2RK1A

Dhfr r67 complexed with nadp and dihydrofolate
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a type II dihydrofolate reductase catalytic ternary complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase type 2
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rk1A00
2RH2A 2RK1A 3UDCA 1VIFA 3T9NA 2GQVA 3SFMA 2RK2A 1VIEA 2VV5A 2OAUA 2P4TA
chains in the Genus database with same CATH superfamily
3A8MB 3UWNA 5GAOm 1UHFA 4C5GA 4Y91A 2RJFA 3CCSA 2BUDA 4MMLA 4AG1C 1RI9A 4RTTA 1PM3A 3CC7Q 4F7UE 1Y0MA 2J7IA 2B86A 5FLXE 3OYFA 2GNCA 5FU6C 1FX7A 2KR3A 4UC4A 2DXUA 3QG1A 2RQRA 2XU8A 1UJ0A 3KFVA 2NUTA 1H3ZA 3I55T 4JDSA 4Z89A 4OMNA 3T9NA 1ZBXA 3A5ZB 4MZMA 3EG3A 1LCKA 3KXTA 5GAN8 2KY9A 4JJBA 1MMNA 1UE9A 1NPRA 2E5QA 5IHNA 3ZFJA 2R57A 4B9WA 2LMJA 2EJGA 3MP1A 4M78E 3RNJA 4A4HA 1NE8A 3CCQT 3QWYA 5D6WA 3OYHA 2WSFE 1JJ2A 3OB9A 3SHWA 2B8AA 2EKHA 4J9FA 3OYAA 1K9MC 1D1AA 2DMOA 1GRIA 1D1CA 4JJDA 5KYNA 2ZGWA 4N4GA 1AWWA 5KCOA 3CEYA 2GTJA 2GF7A 5L8RE 4Y28E 2MMPA 2QA4Q 3EAEA 2CZ6B 4J5YA 2AHJB 4M78A 1IHWA 1Q7YU 1SG5A 2LTOA 2HCKA 1WYXA 2OTLQ 3PIPA 3H0FA 1XOVA 2K9GA 2KRNA 2OAWA 2MPXC 2DRKA 5HK0A 2FHDA 3JB9D 1MMAA 4M77C 2RPNA 2JTMA 3EG0A 4LDWA 1VQKT 3VS6A 1U06A 2DIQA 1M30A 3LH0A 5KYUB 2VB6A 3S6WA 1UEBA 1Q82R 2VGNA 2EYQA 4ZN3A 4IUQA 3L2WA 2F5KA 2G6FX 2CZ1B 1TSFA 4RTVA 3E9GA 5KE2A 2AKKA 2YWWA 4N4HA 2DTIA 2LNHB 3P8BB 2DL3A 2QQBA 2JXBA 2LX9A 4A63B 1VA7A 4AFUC 2RH2A 5GAOn 2HD0A 2FRYA 3M4GA 2KSSA 2IVWA 3MO8A 3OSSC 1E6HA 2ZPHB 1KC8U 4BDYA 4C92B 5GJWB 2DZ9A 2OX7A 2V8IA 1HJDA 3G6EQ 3H0IA 4X9CA 2LCLA 2QDYB 4FYVB 2QEXQ 4C92E 3GPLA 2DYBA 2HL5C 1G3SA 5FRMA 4E7IA 1VOMA 1RACB 3GOXA 2DL7A 3BDLA 2P84A 1C6VX 2A08A 1WXBA 3CCUQ 2VC8A 4M75A 4XU1A 1PD1A 4C0DB 4ZTJA 1BBZA 3OS1A 3DB3A 3WVDB 3MP8A 1BI0A 2V1RA 1IB8A 2QGFB 1I5LA 3JB9H 1XJWB 2QYZA 2VVKA 1VQNQ 4BE1A 2GFUA 4PKCC 1VQ8T 3ASKA 1T0JA 5GAN2 2VXFA 1IGQA 5GAOl 4OF1A 5CAIA 4BE0A 4OMOA 2D1XA 3JV3A 1CSKA 1ZA2B 2GFAA 2RI3A 4HA8A 4M77E 2M51A 2CSQA 2W10A 1QVPA 3CD6T 4LD9K 1W4SA 2X9HA 1M2VA 1BYMA 1NYGA 3OSVA 2LZ6B 4YTLA 3X28B 2EWNA 1X6BA 2XMFA 3DLLA 1MV0B 1JU5C 3HL8A 3KBGA 1MGQA 5J39A 1ZSZB 5LJ5d 4KH0B 1VYVA 2K2VA 2A0FB 2C0IA 1HK9A 4DQ2A 3NTHA 3GNGA 4M7DF 1QVFA 5GJVB 2LDMA 4JRQA 1FMWA 1KG1A 5DLOA 1IO6A 1QVFS 1M3AA 1WJRA 4PNOA 4XU3A 3OYYA 2LJ1A 1BCOA 