C;  3V8L A;  1VQ8 T;  1B34 B;  1HYO A;  2K5F A;  1PHT A;  3OB9 A;  4ZN1 A;  4HXJ A;  2LQN A;  2QQ9 A;  1TTH B;  4OB3 B;  4E7I A;  1GRI A;  1YJW A;  3OYI A;  1T0H A;  5GJW B;  1YJ9 T;  2AKK A;  2JTF A;  2E6N A;  3FJP A;  1JQQ A;  4M75 E;  2RI3 A;  1X43 A;  3J7A F;  2H3E B;  1RUW A;  2DL3 A;  2DJQ A;  1FX7 A;  1NPR A;  2XU8 A;  4FM4 B;  2KVQ G;  1KHC A;  3UA7 A;  5CO7 A;  5KH6 A;  1M9S A;  1YI2 Q;  2ZZD A;  2YT6 A;  1VQ7 A;  1WX6 A;  2J6K A;  3RMQ A;  3A1P A;  3EFO A;  3CCR T;  2EYZ A;  4C8Q D;  4M7D C;  4JDS A;  2DPP B;  2LCL A;  2LQW A;  1YIJ T;  1H92 A;  1NEB A;  3HKS A;  2AT1 B;  3WVD B;  2VV5 A;  2DE0 X;  1WNL A;  3Q1J A;  1Y7X A;  3SEM A;  1YJN Q;  1NJI R;  2XHC A;  3C0C A;  2BTT A;  3JAM E;  4ZGJ B;  4RTT A;  3EH1 A;  2FYK A;  3H9N A;  1NBE B;  5C6S A;  2XDB A;  2VWF A;  4F7U F;  4LD6 A;  1M27 C;  2PVO B;  1M1G A;  1Q86 U;  2DZC A;  3JCM X;  1KC8 R;  2FHD A;  3FDR A;  3OYC A;  3JCM g;  2YWW A;  4JRP A;  4R56 A;  1VQ4 T;  3QZ5 B;  3CME Q;  4PKC C;  3JB9 J;  3SB2 A;  2E70 A;  2E1H A;  1F1B B;  3LW5 E;  1Q86 C;  2DAQ A;  2C06 A;  2RQV A;  2FO0 A;  1UDL A;  1ZQ1 A;  1MMN A;  2PTK A;  2DXC A;  1ZA2 B;  3HHT B;  2COY A;  4J9C A;  5IH2 A;  2H8H A;  3MP8 A;  3HRU A;  4X34 A;  1MMD A;  1I07 A;  1K0X A;  2J6O A;  1Y96 B;  5DY9 A;  2M02 A;  4FSX A;  4M78 E;  2F5T X;  1YJW T;  1JJ2 A;  2ED0 A;  1OU9 A;  4ZN3 A;  2K57 A;  4PJO F;  3OBY A;  1MMG A;  3BDU A;  4C8Q A;  1NJI C;  1VQ8 Q;  4KUD K;  1VQ7 T;  1FMW A;  1IRX A;  2CZ1 B;  2CP2 A;  1WA7 A;  2JTE A;  3GNG A;  2DL4 A;  3JCM e;  2JMA A;  4KUI A;  5KYU B;  1YJ9 Q;  4RG8 A;  4NOY A;  4OGE A;  3O5Z A;  3OSV A;  3C4S A;  3HFN A;  2PVD B;  2MIO A;  3H41 A;  4GLM A;  1XNI A;  2KE9 A;  3QJ6 A;  1QCF A;  1P92 A;  3CCR Q;  2KT1 A;  1UEB A;  1KD1 R;  2FPD A;  3JSC A;  1KQS S;  4HCC A;  1B3Q A;  1YIJ Q;  5KYX B;  1UGP B;  4MML A;  3CCE A;  2QI2 A;  4M75 B;  2VB6 A;  3GNF B;  4CRI A;  3JB9 D;  2KMT A;  1WI7 A;  3MO8 A;  2JTM A;  2DYB A;  3L2V A;  1QVG P;  3A98 A;  5KYU A;  5HK3 A;  4PFZ A;  4A4K A;  3X28 B;  1TS9 A;  2MAM A;  2VGM A;  3DB4 A;  2CT3 A;  1VQ5 A;  3PIP A;  3M53 A;  4IUT A;  1SHG A;  4M75 C;  4F7U G;  4VUB A;  5ECA A;  1SSF A;  2EW3 A;  2KY9 A;  1UGQ B;  1VQ4 Q;  2OTL A;  2LTO A;  4IUP A;  1VA7 A;  2RJF A;  5IHN A;  5GAO l;  4MDW A;  3INZ A;  1I8F A;  1Q82 U;  2L2P A;  4CC3 A;  5CKF A;  4KT0 E;  2BE7 D;  2CGH A;  1SEM A;  3H8Z A;  4Z88 A;  1QVF P;  1BCM A;  4M77 G;  2FZK B;  2GFU A;  4DBQ A;  4BE0 A;  4HCB A;  4ORZ A;  1W2B P;  5EG2 A;  2KRN A;  1N27 A;  2Z0W A;  3CPF A;  1D09 B;  2L89 A;  3M0T A;  5GMK l;  1YJW Q;  4D8D A;  4FT4 A;  2L3Q A;  5CK9 A;  1V1C A;  4E7K A;  2QQR A;  2DFU A;  4DQ2 A;  4IUU A;  4C0D B;  1OX9 A;  3L2Q A;  4DBH A;  2DRK A;  4Y28 E;  3TQ7 P;  2AHJ B;  3OYN A;  1ACM B;  3JCM b;  1QKW A;  4PJO G;  3OW2 P;  3EG0 A;  4J9D A;  1OX8 A;  1GL5 A;  1R0C B;  1VQ7 Q;  5CCA A;  4OMQ A;  3MHX A;  1YIT A;  1LNX A;  1R0B G;  4M7A F;  3CPW A;  1K0S A;  3P8D A;  1OEB A;  1S1N A;  1PKT A;  3CCE T;  2HSE B;  3J81 E;  4WCI A;  4J9G A;  2B86 A;  4J8O A;  2EQI A;  4B6M A;  5KYY B;  4FYX B;  3QXE B;  4JRQ A;  1IHV A;  1M5Q 1;  3JB9 H;  2K9G A;  4M78 C;  1VQ5 T;  3NTH A;  2KXD A;  2YUP A;  4KH1 B;  1H3H A;  2GTJ A;  4EMK A;  2QGG A;  4E7S A;  2OTL T;  4KBM B;  3EG1 A;  5GAM f;  5GAN 5;  5GMK e;  2ZGW A;  5LJ3 h;  1RAA B;  2B8A A;  3OYA A;  2DXT A;  4FT2 A;  3M4Y A;  4N4G A;  2HAX A;  3QDF A;  