1K9AA 3C0CA 1VQPQ 1U1TA 4ATOA 4MDXA 2X4WA 2EKOA 2GQIA 3L1AA 4XTXA 3CXCS 1IHVA 1K1ZA 3FLGA 4OMQA 4BI8B 5CIUA 1RABB 1KC8C 4IUPA 1KIKA 1YITQ 5IHKA 3JCMP 4OB1B 4L59A 2GTOA 1YJNA 2EJ9A 4EPCA 3PVLA 2FZCB 5IT9E 2DBKA 3M0UA 3HHTB 4XTVA 1TUCA 1YJWA 1GFDA 1NLPC 1U5SA 3NMZC 3FIFA 3J80E 5CKFA 4Q5WA 4JLGA 2J6KA 2PUOB 4JZ3A 2QK0A 1VQPA 2LQKA 2HQEA 5LJ3f 2XG8D 4QVDA 2CP2A 1NJIC 2L3RA 2BE9B 2LT1A 4L6V5 4E7KA 3M0TA 2L89A 1IXDA 4JRKA 2EVRA 2E1HA 4EDUA 1KQSP 3CD6Q 1QMCA 3I56A 1VIEA 4OB2B 3GF5A 5FU7B 3OYMA 1S72A 2DM1A 3M4YA 5LJ3h 4E7JA 3CPWP 3QHSA 2CH4A 1N9SA 3FJ5A 3C95A 1J3TA 2ZPEB 2A28A 1AHJB 1IZ6A 2X4YA 3EG9A 1OEBA 1Q81R 1VIFA 2YHTA 4RTZA 5IN1A 3R6OA 4PJLA 4V2SA 3VS3A 2QQRA 2KRMA 1GCPA 2EGCA 2QGGA 4J9BA 2XHCA 1SKUB 4FW2A 1QVFP 2PU9B 5GAN7 3CBOA 4QQ6A 1KQ1A 1TUDA 2P4TA 1WXTA 5KCHA 3JAME 3QJ6A 1JJ2S 2YUNA 2RNAA 1VQ7A 4J9GA 2HBWA 4A4FA 2VV5A 2YRCA 1YBYA 1UB4A 1Q82U 3DB4A 1VQNA 1UHCA 2K79A 3OS2A 1FMKA 4M75C 1PKTA 3L2ZA 4BB7A 1KD1U 3MP6A 1UDLA 3SWNA 5FW9A 4HKEA 4TVRA 2L8DA 2K6DA 2XI9A 3A1PA 2GCXA 2HNIA 2JM8A 1Q86U 3AT1B 1T0HA 4FIBA 2VUBA 2CH4W 2D8JA 3WVEB 1UECA 1UJYA 3IQLA 1M1KU 1AWJA 5GMKh 1NJIR 2A3LA 4RMOA 1GCQA 2KT8A 1TG0A 1X75C 1D0XA 2COYA 1R0BG 1OX9A 2EPDA 3OYEA 3H0HA 2DXCA 4WF2A 1WLPB 3VS2A 5HKCA 4JZ4A 2RB6A 2BKDN 5GMKi 2NLUA 1K73R 4PFPA 1TXQA 4LDYA 4ZGJB 4PJOB 2LX7A 2DX1A 2EQJA 1GL5A 2DTHA 1WI7A 2P0QA 4IUVA 2Y4YA 2J06A 2NUPB 5C0MA 3G6ET 1B34B 2FO0A 3X24B 4DBFA 5GMKl 1BIAA 3CC4Q 3NPFA 3QDRB 1RAHB 2L3QA 4DBRA 3CCQA 3QSUA 1UTIA 4GY5A 4J9HA 2E6NA 4C5IA 2KK4A 1SPKA 1K0XA 1IRXA 1RAAB 3HP9A 2YRVA 2W0ZA 2LC4A 7AT1B 2HAXA 1SEMA 1X2QA 2J6OA 1VQOA 2EQIA 3H9NA 2F2WA 2JM9A 4OGEA 1FMVA 2H3EB 1B34A 1W2BS 1I07A 2L2PA 1YP5A 3MEAA 4OB3B 2K3BA 3G71T 2O31A 2MI6A 2EAYA 5FWBA 4RTXA 1G3TA 1LJOA 2EYYA 2EGAA 4B6MA 1KSWA 1TU0B 3QDFA 4BY6C 5LL6S 2YT6A 2RQUA 4DOVA 3CCEA 3QYGB 3NGPA 3QIIA 3OYDA 1H641 1X69A 3OYGA 4C92F 1S72T 3OS5A 2BTTA 5IXFA 5GAMd 2X4JA 1DJ7B 3L2UA 4FU6A 3PMIA 3X26B 2XIDA 1NG2A 4J9CA 4QVCA 4BY6B 4C5HA 5A2QE 2QDLA 2HSEB 4RCCA 1NZ9A 1AOJA 4J6WA 4QW2A 3SWNB 1UGQB 2CP0A 1EFNA 5GAMf 2MWOA 3A8OB 1QVGS 4C0DC 3MKDA 1LVKA 1OI1A 2Y4XA 4AFZC 2PNIA 2RHYA 2JMAA 3LWHA 2CGHA 1JB0E 1UG1A 1Q82C 1NM7A 1R77A 4AT1B 3NFCA 3J7AF 2PUKB 4JLIA 3QPHA 2COWA 2E5KA 2XDDA 3CC7A 5CO7A 3JCMb 2F1LA 1Y96A 3EH2A 1VUBA 3FDRA 