2RO0 A;  2L8D A;  2ZCF B;  2O2O A;  3ME9 A;  1IGQ A;  3VS3 A;  2QAS A;  2V8J A;  3OYG A;  4BE2 A;  4LDV A;  5KYY A;  2EYQ A;  3QBY A;  2KRO A;  5GAM g;  1W70 A;  4BDY A;  2CDT A;  1K9M R;  2DVJ A;  1ZSZ B;  3M0S A;  5CKE A;  4E6R A;  4JLI A;  3REB B;  2EQJ A;  2DRM A;  3UT1 A;  1RLQ C;  2MWO A;  1GBQ A;  3PFS A;  3CXC P;  1RLP C;  1U1S A;  4J6Y A;  5CR2 A;  1K8A C;  3HP9 A;  1V76 A;  2IPO B;  1BI3 A;  1YIT T;  1O9S A;  5IXB A;  2OAU A;  2QGF B;  2DD4 A;  1ZSZ C;  3L1A A;  3PTA A;  5LJ3 f;  2HKQ B;  2CKK A;  2HL5 C;  1M2V B;  3VKI A;  1KJW A;  1UE9 A;  2K6D A;  4KH0 B;  4Z89 A;  4BI4 A;  2JM9 A;  2QA4 A;  1KG1 A;  2EVR A;  4J9H A;  3OYB A;  4LD9 K;  4MZP A;  2C0O A;  1M1K C;  1K73 C;  3I56 A;  4KUL A;  1OU8 A;  4F16 A;  2EIF A;  1K4U S;  1T0J A;  1TUC A;  4J9E A;  2BIV A;  2I0N A;  3CCV A;  1TU0 B;  1NYF A;  4C92 D;  4LDX A;  4Y91 A;  3RKY A;  2EAY A;  1AEY A;  2DEQ A;  5LJ3 g;  2PUK B;  1LJO A;  5GAN g;  1VQL A;  2QDY B;  5LJ5 g;  1RL2 A;  4M7A G;  5I21 A;  3CCE Q;  3HRS A;  4OMM A;  2AK5 A;  2LT1 A;  3RKW A;  4J83 A;  2F1L A;  1ABO A;  3CC4 A;  1AWX A;  1M2V A;  1K76 A;  4AFU C;  2DL7 A;  4C8Q F;  3L2W A;  3MP1 A;  3S3M A;  2E3H A;  2JVV A;  4LUD A;  3X24 B;  4PJM A;  4K11 A;  4XTW A;  1VQ5 Q;  4C92 B;  3RMS A;  1WQW A;  2E64 A;  1AVZ C;  3CCS A;  2RB6 A;  1PWT A;  4BD3 A;  4OMF B;  4RTW A;  2O9V A;  2OTL Q;  2MYS A;  3G71 A;  1KFZ A;  5CKB A;  3NHN A;  3SHW A;  2ZPH B;  3OS0 A;  2E3I A;  1OOT A;  1Q81 C;  3U23 A;  2VAS A;  2YLB A;  4LNP A;  4Q5W A;  1W1F A;  1W4S A;  2RQR A;  5I11 A;  4AG2 C;  2P0Q A;  4XQ3 A;  1BIA A;  5GMK j;  5FLX E;  2Y4X A;  3GBQ A;  4HCZ A;  1FMV A;  2RK2 A;  4AFS C;  5KYW B;  1QVG A;  2FZG B;  2V1Q A;  2YUN A;  3P8B B;  2KAF A;  5GAN e;  5LJ5 e;  3CBP A;  2VKN A;  2KEA A;  5HCK A;  3S3N A;  3RR6 A;  4HT8 A;  3M4G A;  1U1T A;  4WF2 A;  4BE1 A;  1WJR A;  1Q95 G;  2C0I A;  3X25 B;  1AHJ B;  2NUT A;  2WSF E;  1UHC A;  4OMP A;  1RAG B;  2LP5 A;  2QA4 T;  1Q7Y C;  1TUD A;  3RIR A;  4C92 A;  2L3R A;  4IIO A;  5D7U A;  5A2Q E;  3I56 T;  4JJD A;  1G3Y A;  2CRE A;  3PT9 A;  3PNW C;  3CCV T;  4M7D D;  3LWH A;  1YIT Q;  3MET A;  2JXB A;  3NMZ C;  1X75 C;  2CYZ B;  1AWO A;  4XK8 E;  1QVF A;  5FWB A;  2MI6 A;  2KNB B;  4P5N A;  1VQL T;  3EG9 B;  5GJV B;  3OBW A;  3CD6 A;  2EJG A;  4QVC A;  1W2B A;  4WTO B;  2F2V A;  2LNV A;  3CBM A;  1TOV A;  2D0Q B;  3RBB B;  5KYW A;  2RHU A;  1YFN A;  1AD5 A;  3JB9 I;  4PJN A;  1N8R C;  3BY7 A;  1QCN A;  3CC4 T;  2DA9 A;  5FW9 A;  3ZFJ A;  2DTO A;  4GLK A;  1X01 A;  2DBM A;  4DOV A;  3VUB A;  1AT1 B;  2YHT A;  1BBZ A;  2CH4 W;  2A28 A;  4YTL A;  3MEA A;  5AYF A;  4M7D B;  1I4K 1;  1NZ9 A;  3OY9 A;  2LC4 A;  3CCS T;  2K4Y A;  3OW2 A;  3QWY A;  2X4Y A;  1M1F A;  1WQ7 A;  1UUE A;  1U3O A;  3KUF A;  5DLQ E;  2DTH A;  2JUF A;  3VS7 A;  2GQI A;  1EZZ B;  3UAT A;  3FRN A;  1SHF A;  3G71 T;  3L2R A;  4RTX A;  1SKU B;  4JRI A;  2W0Z A;  2EYY A;  2KI7 A;  2LX7 A;  3I5S A;  2AIR B;  4RCB A;  1MND A;  1UB4 A;  1IHW A;  1PKS A;  2FRY A;  1A0N B;  1E7O A;  5GAN d;  2GGR A;  4C8Q G;  1VIE A;  1Y57 A;  1B34 A;  5J26 A;  2DTI A;  2R5M A;  2E5K A;  4N0A C;  3JB9 F;  4MMK A;  3HFO A;  1VQK A;  2F2W A;  2YRD A;  3MEW A;  2HBP A;  3EG3 A;  1G3T A;  3GLX A;  4M7D A;  3OA6 A;  1M8M A;  1KSW A;  2W10 A;  4J5Y A;  2KK4 A;  2HZY A;  1IB8 A;  1JB0 E;  4MZM A;  2M1H A;  3C94 A;  1D1C A;  1NG2 A;  4JPB W;  2K5I A;  2KGT A;  4RTY A;  3ZL7 C;  3M55 A;  1JEG A;  2X4X A;  3MPU B;  1RAF B;  4RG2 A;  4BUG A;  4RTZ A;  4F7U E;  4RUG A;  5GAN j;  4M77 F;  2F2X A;  3SDZ A;  5LJ5 j;  2ROL A;  2QA4 Q;  3CD6 T;  2RN8 A;  2K2M A;  5AT1 B;  2VVK A;  2P0K A;  3I56 Q;  4PLL A;  4J9I A;  4ZNX A;  2J6F A;  5L23 A;  4JJB A;  2YLC A;  3EAE A;  1M3C A;  2HQH A;  3CCV Q;  4M77 E;  2V8K A;  5J3B A;  1NJI U;  5IXF A;  4QVD A;  3V7C A;  1T3L A;  1VQL Q;  3EH2 A;  1OQK A;  3CXC A;  2PUO B;  2DF6 A;  3OSS C;  5I2S A;  1X2Q A;  1NLO C;  2KSS A;  2CZ7 B;  2SRC A;  3DKM A;  4OB1 B;  4ESR A;  1O75 A;  1WHH A;  3CC4 Q;  2P0P A;  3URG A;  4PJO E;  4IIM A;  4C5G A;  1KC8 C;  2VC8 A;  4M75 D;  1XTD A;  2F5K A;  2ESW A;  3H0F A;  4XTV A;  2NLU A;  3CCS Q;  8AT1 B;  4JJC A;  1H8K A;  1GCQ C;  3DLM A;  4N4H A;  1YHQ A;  2ZPE B;  5HKC A;  2WAC A;  1Y96 A;  3G71 Q;  2X51 A;  1VQK T;  1WPY A;  3GF5 A;  2CUD A;  1I1J A;  2O31 A;  1WZO A;  2HBW A;  4F14 A;  2YDL A;  2D9T A;  2LQK A;  3L2U A;  3CC7 A;  2L0A A;  2OAW A;  2D8H A;  2K3Y A;  2R57 A;  1RI9 A;  1YCS B;  4KGV B;  1RI0 A;  2O88 A;  2HD0 A;  5IT9 E;  1Q82 R;  3OS5 A;  5CQX A;  1OV3 A;  1M8V A;  4JS4 A;  4NL2 A;  2G6F X;  4IKF A;  3HRT A;  1N9S A;  2FPE A;  2M16 A;  1G5V A;  3M9Q A;  3JB9 G;  3EGU A;  1RAI B;  1DJ7 B;  1VQ6 A;  1WHL A;  1NLP C;  2LMJ A;  4JUV A;  1M90 R;  1SRL A;  3CEY A;  4RCC A;  4II1 A;  1QCO A;  1JXO A;  3PMT A;  1JJ2 S;  1XQH A;  3NGP A;  3FB9 A;  2QAZ A;  3OMC A;  1MV3 A;  1YBY A;  4BI3 A;  1U5S A;  3CD6 Q;  5FU6 C;  1BI0 A;  1D0Y A;  1MV0 B;  2CH4 A;  3E2U A;  1SSH A;  5KYX A;  4M75 A;  1QMC A;  3LH5 A;  3DLL A;  2CZ0 B;  4L6V 5;  3J80 E;  3UPU A;  1VQP A;  3JCM d;  3QKJ A;  4M78 D;  1SG5 A;  3JV3 A;  1KD1 C;  2KQW A;  1NEG A;  4R0K A;  2QQB A;  5GAO q;  1G8X A;  1PM3 A;  1QP3 A;  3ASK A;  3NTK A;  5IHI A;  1PD1 A;  1Y07 A;  1YHQ T;  2MCN A;  3VS2 A;  2A36 A;  4RKU E;  4C0Z A;  3QDR B;  2IIM A;  1PCX A;  2QK0 A;  1H64 1;  4FYY B;  5HY6 A;  5GAO m;  4C92 F;  4E2F B;  3CC7 T;  3ULR B;  3OYM A;  1D1B A;  4OMN A;  4M78 B;  2K3B A;  4DEX A;  4PJJ A;  3OMG A;  1TH7 A;  2RHX A;  1FWZ A;  2FRW A;  2DX1 A;  1VQK Q;  2RH2 A;  1PRL C;  4O6J A;  4M7A E;  2H3J A;  1ZSG A;  1D3B B;  7AT1 B;  1AZE A;  5GMK m;  1VQ6 T;  1PD0 A;  4A4F A;  2RJD A;  3WXM B;  4M77 C;  2M0O A;  3LGF A;  1CKA A;  2ATC B;  2KT8 A;  4BY6 B;  2KYM A;  3KXT A;  2DIG A;  1N9R A;  2QQA A;  4RTV A;  4HVW A;  3EG2 A;  3L2Z A;  3QYG B;  4XTY A;  2L3P A;  4J7F A;  2GCX A;  4PFO A;  3PIO A;  3CCM A;  1CSK A;  3MCA B;  3O8V A;  2JNG A;  4M78 A;  2PZ1 A;  4ZGE B;  2NWM A;  3MKD A;  4KRT A;  4BY6 C;  2ROT A;  4PJO C;  4LDU A;  1J3T A;  2COZ A;  1VYU A;  1KQS P;  3NFC A;  2FB7 A;  3A5Z B;  1VQP T;  4O5V A;  3S3O A;  1T3S A;  1D3B A;  4B9X A;  4FW2 A;  2EQK A;  3M54 A;  1S72 Q;  2KR3 A;  2NYS A;  1K8A U;  1XOV A;  4OML A;  1U06 A;  3H6Z A;  1RAC B;  3QHS A;  1JRI A;  4XTU A;  1HK9 A;  2DVE A;  2LCS A;  2IVW A;  2OX7 A;  1UGS B;  1SRM A;  3A8O B;  1KHI A;  5GAN 4;  4FIB A;  3CPW S;  4ELY C;  3RKX A;  3V8J A;  1M1K U;  1K73 U;  2LDM A;  1QWE A;  1K9A A;  3LX7 A;  3VJP A;  2CSQ A;  4C5E A;  2R5A A;  5FRN A;  1E6G A;  4EMG A;  4XU0 A;  2DXB A;  3VS5 A;  3SWN C;  1YHQ Q;  3EGX B;  1LCK A;  2ZAE A;  1WLP B;  3G4S A;  4EIK A;  3GP8 A;  3QG1 A;  4ZTJ A;  3I9Q A;  1PSF A;  2BE9 B;  1CKB A;  1ZSZ A;  4EMH A;  3CC7 Q;  2P4R A;  4NS5 A;  4X1V A;  2DL8 A;  5GAM e;  4MZT A;  4C92 G;  