3OMCA 3OMGA 4E7SA 2ZPGB 4LDXA 4LN2A 1RAGB 1MNEA 1OV3A 2QEXT 3MEVA 4C8QF 3EFOA 4A53A 1D0YA 4A4KA 1PRMC 4C8QC 1M8VA 2KDSA 3EG9B 3EGXB 3HFNA 2BE7D 1KK7A 4M7DE 4PFZA 1OYXA 1KHIA 1OU9A 3CCLA 2Y90A 4HVVA 3EFRA 2KROA 5CR2A 2HQXA 3M9QA 2M16A 4X1VA 3RBBB 3CQTA 1B07A 5AT1B 3G4ST 2DEUA 1V29B 5I22A 1NEGA 1GCQC 1K76A 2EYXA 4F04B 3JCMg 1W2BP 3EHQA 1TOVA 1TWBA 2DJQA 4PJNA 2HDAA 4R56A 8AT1B 4J6YA 4MZPA 3OYKA 5J26A 4OMPA 2DPPB 4KH1B 1ZX6A 2BZYA 1WZOA 1VQ5T 5CKEA 3LLRA 2ZCFB 2C06A 3PE0A 2MCNA 2DE0X 1X6OA 1QLYA 3VS0A 1Q7YC 3BE3A 1VQLQ 2ROTA 2QXFA 2MAMA 1YIJA 2KXCA 2XDBA 3CCLT 3SB2A 1BKBA 1M3BA 1JRIA 2SRCA 2ABLA 2DIGA 2CREA 3M0SA 1MUZA 1KJWA 2F2XA 4NS5A 3V8KA 3EGXA 4D6WA 1GBRA 2JZ2A 2WSCE 1GBQA 2KYBA 1UFFA 1YI2Q 1WHHA 3EFOB 2AK5A 2KMTA 2DEQA 1XTDA 2YSQA 2QI2A 3CD6A 2EIFA 1BI2A 2RF0A 3M55A 4VUBA 4OVAA 2D8HA 2E6ZA 1Y96B 3SDZA 1WIEA 2RJCA 2YUPA 4GLKA 1ACMB 1MV3A 2WACA 3VYGA 1WQWA 4J7IA 2DYIA 2BIVA 3CMAT 4IKFA 1M90U 1WX6A 1M3CA 4BUGA 3OYBA 4DA4A 3CC2A 2DNUA 4PJOF 1N5ZA 1PRLC 3OYLA 3NTIA 3VYHB 1GXIE 1YJNQ 2CKKA 3BFMA 2EGEA 1I5OB 2KAFA 4FYYB 2R5MA 1H3HA 2CZ7B 2L0AA 4FM4B 2JW4A 2K5FA 2DVEA 2RHIA 1U1SA 1M2VB 1VQOQ 2JN0A 1B7TA 1LPLA 1AWXA 4CC4B 1BU1A 1M2OA 2FRWA 2DL4A 2C0OA 2BZXA 2V26A 2F69A 3JB9G 3E19A 1JXOA 3HSBA 2VYTA 4M4ZA 4XTWA 4KGXB 3TSZA 3VUZA 1YIJT 4LUEA 1I8FA 2K3YA 4J9DA 3A98A 1VQ6T 2E10A 2CDTA 3M53A 2A37A 3TCJA 3MEUA 1Z9QA 3E9FA 5D6XA 5I2SA 1WA7A 2DVJA 3EG1A 3VKIA 1VQ4Q 1QP2A 2DZCA 3H8ZA 4P5NA 2M02A 1YI2T 2PVGB 4EMKC 4K11A 2E3IA 3ZBDA 2EJFA 4J83A 4PLIA 4OP0A 3CCVA 2A7YA 5GANd 3CPWS 6AT1B 3CMAA 2DAQA 3M59A 3QBYA 2JJ9A 1JO8A 1IGUA 2K3XA 2ATCB 4M77G 2KXDA 1CKBA 4IURA 2X3WD 1T3SA 2QG9B 4PL6A 4AFSC 4IUTA 5LJ5j 4N0AC 2L3SA 1Q81U 4IIMA 4XU2A 1OZ2A 4NL2A 2NUPA 3RESA 1OULA 1EIFA 2DK3A 3M56A 4PJOA 1YJ9T 1WXUA 1ZSZC 1NEBA 3S3MA 1U8RA 2FYKA 5DM7R 1BB9A 1HXDA 2V8KA 1AT1B 5CKBA 4J9EA 2OTJT 4KGZB 2QTXA 1N8RU 5KYUA 4LDVA 4E6RA 1SSFA 3CCJA 1NLOC 2GGRA 5HK3A 2V1QA 3UF4A 5GANh 1K8AC 1X01A 2DBMA 3GIBA 4MZTA 1MNDA 3CMAQ 4FCYA 5GAOr 1PD0A 2LCSA 2O9SA 4C92D 2DXTA 1WPYA 5GANg 3RDVA 2E41A 4ORZA 3V7RA 2K5IA 4WCIA 3RR6A 2DERA 1VQ4A 1UGVA 1VQPT 2YUOA 1OQKA 3C94A 3CCJT 1WJSA 3PIOA 1S72Q 2WSEE 2A36A 2MWPA 1Z9ZA 3JB9F 1WHMA 4D8KA 1G5VA 1D0ZA 1QKXA 2CZ0B 4CC2A 1KHCA 1P92A 3FB9A 2HL3A 3CPFA 1BCMA 1K9MU 2KE9A 