3TU4 K;  3GOX A;  1MMA A;  5D6W A;  3ZBD A;  5GAN 6;  3AT1 B;  3UDC A;  2HDA A;  4C0F A;  3OQ5 A;  1K9M C;  3CCL A;  3V8K A;  3HL8 A;  3CC2 A;  3VYH B;  1M30 A;  2QYZ A;  2VUB A;  4DA4 A;  2VXF A;  5A0L A;  3CCM T;  4V2S A;  4JS5 A;  1VQ6 Q;  1PC0 A;  2JMC A;  3SFM A;  1NE8 A;  2DER A;  3MJX A;  3PE0 A;  4PL6 A;  3QJY A;  1QP2 A;  2RK1 A;  1NYG A;  2A7Y A;  3JCM V;  4Y92 A;  2DJZ A;  1Q81 U;  2JM8 A;  5GAO n;  3M5A A;  2HQX A;  3H0I A;  5IAY A;  5GAN 8;  3RDV A;  2K5L A;  2NUP B;  4C8Q E;  2R58 A;  2MF2 A;  4AFZ C;  4JZ3 A;  3JCM P;  4ZTF A;  3QO3 A;  3G6E A;  2GNC A;  4IUV A;  1YN8 A;  4M7A B;  5KE2 A;  2GBQ A;  2EKO A;  2RI5 A;  4B9W A;  5LJ3 e;  2X9H A;  2BZ8 A;  2LCC A;  4KGX B;  4QT7 A;  4CC2 A;  1Q7Y U;  3OYH A;  1AZG B;  1VQP Q;  4F04 B;  1WHG A;  1X69 A;  1AWJ A;  3L42 A;  1OPK A;  1OPL A;  1TWB A;  2L5Q A;  1MUZ A;  2JS2 A;  3E9F A;  3E9G A;  2XDP A;  3EHR A;  4PNO A;  3OYL A;  4M7A C;  2LT4 A;  2D6F A;  3TEE A;  2BZY A;  2E4H A;  2LJ1 A;  3M56 A;  1JU5 C;  5D6X A;  2V26 A;  3DB3 A;  1FMK A;  2XI9 A;  3OYY A;  4FL6 A;  1WDX A;  4Z02 A;  5I22 A;  3G4S T;  1Z9Z A;  1PNJ A;  3REA B;  1ZBJ A;  1E6H A;  1B7T A;  2AZV A;  1QQJ A;  3QSU A;  5GAM d;  3R6O A;  3THK A;  3EGD B;  1N8R U;  2DL5 A;  4M7D G;  1G3W A;  2YXY A;  2RF0 A;  2ZPB B;  3JCM W;  4IUR A;  3CCL T;  5FU7 B;  3CC2 T;  1G3S A;  4R55 A;  2HCK A;  3QII A;  1IXD A;  1OZ2 A;  3RUX A;  3EFO B;  4CC4 B;  2EJ9 A;  2DET A;  1TG0 A;  4OB2 B;  4PK4 A;  2HSP A;  3JCM h;  4M75 F;  4JRK A;  1D0X A;  2I2L A;  3JCM c;  1UJY A;  4LDY A;  3MEV A;  2A37 A;  5CIU A;  1VQM A;  1WJS A;  2J7I A;  2HQE A;  1D1A A;  2Y90 A;  4DBR A;  3CCJ Q;  3JCM J;  4AT1 B;  5FU7 C;  1X27 A;  3NPF A;  4L5G A;  2LNH B;  2E12 A;  5GAM j;  2CP0 A;  3M57 A;  5CKD A;  5J39 A;  4XU3 A;  4HT9 A;  5D6Y A;  2E65 A;  3OS1 A;  2FEI A;  1Q86 R;  3CCM Q;  3EGD A;  2X3W D;  1VQN A;  3G6E T;  3M59 A;  2ENM A;  3EG9 A;  3M0Q A;  3UA6 A;  1QVG S;  4E7Z A;  5LJ3 d;  3ZEH A;  4A54 A;  3BW1 A;  5LJ5 d;  2JOY A;  3V7S A;  5CVI A;  2RA2 A;  3VS0 A;  1I81 A;  4E7H A;  1M4Z A;  3CQT A;  3PMI A;  1QW1 A;  1UTI A;  4QQD A;  5IHK A;  4KGZ B;  4QQ6 A;  2EYW A;  2QEX A;  5GAN 2;  3CCU A;  2KRS A;  2RQU A;  3JCM f;  3C12 A;  4J9F A;  2OJ2 A;  3M0U A;  1RAE B;  1UGV A;  4PJL A;  3RES A;  5GAO r;  3I55 A;  1D0Z A;  1BIB A;  4N0A A;  3M58 A;  2OTJ A;  4LXC A;  2DMO A;  8ATC B;  1R77 A;  1QVF S;  3AHU A;  1HJD A;  4CI0 C;  4HKE A;  5GAN 3;  5LJ3 j;  1HD3 A;  3MEU A;  1W2B S;  2F69 A;  1I5L A;  4OB0 B;  4C8Q B;  2HMA A;  2J06 A;  1KQS A;  2M0Y A;  1UGR B;  3OYE A;  3FJ5 A;  2EGC A;  2D0N A;  5A0G A;  1BK2 A;  2EGE A;  4GY5 A;  2QQS A;  1X6B A;  5L8R E;  2IG0 A;  4FSS A;  3G4S Q;  1R8O B;  1M2O A;  2ABL A;  2OI3 A;  2YUO A;  4M78 F;  4OMO A;  1KIK A;  3A8L B;  1ARK A;  1KQ2 A;  2FZC B;  5CKH A;  2WSC E;  3VS1 A;  3X26 B;  1S72 A;  2BUD A;  3OW2 S;  1FXX A;  4C8Q C;  1XJW B;  2QDL A;  1VQM T;  1BYM A;  2XMF A;  3MP6 A;  3I5R A;  2X4W A;  1KC8 U;  2DIL A;  3H0H A;  2YRC A;  3CCL Q;  2DZ9 A;  4J7I A;  3CC2 Q;  1OYX A;  1LPL A;  4QVZ A;  4UC4 A;  4E7L A;  2E10 A;  4A4G A;  1C6V X;  1X6O A;  1VQN T;  1G83 A;  2D8J A;  3TRE A;  2EGA A;  2GQV A;  1RAH B;  2EBP A;  4HA8 A;  1ZUY A;  4ELZ C;  1GCP A;  2XIC A;  3R6N A;  4BI8 B;  2XD0 A;  1LOJ A;  2DIQ A;  3VV0 A;  1ZX6 A;  5FRM A;  2DBK A;  2KRM A;  2BKD N;  4M75 G;  9ATC B;  1IZ6 A;  1GBR A;  2X3X D;  1M3A A;  4D6W A;  2WSE E;  4FYV B;  1VYT A;  4X9D A;  4HVV A;  1PSE A;  5KE3 A;  2QEX T;  3CCU T;  2RHY A;  3G6E Q;  2VGN A;  1IO6 A;  3FLG A;  3UF4 A;  2X4J A;  4F17 A;  1VQ9 A;  5IN1 A;  2MPX C;  2PU9 B;  1Y0M A;  1NM7 A;  4A63 B;  3V7R A;  3I55 T;  1GCQ A;  2EFI A;  2JW4 A;  4OF1 A;  3KFV A;  3LWI A;  2OTJ T;  3D7S B;  2KYB A;  1X6G A;  2XK0 A;  1GXI E;  1BU1 A;  1OI1 A;  2E41 A;  4NL3 A;  3G1J A;  5GMK h;  3A8G B;  1WXB A;  2ECZ A;  2RPN A;  3P8H A;  4J6X A;  5FU6 B;  2CP6 A;  4ZGD B;  2RM4 A;  4C0G A;  2CP7 A;  3QZ9 B;  3TSZ A;  3RER A;  3LLR A;  4TVR A;  1W6X A;  4C5I A;  2J05 A;  1N5Z A;  3QYH B;  4GBQ A;  5C0M A;  2RHI A;  2EQM A;  3CCQ A;  2MMP A;  3LH0 A;  1WXU A;  1VQO A;  4Z8A A;  2P4T A;  1WYX A;  3HTR A;  2HEQ A;  1S72 T;  3CXC S;  1PRM C;  2JZ2 A;  3GIB A;  4OVA A;  3JRZ A;  1KD1 U;  2CT4 A;  4ANJ A;  1VIF A;  2LJ3 A;  3LGL A;  2JN0 A;  2AKL A;  4XU1 A;  3GPL A;  1QKX A;  1KK7 A;  4XU2 A;  2O01 E;  2HNI A;  4XAX B;  2RQW A;  4M77 D;  2EQU A;  1K1Z A;  2G3R A;  3HPW A;  4HCK A;  1EIF A;  2D1X A;  5CAI A;  2Y4Y A;  2DYI A;  4M78 G;  2O4X B;  1Q82 C;  2QTX A;  1VQM Q;  4F7U B;  4RMO A;  1G2B A;  2ZPI B;  1ZUU A;  1M90 U;  4A4E A;  2RQT A;  3TCJ A;  1PG5 B;  2DKG A;  1UEC A;  3QUI A;  1OUL A;  1M90 C;  4PJO D;  3VS4 A;  1WHJ A;  1SPK A;  1TUG B;  1ZLM A;  3G7Z A;  5GMK i;  3N5B B;  1VQN Q;  3CMA A;  3VRZ A;  4M77 B;  1VQ9 T;  2RMO A;  5GAM h;  4EMK B;  2CP3 A;  4JLG A;  4BDZ A;  4CC7 A;  1H3Z A;  1VYV A;  1ZA1 B;  1NPP A;  5CQY A;  3FIF A;  2YSQ A;  4C92 E;  3VS6 A;  5GAN 7;  1UJ0 A;  1YP5 A;  3PGG A;  4E7J A;  2EPD A;  3QPH A;  4C0D C;  2P84 A;  2MWP A;  2QEX Q;  2JS0 A;  3CCU Q;  1U8R A;  2O4X A;  5HK0 A;  4A4H A;  4F7U A;  4EMK C;  3OYJ A;  4PJO B;  2C0T A;  2LX9 A;  1WGS A;  2V8I A;  5A0D A;  3CCJ A;  3I55 Q;  2DEU A;  2NUZ A;  3IQL A;  3A8H B;  2OTJ Q;  2FPF A;  2XG8 D;  2HKN A;  3CCQ T;  1C0M A;  2PVG B;  1K8A R;  4D8K A;  4PFP A;  2VXE A;  1VQO T;  1ZBX A;  2QTV A;  2CP5 A;  2LZ6 B;  4M77 A;  1VUB A;  1V29 B;  1BB9 A;  2K79 A;  1RAD B;  1YWP A;  1GFD A;  1WHK A;  4ME7 A;  1M1K R;  1YI2 A;  1K73 R;  1WIE A;  2JT4 A;  3PVL A;  1GFC A;  2L3S A;  5GAN h;  6AT1 B;  2LVM A;  5LJ5 h;  1HSQ A;  3OYK A;  2ZPF B;  1Z9Q A;  2KXC A;  3TSW A;  5DM7 R;  3I35 A;  2HL3 A;  1KQ1 A;  2DXU A;  5FWC A;  4EPC A;  1QLY A;  4PJO A;  3OYF A;  3BDL A;  1B07 A;  2M9U A;  5GAO p;  3TVT A;  2LQ8 A;  3F70 A;  1LVK A;  3SWN B;  4DEY A;  3M0R A;  1YJN A;  2GFA A;  2RJE A;  3ER0 A;  2CUB A;  1OZ3 A;  4M7D F;  4OP0 A;  2E6Z A;  1JJ2 P;  3CMA T;  2YUQ A;  4MDX A;  2RI2 A;  3E1S A;  4QKU A;  2DNU A;  2RHZ A;  4A53 A;  2KBT A;  4LDW A;  3PVQ A;  2EWN A;  1X2K A;  1JXM A;  1M3B A;  3HSB A;  2A08 A;  2EJF A;  3OYD A;  3CME A;  4ATO A;  3LYI A;  2PQW A;  2RNA A;  4M7D E;  3BE3 A;  2A3L A;  2MK5 A;  4JJN K;  2RD1 A;  4LN2 A;  3VRY A;  5GAN f;  1EFN A;  5LJ5 f;  2EKH A;  3E19 A;  1K9M U;  1C1A A;  1Q81 R;  3A8M B;  1MHN A;  3WVE B;  1I0C A;  2QG9 B;  4FYW B;  2LJ0 A;  1VQ9 Q;  3RNJ A;  3CCJ T;  2ZPG B;  4FW1 A;  2XID A;  3SWN A;  4C5H A;  1WJQ A;  4E47 A;  3OS2 A;  4M7A D;  5KCO A;  3EFS A;  4QW2 A;  4OGC A;  4AFQ C;  1IGU A;  2E5Q A;  1YNZ A;  3EHQ A;  1BKB A;  1FYN A;  2CS7 A;  3EFR A;  1AWW A;  5FRO A;  1Q7Y R;  2SEM A;  1YCY A;  2COW A;  3NTI A;  4LE9 A;  3SD4 A;  1ZHI A;  1VQ8 A; 
#chains in the Genus database with same CATH homology