3JCMW 5IAYA 2KGTA 3HRTA 4C92C 1BI3A 3J81E 2OTLA 1M27C 1YJWQ 3G4SA 1UGRB 1SF9A 2RO0A 4FSXA 2KI7A 1RUWA 4M7DG 3U23A 3OW2S 1ZHIA 4PK4A 5CKHA 3HFOA 4KRTA 4OMFB 1YHQQ 3SFMA 3VS5A 2DO3A 2OAUA 2RN8A 3RERA 3EG2A 4FT4A 4M7DC 2AT1B 1QWEA 3ME9A 3QJYA 3TQ7P 3RMQA 2NUTB 4M75D 2QA4A 1G8XA 2F2VA 2LNVA 2QTVA 3JRZA 1G3YA 3OA6A 1KQSS 2L3PA 1QKWA 2FEIA 2GBQA 3BW1A 3KUFA 1UGPB 1MHNA 1RAEB 4E7HA 1K9MR 3EHRA 5GAMe 1NYFA 4R55A 2RM4A 3UPUA 3QKJA 2GQVA 1M1KR 4XTUA 3EGDB 1RAIB 1N8RR 2DTOA 4M75E 1F1BB 3CBPA 1AZGB 5LJ3e 1YI2A 5CQXA 4RG8A 4EMKA 2LQNA 2D9TA 3GBQA 3H6ZA 5FROA 2LJ3A 4C5EA 3JCMV 2YLBA 3EFSA 5GMKe 5GANj 2CT3A 2RHXA 2HQHA 1TUGB 1JJ2P 3CMEA 2HEQA 1VQLA 4JPBW 2FPEA 2YLCA 2E3HA 2KYMA 2RK2A 4BACA 3JCMJ 1Q95G 1AVZC 1PWTA 5CKDA 2QQSA 2RJEA 3CXCP 4C0ZA 1I81A 4LE9A 3GNFB 5KYWA 2HKQB 3DLMA 1M4ZA 3MHXA 2DLPA 5LJ5f 4PJJA 1EX4A 2RHUA 1JXMA 4C0GA 3FJPA 1YJWT 5HCKA 8ATCB 3OYCA 1ZSZA 2KT1A 4QT7A 4ELYC 2CT4A 3RMSA 3C4SA 3M54A 2PQWA 2LT4A 5HY6A 2FPDA 1N8RC 5CQYA 1OU8A 1QVGP 2HSPA 2COZA 3LH5A 4C92G 1HYOA 2VWFA 4M78D 5LJ5g 4KT0E 2BZ8A 2QEXA 4M77B 4QVZA 2KBTA 3M58A 3G6EA 3RUXA 5GAOp 3ZL7C 3FRNA 3LGFA 2K2MA 1VQ9A 3A8GB 5IXBA 1VQKA 2NWMA 2CP7A 2CP3A 4C0FA 2OJ2A 2MYSA 1PSFA 1BK2A 3O8VA 3TREA 3G71A 3QUIA 4N4IA 1PC0A 3TVTA 2H8HA 4M7AG 5J3BA 4DEXA 2G3RA 1VQLT 1ZSGA 1X27A 2LQWA 1E7OA 1HD3A 2FVUA 5GMKj 3CCVT 2JT4A 2RJDA 4C8QE 4ANJA 3I5RA 1M90R 4BE2A 3G7ZA 4II1A 9ATCB 4M75B 2FZKB 3CCET 2LJ0A 3HPWA 2RHZA 4MDWA 1Q86C 1VQMQ 4LDUA 4JJNK 3UA6A 1KD1R 3HRUA 1JBMA 1H8KA 2JTEA 4JRPA 2RMOA 3C12A 3HTRA 4HCKA 3INZA 3I35A 1JQQA 3OW2P 1BI1A 3QO3A 2DJZA 4PLLA 4C8QD 4E2FB 2XK0A 4JS5A 1UGSB 2YDLA 4C92A 5A0DA 2PVOB 1AZEA 3CCEQ 1VQ5Q 3EGUA 5GAN4 1AD5A 3SWNC 1PSEA 2CUBA 1X2KA 2E4HA 2V8JA 4M7AA 3JSCA 1M8MA 4QQDA 3OQ5A 2JNGA 2MF2A 3TU4K 1ZUKA 4FYXB 2DF6A 3V8JA 3V7CA 2EQMA 1PCXA 3SEMA 4M7DA 2E64A 4IUUA 2ENMA 1FYNA 1VQ9T 3I9QA 4PFOA 4OB0B 5KYXB 5FU6B 2J05A 3I55A 3FEOA 1C1AA 1SHGA 4F16A 1QCFA 1WQ7A 3UATA 1HSQA 4KGVB 1RLQC 4ZGDB 2XD0A 5DY9A 2DL5A 2NUZA 4M78F 3TSWA 4OMMA 3PMTA 3OS0A 1XNIA 3PNWC 1GFCA 3SD4A 3HKSA 4M78G 4CC7A 3CCQQ 3E1SA 4LD6A 3CC4A 2P0KA 2JMCA 3EH1A 3CCRT 1OOTA 2M1HA 1VQMA 5I2MA 3CPWA 5CVIA 4M78B 5LJ3j 2HZYA 2H3JA 2ESWA 3CC7T 3L2QA 3JB9I 1ABOA 2P4RA 1OX8A 1ZUUA 3WXMB 5KYYB 1ZUYA 4BI4A 2FL7A 4FYWB 1VQOT 5GAN5 3PTAA 1VQ6A 