 2XDD A;  3CC7 A;  1YI2 T;  5LJ3 d;  3ZEH A;  1M5Q 1;  4A54 A;  2K3Y A;  2R57 A;  2X35 A;  3BW1 A;  3JB9 H;  4EDU A;  5LJ5 d;  2JOY A;  3V7S A;  2KDS A;  5CVI A;  1RI0 A;  2RA2 A;  4M78 C;  3JCM Q;  1VQ5 T;  1BI2 A;  1I81 A;  1HXD A;  2HD0 A;  1YJ9 A;  5IT9 E;  2CZ6 B;  1IRE B;  3NTH A;  4E7H A;  1M4Z A;  3OS5 A;  5CQX A;  3PMI A;  1QW1 A;  1M8V A;  3OW2 A;  4QQD A;  4JS4 A;  4NL2 A;  2RJC A;  4IKF A;  3CBO A;  3C95 A;  3HRT A;  4QQ6 A;  4EMK A;  2FL7 A;  2OTL T;  1N9S A;  2QEX A;  5GAN 2;  3FEO A;  3CCU A;  2M16 A;  4KBM B;  1G5V A;  3M9Q A;  5GAM f;  3JB9 G;  5GAN 5;  1DJ7 B;  5GMK e;  3JCM f;  3X20 B;  3C12 A;  2ZGW A;  3KBG A;  1YJN T;  5LJ3 h;  5DLO A;  1VQ6 A;  4JUV A;  3T9N A;  5GAO r;  3RES A;  3I55 A;  2B8A A;  3CEY A;  4RCC A;  2DXT A;  4FT2 A;  1BIB A;  4N0A A;  4N4I A;  1MGQ A;  2DD5 A;  3M58 A;  3UWN A;  3VUZ A;  3CCR A;  4L59 A;  2OTJ A;  3VU3 C;  1Q86 U;  4II1 A;  3VYG A;  3M4Y A;  3PMT A;  4C92 C;  1QVF S;  3BFM A;  4N4G A;  1JJ2 S;  3AHU A;  4IUQ A;  2HAX A;  1XQH A;  2RO0 A;  2L8D A;  2ZCF B;  4CI0 C;  3ME9 A;  4HKE A;  5GAN 3;  5LJ3 j;  3FB9 A;  1YIJ A;  2V8J A;  3MEU A;  3OYG A;  1W2B S;  4BE2 A;  4LDV A;  2GF7 A;  2EYQ A;  3QBY A;  5KCH A;  2F69 A;  2K3X A;  1I5L A;  5I2M A;  5GAM g;  3CME T;  4OB0 B;  4BDY A;  3OMC A;  1YBY A;  4C8Q B;  1KQS A;  1UGR B;  4BI3 A;  2K2V A;  3OYE A;  4FU6 A;  4PLI A;  5FU6 C;  5A0G A;  1QVP A;  1BI0 A;  4GY5 A;  5CKE A;  2DK3 A;  2FVU A;  1Y71 A;  2QQS A;  5L8R E;  4JLI A;  2IG0 A;  4M75 A;  3S6W A;  1R8O B;  3DLL A;  2QXF A;  4XTZ A;  2CZ0 B;  2EQJ A;  4L6V 5;  4M78 F;  3UT1 A;  2MWO A;  3J80 E;  3PFS A;  3UPU A;  1VQP A;  3A8L B;  3JCM d;  4M7A A;  1KQ2 A;  1U1S A;  3QKJ A;  4J6Y A;  5CKH A;  5CR2 A;  2WSC E;  4M78 D;  3X26 B;  3HP9 A;  3FC3 A;  2BUD A;  1S72 A;  3OW2 S;  2KQW A;  5LL6 S;  1KD1 C;  1FXX A;  4X9C A;  1N6A A;  4C8Q C;  1BI3 A;  1YIT T;  1O9S A;  1VQM T;  2OAU A;  1VQ4 A;  2DD4 A;  2QQB A;  2YRV A;  3L1A A;  5GAO q;  3PTA A;  5LJ3 f;  1BYM A;  4QQG A;  3MP6 A;  2CKK A;  4J6W A;  4BB7 A;  4DOW A;  3VKI A;  2X4W A;  1KC8 U;  1BI1 A;  1QP3 A;  4BI4 A;  2DO3 A;  3ASK A;  3NTK A;  2DZ9 A;  2QA4 A;  1KG1 A;  4J7I A;  1Y07 A;  1YHQ T;  3OYB A;  1OYX A;  4LD9 K;  4MZP A;  4BAC A;  4RKU E;  4C0Z A;  5M9O A;  4QVZ A;  1K73 C;  1KC8 C;  1M1K C;  4UC4 A;  4XTX A;  3I56 A;  2E10 A;  4A4G A;  4E7L A;  2LRQ A;  3QDR B;  1X6O A;  1VQN T;  2VYT A;  4KUL A;  1JBM A;  2XKO C;  1H64 1;  3TRE A;  3V8L A;  5HY6 A;  2GQV A;  4HA8 A;  1B34 B;  5GAO m;  4C92 F;  2EIF A;  1VQ8 T;  2K5F A;  4ELZ C;  3OB9 A;  4ZN1 A;  3CC7 T;  2XIC A;  2QQ9 A;  3OYM A;  2BIV A;  4BI8 B;  3CCV A;  2XD0 A;  4C92 D;  1LOJ A;  4M78 B;  2DIQ A;  4Y91 A;  3RKY A;  2EAY A;  3VV0 A;  4OB3 B;  4LDX A;  5FRM A;  2DEQ A;  5LJ3 g;  3OMG A;  4E7I A;  2PUK B;  2BKD N;  4M75 G;  1YJW A;  3OYI A;  1IZ6 A;  1LJO A;  5GAN g;  1YJ9 T;  1VQL A;  1TH7 A;  2QDY B;  2JTF A;  5LJ5 g;  2RHX A;  4D6W A;  2WSE E;  2E6N A;  3FJP A;  1FWZ A;  4M75 E;  1RL2 A;  2RI3 A;  3J7A F;  4M7A G;  5I21 A;  4X9D A;  3HRS A;  1PSE A;  5KE3 A;  2QEX T;  1FX7 A;  3CCU T;  2LT1 A;  2RH2 A;  4O6J A;  4M7A E;  3RKW A;  2H3J A;  2RHY A;  1D3B B;  1NPR A;  2XU8 A;  2VGN A;  4FM4 B;  2KVQ G;  4J83 A;  1K8A C;  1KHC A;  3FLG A;  5GMK m;  3CC4 A;  4A4F A;  1VQ6 T;  2RJD A;  5CO7 A;  5KH6 A;  1M9S A;  2X4J A;  3WXM B;  2ZZD A;  1VQ9 A;  1VQ7 A;  5IN1 A;  4M77 C;  2M0O A;  2PU9 B;  3LGF A;  3RMQ A;  3V7R A;  4C8Q F;  3I55 T;  2EFI A;  3L2W A;  3MP1 A;  4BY6 B;  3S3M A;  2JVV A;  3CCR T;  4OF1 A;  3X24 B;  3KXT A;  3LWI A;  2OTJ T;  2DIG A;  1N9R A;  4XTW A;  2QQA A;  4C8Q D;  1ZHI A;  4C92 B;  4M7D C;  3RMS A;  1WQW A;  2E64 A;  2XK0 A;  3CCS A;  2RB6 A;  3L2Z A;  4JDS A;  1GXI E;  2DPP B;  2LCL A;  1OI1 A;  2E41 A;  4NL3 A;  1YIJ T;  4BD3 A;  3QYG B;  4OMF B;  4HCC A;  3HKS A;  5GMK h;  3A8G B;  4XTY A;  3G71 A;  5CKB A;  3WVD B;  4J7F A;  2GCX A;  2VV5 A;  2ZPH B;  3PIO A;  3CCM A;  1WNL A;  3Q1J A;  3MCA B;  3O8V A;  3OS0 A;  2JNG A;  3P8H A;  4J6X A;  4M78 A;  5FU6 B;  4ZGE B;  1Y7X A;  4ZGD B;  2RM4 A;  1Q81 C;  2XHC A;  4C0G A;  4BY6 C;  2YLB A;  3QZ9 B;  4PJO C;  3RER A;  3LLR A;  4Q5W A;  4TVR A;  4ZGJ B;  3JAM E;  1W4S A;  2FYK A;  4LDU A;  4C5I A;  2P0Q A;  4XQ3 A;  3QYH B;  5C0M A;  1BIA A;  5GMK j;  5C6S A;  2RHI A;  5FLX E;  2XDB A;  2EQM A;  2Y4X A;  2MMP A;  3LH0 A;  3NFC A;  4LD6 A;  4F7U F;  2FB7 A;  3CCQ A;  3A5Z B;  1VQP T;  4HCZ A;  2RK2 A;  1QVG A;  3P8B B;  2PVO B;  1VQO A;  1M1G A;  4O5V A;  3S3O A;  2KAF A;  2DZC A;  2P4T A;  5GAN e;  2FHD A;  3JCM X;  3CXC S;  1S72 T;  3FDR A;  5LJ5 e;  1D3B A;  3OYC A;  3JCM g;  4B9X A;  4JRP A;  2JZ2 A;  2EQK A;  3CBP A;  4OVA A;  4R56 A;  3GIB A;  3M54 A;  3S3N A;  1VQ4 T;  3QZ5 B;  4HT8 A;  3JRZ A;  3M4G A;  4PKC C;  1U1T A;  3SB2 A;  3JB9 J;  2E70 A;  1K8A U;  4WF2 A;  4BE1 A;  1KD1 U;  1WJR A;  1XOV A;  3X25 B;  2E1H A;  3LW5 E;  1AHJ B;  3H6Z A;  2WSF E;  1Q86 C;  2QA4 T;  3QHS A;  2DAQ A;  1Q7Y C;  1VIF A;  3LGL A;  2C06 A;  1JRI A;  2JN0 A;  4XTU A;  3RIR A;  4C92 A;  1HK9 A;  2DVE A;  2L3R A;  4XU1 A;  3GPL A;  1ZQ1 A;  2IVW A;  4XU2 A;  2O01 E;  5A2Q E;  1UGS B;  2HNI A;  4XAX B;  3I56 T;  2DXC A;  1G3Y A;  4M77 D;  2EQU A;  3A8O B;  3PT9 A;  1KHI A;  5GAN 4;  4FIB A;  3CPW S;  4ELY C;  3HHT B;  2G3R A;  3HPW A;  5CAI A;  1EIF A;  3RKX A;  3V8J A;  1M1K U;  1K73 U;  2Y4Y A;  3HRU A;  3MP8 A;  2O4X B;  2LDM A;  3PNW C;  4M78 G;  4X34 A;  3CCV T;  1Q82 C;  2QTX A;  3LWH A;  4M7D D;  3MET A;  1Y96 B;  5DY9 A;  1X75 C;  2CYZ B;  3LX7 A;  4F7U B;  4RMO A;  4FSX A;  4M78 E;  2ZPI B;  4XK8 E;  2F5T X;  1YJW T;  1M90 U;  1QVF A;  4A4E A;  3VJP A;  1JJ2 A;  2MI6 A;  4C5E A;  4P5N A;  1VQL T;  2R5A A;  5FRN A;  3OBW A;  4EMG A;  4ZN3 A;  4XU0 A;  3CD6 A;  2EJG A;  2K57 A;  2DXB A;  3TCJ A;  4QVC A;  3SWN C;  1W2B A;  2LNV A;  2DKG A;  3CBM A;  2D0Q B;  4PJO F;  2RHU A;  3QUI A;  3OBY A;  3BDU A;  3G4S A;  4ZTJ A;  3GP8 A;  3QG1 A;  3JB9 I;  4C8Q A;  1M90 C;  4PJO D;  5GMK i;  3G7Z A;  1N8R C;  3N5B B;  1PSF A;  3BY7 A;  3CMA A;  1NJI C;  4EMH A;  3CC4 T;  3ZFJ A;  2DTO A;  4GLK A;  4KUD K;  4M77 B;  1VQ9 T;  1VQ7 T;  1X01 A;  4NS5 A;  4DOV A;  3VUB A;  2YHT A;  5GAM e;  2CZ1 B;  5GAM h;  4MZT A;  4EMK B;  3GNG A;  4C92 G;  4JLG A;  4YTL A;  4BDZ A;  3JCM e;  3TU4 K;  3GOX A;  1H3Z A;  3MEA A;  4KUI A;  3ZBD A;  5D6W A;  5AYF A;  4M7D B;  4RG8 A;  1NPP A;  5CQY A;  1I4K 1;  1NZ9 A;  3FIF A;  2LC4 A;  4NOY A;  2K4Y A;  4OGE A;  4C92 E;  5GAN 6;  3OY9 A;  3UDC A;  2X4Y A;  3OSV A;  4C0F A;  1M1F A;  3C4S A;  1WQ7 A;  3HFN A;  3OQ5 A;  1K9M C;  5GAN 7;  3CCL A;  3PGG A;  3V8K A;  4E7J A;  3KUF A;  5DLQ E;  3HL8 A;  3QPH A;  2DTH A;  2JUF A;  3VYH B;  4C0D C;  3CC2 A;  2PVD B;  2MWP A;  3FRN A;  2VUB A;  3G71 T;  3L2R A;  4DA4 A;  2VXF A;  5A0L A;  2O4X A;  5HK0 A;  1U8R A;  