2VGMA 1CKAA 4JS4A 1AWOA 1QW1A 2AKLA 3R6NA 2I2LA 2K4YA 1D3BA 2DD4A 4M77D 2AZSA 3CCSQ 4F7UB 4FSSA 4X34A 2O2OA 4B9XA 3VV0A 2IG0A 1T3LA 2O9VA 2ZPIB 3PT9A 1Q7YR 3I5SA 2YUQA 3CCMA 1FXXA 3ULRB 1KFZA 4Y92A 3ER0A 4HVUA 4O6JA 5GAMg 3LW5E 2MK5A 5KE3A 5FRNA 1W6XA 2Z0WA 4KUIA 3CCRA 2EQKA 1VQMT 2M9UA 1W70A 4J8OA 4KBMB 2CP6A 3D7SB 3OY9A 1PHTA 4ZNXA 5EC7A 2C0TA 1M1FA 2J6FA 3M5AA 4E47A 5I11A 3PFSA 3FC3A 1TTHB 1VQ7Q 2RA2A 3LWIA 4FL6A 1V1CA 3A8HB 2XKOC 1O75A 4AG2C 1VYUA 2CSIA 1KQSA 3RKWA 1OZ3A 2HKNA 4A54A 3CMEQ 4ELZC 1MMGA 2X35A 3OW2A 4RTWA 3L42A 4E7ZA 4RCBA 3CC2T 3OYIA 3QWXX 4A4GA 3BDUA 1NJIU 1PNJA 2O4XA 4BD3A 1X43A 3P8DA 4OGCA 4HCZA 4ZTFA 4BDZA 3LYIA 4M7DD 4DEYA 3M0QA 4E7LA 3REBB 3UT1A 5D7UA 4M77F 3CCMT 2EQUA 3MPUB 2OTJQ 3OBYA 4LNPA 3I56Q 3JB9J 2EFIA 2ZZDA 2O88A 3NHNA 1OPLA 3QZ9B 3JCMc 3A8LB 2PTKA 1Q81C 1ARKA 3H41A 3THKA 1NPPA 2P0PA 4C8QB 3M0RA 4M7AC 4C8QA 1I0CA 4J9IA 2JTFA 2ZAEA 2X51A 2EYZA 4DBQA 1U3OA 4CC3A 2E65A 4BI3A 4HXJA 4QKUA 2RQWA 3N5BB 4D8DA 4XTZA 3JCMX 1YHQA 1ZBJA 2ED0A 4HCCA 4NOYA 2X3XD 3MEWA 1YITA 2HMAA 5IHIA 5IH2A 2OTLT 4RUGA 4HCBA 3G4SQ 1A0NB 1Y7XA 4PJOG 2F5TX 3RIRA 3JCMf 2ZPFB 3REAB 2KEAA 4HVWA 1K4US 1QWFA 4ESRA 3JCMQ 3PGGA 2QASA 4XQ3A 2LQ8A 4F14A 1KC8R 3M0PA 5A0GA 5M9OA 3QZ5B 2OTJA 1I1JA 1M9SA 2AZVA 2FZGB 2VXEA 1KD1C 1SHFA 2FPFA 1WNLA 2KRSA 2XICA 3UA7A 3ZEHA 1WHGA 5LJ3d 3E2UA 4GBQA 4FW1A 3OYJA 3DKMA 2IIMA 1B3QA 4R0KA 4AFQC 1YJ9A 1QP3A 4XK8E 2EYWA 2FB7A 2IPOB 2AIRB 1MMDA 5GAN6 3GLXA 3VJPA 2L5QA 1PKSA 4EMGA 4A4EA 1S1NA 1G3WA 4M75G 3AHUA 1RAFB 1YCYA 1YHQT 5GAOq 3L2RA 4F7UA 2O01E 1WHJA 2R58A 1YFNA 1D09B 1RI0A 1D3BB 4M75F 3X20B 3M57A 5CCAA 2VASA 1K8AR 3VS1A 3CCJQ 5GAN3 1AEYA 2RI2A 4Z88A 5FWCA 3CMET 1WDXA 1TS9A 5KYYA 1QCNA 2YRDA 4EIKA 2RQVA 1VQ8A 1KQ2A 3HRSA 4CRIA 1ABQA 3NTKA 1M5Q1 3LX7A 2LCCA 4RG2A 1VQ4T 4XU0A 3CCUA 1ZQ1A 2CP5A 3CCST 2JVVA 2DRMA 2CUDA 1VQ8Q 1M90C 3CC4T 4RKUE 5DLQE 2X4XA 2M0YA 1SRLA 1XQHA 2HBPA 1Q86R 4XAXB 5CK9A 1WHLA 3X25B 3S3OA 2YXYA 4KUDK 1ZA1B 5C6SA 5I21A 1JEGA 4NL3A 3V8LA 1EZZB 1N27A 1E6GA 2JOYA 5LJ5h 4AMCA 1M1KC 2KVQG 1VQ6Q 3L2VA 3CCVQ 1Y71A 3VRZA 2DKGA 2LVMA 3JCMh 5KYXA 1WJQA 1YWPA 2QQ9A 2D0QB 1RL2A 1G83A 2E12A 2RK1A 2KQWA 1YJ9Q 3JCMd 2DFUA 1TH7A 4PJOD 4M7DB 2ED1A 4LUDA 4ME7A 2PZ1A 4L5GA 2PVDB 4FT2A 2LRQA 1VQNT 2QA4T 1RADB 4M7AB 4IIOA 2ROLA 4F7UG 2K7AA 2QQAA 3CCUT 1YJNT 2RI5A 1C0MA 4N0AA 1I4K1 4RTUA 5ECAA 5GMKm 1ZLMA 3OBWA 2NYSA 3RKXA 1W1FA 4PJOE 2R5AA 4PJOC 4EMHA 2K57A 2ECZA 1QVGA 1N9RA 1K73C 3Q1JA 1SSHA 3I55Q 2ZPBB 4X9DA 3TEEA 3QYHB 1YITT 5GANf 2RD1A 4DBHA 1YWOA 2MOXA 1H92A 4HT9A 4OMLA 4ZN1A 2LP5A 2RQTA 3BY7A 2EBPA 4M78C 1D1BA 2EW3A 2E70A 4M7AF 3CXCA 3VS4A 4KULA 4LXCA 1K8AU 3URGA 1V76A 1LOJA 1QQJA 1R8OB 4O5VA 4RTYA 1WFWA 3CC2Q 2I0NA 1WHKA 3OYNA 1VQ5A 1Y07A 2XDPA 5LJ3g 1YCSB 5GAMj 4Z02A 3MJXA 3QXEB 4GLMA 4Z8AA 3CBMA 4M77A 2CYZB 2JS2A 3I56T 5KH6A 4PJMA 2KNBB 2M0OA 3JCMe 3VRYA 5L23A 3S3NA 1OPKA 2D0NA 1G2BA 1X6GA 1W2BA 1VQ7T 2OI3A 2DL8A 1Y57A 1IREB 2JUFA 4DOWA 1M1GA 2DD5A 2JS0A 1O9SA 1YIJQ 1K0SA 1YNZA 3F70A 5EG2A 1WGSA 2MIOA 3V7SA 4C8QG 1LNXA 2K5LA 4F17A 2D6FA 5KYWB 4J7FA 4JJCA 2DA9A 3G71Q 4MMKA 4M7AE 1YN8A 1SRMA 2CS7A 4JUVA 1PG5B 1RLPC 1VQKQ 5GAMh 3UDCA 4CI0C 1VQ9Q 3P8HA 2SEMA 1FWZA 2FG0A 3VU3C 3G1JA 4JRIA 4J6XA 2DILA 3MCAB 1QCOA 5FU7C 4QQGA 5D6YA 1UUEA 3CCLQ 3CCRQ 1R0CB 2DXBA 2DETA 4WTOB 3META 5GANe 3GP8A 3VUBA 4EMKB 4ZGEB 3LGLA 2O4XB 4M7AD 1K73U 4HT8A 3PVQA 5AYFA 1VYTA 1BIBA 2QAZA 4F7UF 5LJ5e 3CCMQ 3O5ZA 1N6AA 4XTYA 5A0LA 3EGDA 3VS7A 3RKYA 2VKNA 1NBEB
chains in the Genus database with same CATH topology
1M1FA 1SSFA 3A8MB 3UWNA 5GAOm 3M5AA 4E47A 3CCJA 4C5GA 5HK3A 3PFSA 5GMKh 3FC3A 4Y91A 2RJFA 3CCSA 2A3LA 2BUDA 4MMLA 2RA2A 5GANh 1K8AC 4RMOA 1X01A 3LWIA 4FL6A 4F7UE 3A8HB 2XKOC 1O75A 1X75C 3GIBA 4MZTA 5FLXE 3OYFA 5FU6C 5GAOr 1FX7A 1KQSA 3RKWA 4UC4A 1OZ3A 2DXUA 4C92D 2DXTA 3OYEA 4A54A 3QG1A 4ELZC 2XU8A 2DXCA 2X35A 3OW2A 4WF2A 5HKCA 1H3ZA 3I55T 1WPYA 3L42A 2RB6A 4JDSA 5GANg 2BKDN 2E41A 4RCBA 3CC2T 5GMKi 2NLUA 3T9NA 3V7RA 3OYIA 4A4GA 1ZBXA 3BDUA 3A5ZB 4MZMA 4LDYA 1NJIU 4BD3A 2O4XA 2K5IA 3P8DA 4ZGJB 4OGCA 4HCZA 3KXTA 1VQ4A 4ZTFA 5GAN8 4BDZA 4PJOB 3LYIA 2KY9A 1VQPT 4M7DD 2EQJA 1NPRA 2DTHA 2E5QA 2P0QA 4IUVA 2Y4YA 3ZFJA 3C94A 3CCJT 4E7LA 1WJSA 2R57A 5C0MA 4B9WA 3G6ET 1B34B 3UT1A 3X24B 3PIOA 2WSEE 5GMKl 2EJGA 3MP1A 2EQUA 4M78E 4M77F 3CCMT 2MWPA 1BIAA 4A4HA 3JB9F 3OBYA 1NE8A 3QDRB 3CCQT 3JB9J 2EFIA 3CCQA 5D6WA 3OYHA 3QSUA 2ZZDA 1G5VA 2CZ0B 2WSFE 3QZ9B 3OB9A 4GY5A 2E6NA 1JJ2A 3JCMc 4C5IA 2KK4A 2B8AA 3A8LB 1KHCA 1Q81C 1P92A 3FB9A 1NPPA 2P0PA 4C8QB 3CPFA 3OYAA 1K9MC 1YHQT 3HP9A 4M7AC 4C8QA 2YRVA 1K9MU 2JTFA 2ZGWA 