3CCM T;  4A4H A;  4JRQ A;  4JRI A;  4V2S A;  4JS5 A;  1XNI A;  4F7U A;  3CCS T;  4EMK C;  3OYJ A;  4PJO B;  4RCB A;  3SFM A;  2LX9 A;  1NE8 A;  3QJ6 A;  1WGS A;  2V8I A;  5A0D A;  3CCJ A;  1UB4 A;  4PL6 A;  3QJY A;  1P92 A;  1QP2 A;  2RK1 A;  2A7Y A;  3A8H B;  3JCM V;  2DJZ A;  2XG8 D;  1Q81 U;  1UEB A;  3CCQ T;  2PVG B;  5GAO n;  3M5A A;  2HQX A;  5GAN d;  5IAY A;  2VXE A;  4C8Q G;  1VIE A;  3JSC A;  1B34 A;  5GAN 8;  5J26 A;  2DTI A;  1ZBX A;  2R5M A;  1VQO T;  1KQS S;  2K5L A;  4N0A C;  3JB9 F;  4MMK A;  4C8Q E;  1UGP B;  4MML A;  3CCE A;  2R58 A;  2QI2 A;  3HFO A;  4M75 B;  2MF2 A;  3GNF B;  1VQK A;  4CRI A;  3JCM P;  4M77 A;  3JB9 D;  2KMT A;  4ZTF A;  1VUB A;  1V29 B;  3MEW A;  3MO8 A;  2HBP A;  3QO3 A;  2JTM A;  3L2V A;  3G6E A;  4IUV A;  1G3T A;  4M7A B;  5KE2 A;  3GLX A;  4M7D A;  4ME7 A;  1YI2 A;  2EKO A;  2RI5 A;  5HK3 A;  4B9W A;  4A4K A;  3OA6 A;  3X28 B;  5LJ3 e;  2MAM A;  4J5Y A;  2KK4 A;  2VGM A;  2LCC A;  1JB0 E;  3DB4 A;  4MZM A;  5GAN h;  1Q7Y U;  2M1H A;  3C94 A;  3OYH A;  1VQ5 A;  2LVM A;  5LJ5 h;  3PIP A;  2K5I A;  3OYK A;  2ZPF B;  3M53 A;  4IUT A;  3M55 A;  4M75 C;  2X4X A;  3L42 A;  5DM7 R;  2L5Q A;  4F7U G;  4VUB A;  1KQ1 A;  2DXU A;  4RG2 A;  4EPC A;  1SSF A;  2KY9 A;  4BUG A;  1UGQ B;  2OTL A;  2LTO A;  3E9F A;  3E9G A;  4IUP A;  4PJO A;  2RJF A;  3OYF A;  2XDP A;  4PNO A;  4F7U E;  5GAO l;  3OYL A;  3BDL A;  4M7A C;  4MDW A;  2M9U A;  2LT4 A;  3INZ A;  3TEE A;  2D6F A;  5GAN j;  5GAO p;  1I8F A;  3M56 A;  1Q82 U;  2LQ8 A;  3F70 A;  4M77 F;  3SDZ A;  5LJ5 j;  5D6X A;  1YJN A;  3SWN B;  3CD6 T;  2GFA A;  3DB3 A;  2RJE A;  2XI9 A;  4FL6 A;  3OYY A;  5CKF A;  4KT0 E;  4Z02 A;  3ER0 A;  1OZ3 A;  2CGH A;  4M7D F;  3G4S T;  2P0K A;  4PLL A;  4OP0 A;  2E6Z A;  3H8Z A;  3OYA A;  3CMA T;  4M77 G;  4MDX A;  2GFU A;  2RI2 A;  2YLC A;  3E1S A;  4BE0 A;  3EAE A;  4HCB A;  3QSU A;  5EG2 A;  1N27 A;  5GAM d;  3R6O A;  2RHZ A;  4M77 E;  4A53 A;  4LDW A;  2EWN A;  2V8K A;  3CPF A;  1N8R U;  3HSB A;  5J3B A;  2L89 A;  1G3W A;  1NJI U;  4M7D G;  2EJF A;  5GMK l;  3OYD A;  3CME A;  4ATO A;  3LYI A;  4QVD A;  2ZPB B;  2PQW A;  4FT4 A;  3V7C A;  4M7D E;  5CK9 A;  3CXC A;  4E7K A;  3JCM W;  2QQR A;  2PUO B;  2A3L A;  4DQ2 A;  4JJN K;  2RD1 A;  4IUR A;  4IUU A;  3CCL T;  3OSS C;  4C0D B;  5FU7 B;  3CC2 T;  3L2Q A;  5I2S A;  1G3S A;  5GAN f;  4R55 A;  3QII A;  1OZ2 A;  5LJ5 f;  4Y28 E;  3RUX A;  2KSS A;  2AHJ B;  2CZ7 B;  3E19 A;  3OYN A;  1K9M U;  2EJ9 A;  3A8M B;  1MHN A;  3JCM b;  3DKM A;  4OB1 B;  4PJO G;  3WVE B;  1O75 A;  4OB2 B;  2P0P A;  3JCM h;  4M75 F;  3URG A;  4PJO E;  5CCA A;  4JRK A;  4C5G A;  3CCJ T;  2ZPG B;  2I2L A;  3MHX A;  3JCM c;  2XID A;  3L2U A;  2VC8 A;  4LDY A;  3MEV A;  5CIU A;  3SWN A;  1YIT A;  4C5H A;  1VQM A;  1WJS A;  4M75 D;  2HQE A;  1LNX A;  1XTD A;  2F5K A;  1WJQ A;  4E47 A;  2Y90 A;  4M7A F;  3CPW A;  4XTV A;  3JCM J;  2NLU A;  5FU7 C;  3P8D A;  3OS2 A;  4L5G A;  2E12 A;  4M7A D;  3DLM A;  5GAM j;  4N4H A;  1YHQ A;  2ZPE B;  3M57 A;  5KCO A;  5HKC A;  3EFS A;  4QW2 A;  2WAC A;  4OGC A;  5CKD A;  1Y96 A;  5J39 A;  4XU3 A;  3CCE T;  5D6Y A;  4HT9 A;  2E65 A;  2E5Q A;  3OS1 A;  1VQK T;  1BKB A;  2CS7 A;  3J81 E;  1WPY A;  3EFR A;  3GF5 A;  5FRO A;  1VQN A;  4J8O A;  3M59 A;  3G6E T;  1YCY A;  3SD4 A;  3NTI A;  1VQ8 A;  2D9T A;  2LQK A;  1QVG S;  3QXE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...