4N4GA 3JCMW 5KCOA 2LC4A 3CEYA 5IAYA 2HAXA 3HRTA 4C92C 2GF7A 1VQOA 1BI3A 5L8RE 3J81E 2OTLA 4Y28E 2MMPA 4OGEA 3G4SA 1UGRB 2E65A 4BI3A 2RO0A 4FSXA 4M7DG 1B34A 1W2BS 3EAEA 3OW2S 1ZHIA 3N5BB 2CZ6B 3MEAA 4OB3B 4J5YA 5CKHA 3HFOA 4OMFB 4XTZA 2AHJB 3G71T 2MI6A 4M78A 3JCMX 3SFMA 2EAYA 2DO3A 2OAUA 1YHQA 1Q7YU 3RERA 1G3TA 4HCCA 4NOYA 1LJOA 3MEWA 4FT4A 4M7DC 1YITA 3ME9A 3QJYA 2LTOA 2OTLT 3RMQA 4M75D 4BY6C 2QA4A 4HCBA 1Y7XA 4PJOG 3PIPA 2LNVA 2F5TX 1XOVA 5LL6S 3RIRA 3JCMf 4DOVA 3CCEA 3JRZA 2ZPFB 5HK0A 3QYGB 2FHDA 3QIIA 3OYDA 3JB9D 1G3YA 3OA6A 1KQSS 1H641 4M77C 3BW1A 2JTMA 3KUFA 3OYGA 1UGPB 4C92F 3JCMQ 4LDWA 1MHNA 3PGGA 4E7HA 1S72T 1VQKT 3OS5A 2DIQA 5GAMe 4XQ3A 3LH0A 5GAMd 2RM4A 2X4JA 2LQ8A 4R55A 1DJ7B 3L2UA 5A0GA 4FU6A 5M9OA 3UPUA 3PMIA 3X26B 3QKJA 2GQVA 4XTUA 3S6WA 3QZ5B 1UEBA 3CC4T 2VGNA 2XIDA 2OTJA 2EYQA 1M9SA 4ZN3A 2DTOA 4M75E 2VXEA 1KD1C 3CBPA 1WNLA 4IUQA 2XICA 4QVCA 2F5KA 5LJ3d 3ZEHA 3L2WA 5LJ3e 3OYJA 1YI2A 4BY6B 4C5HA 5CQXA 5A2QE 3DKMA 4RG8A 4RCCA 2CZ1B 4EMKA 1NZ9A 2D9TA 4J6WA 4QW2A 3SWNB 1YJ9A 3H6ZA 1UGQB 3E9GA 1QP3A 4XK8E 5GAMf 5KE2A 2MWOA 2FB7A 3A8OB 5FROA 4N4HA 2DTIA 3P8BB 4C0DC 4C5EA 1QVGS 3JCMV 2YLBA 3J7AF 5GAN6 2QQBA 3EFSA 3GLXA 5GMKe 5GANj 3VJPA 1OI1A 2L5QA 2RHXA 2Y4XA 4EMGA 4A4EA 2LX9A 1G3WA 4M75G 3CMEA 1VQLA 3AHUA 2RHYA 3LWHA 2CGHA 2RH2A 5GAOn 1JB0E 1Q82C 2HD0A 2YLCA 1YCYA 3M4GA 2RK2A 2KSSA 2IVWA 4BACA 3MO8A 3OSSC 5GAOq 3L2RA 3NFCA 2O01E 2PUKB 4JLIA 3QPHA 4F7UA 3JCMJ 2R58A 2ZPHB 1KC8U 4BDYA 4C92B 1RI0A 2XDDA 3CC7A 1D3BB 2DZ9A 4M75F 5CO7A 3X20B 5CKDA 3JCMb 2QQSA 3M57A 2RJEA 5CCAA 4C0ZA 1I81A 1Y96A 1VUBA 3FDRA 3GNFB 2V8IA 3DLMA 3OMCA 5GAN3 3OMGA 1M4ZA 4X9CA 2LCLA 2QDYB 2RI2A 2ZPGB 3MHXA 5LJ5f 4C92E 3GPLA 3CMET 4LDXA 2RHUA 1G3SA 4C0GA 5FRMA 3FJPA 2QEXT 4E7IA 1VQ8A 1KQ2A 3HRSA 3MEVA 1YJWT 4C8QF 4CRIA 3OYCA 3GOXA 4A53A 4A4KA 4C8QC 3BDLA 3NTKA 1M8VA 1M5Q1 2KDSA 3LX7A 2LCCA 4ELYC 4RG2A 3RMSA 2VC8A 1VQ4T 3HFNA 4M75A 4XU0A 3C4SA 4XU1A 4C0DB 3M54A 3CCUA 4ZTJA 2PQWA 2LT4A 5HY6A 4M7DE 1ZQ1A 1OYXA 3CCST 1N8RC 1KHIA 5CQYA 2JVVA 3DB3A 3MP8A 1BI0A 3WVDB 3OS1A 3CCLA 1I5LA 2Y90A 4C92G 3EFRA 3RKYA 3JB9H 5CR2A 2HQXA 1M90C 4M78D 3M9QA 2GFUA 2M16A 4PKCC 4KT0E 4RKUE 5DLQE 5LJ5g 2QEXA 1VQ8T 2X4XA 4M77B 4QVZA 3G4ST 3ASKA 3M58A 3G6EA 1V29B 2VXFA 3RUXA 5GAN2 5GAOp 5GAOl 3FRNA 1XQHA 3LGFA 4OF1A 5CAIA 2HBPA 4BE0A 1VQ9A 3A8GB 3JCMg 1VQKA 4XAXB 5CK9A 2GFAA 3X25B 4R56A 3S3OA 2RI3A 4C0FA 4KUDK 4J6YA 4HA8A 4MZPA 4M77E 5C6SA 5I21A 1PSFA 5J26A 3OYKA 2DPPB 3O8VA 4NL3A 3TREA 3V8LA 3G71A 3QUIA 1VQ5T 4N4IA 5CKEA 1N27A 3LLRA 2ZCFB 4M7AG 5J3BA 2C06A 2JOYA 5LJ5h 1M1KC 1QVPA 1X6OA 2G3RA 2KVQG 1VQLT 3CD6T 3L2VA 4LD9K 1W4SA 1Q7YC 1Y71A 2FVUA 5GMKj 2DKGA 1BYMA 2LVMA 3CCVT 3JCMh 2QXFA 2MAMA 3OSVA 1WJQA 2QQ9A 1YIJA 2RJDA 4YTLA 2XDBA 2D0QB 3X28B 4C8QE 1RL2A 3CCLT 3SB2A 1BKBA 2EWNA 1JRIA 2E12A 4BE2A 2DIGA 3G7ZA 4II1A 2RK1A 3DLLA 2KQWA 4NS5A 3V8KA 3JCMd 4M75B 3HL8A 1TH7A 3CCET 4PJOD 3KBGA 4D6WA 3HPWA 2JZ2A 2WSCE 4M7DB 2RHZA 1MGQA 4MDWA 1Q86C 4LDUA 5J39A 5LJ5d 4ME7A 4JJNK 4L5GA 2KMTA 2PVDB 2DEQA 1XTDA 2K2VA 3HRUA 2LRQA 1JBMA 1HK9A 4FT2A 3NTHA 4DQ2A 3GNGA 1VQNT 2QA4T 1QVFA 4M7DF 2QI2A 3CD6A 2EIFA 2LDMA 4JRPA 4JRQA 1BI2A 3C12A 3M55A 4VUBA 4M7AB 3INZA 4OVAA 1KG1A 5DLOA 4F7UG 2E6ZA 2QQAA 3CCUT 1QVFS 1BI1A 1Y96B 3QO3A 2DJZA 1YJNT 2RI5A 4PLLA 4C8QD 4N0AA 3SDZA 1WJRA 1I4K1 2RJCA 4PNOA 2XK0A 4GLKA 4XU3A 2WACA 3OYYA 1UGSB 5GMKm 3OBWA 3VYGA 1WQWA 4JS5A 5A0DA 4J7IA 4C92A 3RKXA 2PVOB 1U1TA 2BIVA 4ATOA 3CMAT 4IKFA 4MDXA 4PJOE 2R5AA 2X4WA 5GAN4 1M90U 2EKOA 3L1AA 1PSEA 3SWNC 4BUGA 4XTXA 4PJOC 3CXCS 4EMHA 3OYBA 4DA4A 2K57A 2V8JA 3CC2A 3JSCA 4M7AA 4PJOF 1QVGA 3FLGA 4QQDA 3OQ5A 1N9RA 1K73C 3Q1JA 2JNGA 4BI8B 5CIUA 2MF2A 3OYLA 3TU4K 1KC8C 2ZPBB 4X9DA 4IUPA 3V8JA 3NTIA 3VYHB 3TEEA 3QYHB 3V7CA 2EQMA 1YITT 5GANf 1GXIE 2RD1A 4M7DA 2E64A 4IUUA 4OB1B 4L59A 3JCMP 2CKKA 1YJNA 3BFMA 2EJ9A 2KAFA 4EPCA 2R5MA 4HT9A 4ZN1A 2CZ7B 3BY7A 5IT9E 4FM4B 4M78C 1VQ9T 2K5FA 2DVEA 2E70A 3HHTB 4OB0B 2RHIA 4XTVA 3I55A 5FU6B 4M7AF 1U1SA 3FEOA 1YJWA 3CXCA 4KULA 2JN0A 1K8AU 3URGA 1R8OB 1LOJA 3FIFA 4O5VA 3J80E 5CKFA 1WQ7A 4JLGA 4Q5WA 3OYNA 1VQ5A 2PUOB 2F69A 4ZGDB 1Y07A 2XDPA 3JB9G 5DY9A 1VQPA 3E19A 2LQKA 2XD0A 2HQEA 5LJ3f 4M78F 2XG8D 5LJ3g 5GAMj 3PMTA 4Z02A 4QVDA 3OS0A 1XNIA 1NJIC 3HSBA 3PNWC 2L3RA 2VYTA 4XTWA 2LT1A 3QXEB 4L6V5 3VUZA 4E7KA 1YIJT 2L89A 3SD4A 3HKSA 1I8FA 2K3YA 4JRKA 2E1HA 3CBMA 4M77A 4M78G 2CYZB 4EDUA 3I56T 1VQ6T 2E10A 3M53A 3E1SA 4LD6A 3TCJA 3I56A 1VIEA 3CC4A 2P0KA 4OB2B 3GF5A 5KH6A 2M0OA 5FU7B 3MEUA 3JCMe 3OYMA 1S72A 3E9FA 5D6XA 3S3NA 5I2SA 3M4YA 5LJ3h 4E7JA 3CCRT 2M1HA 1VQMA 5I2MA 3CPWA 3QHSA 3VKIA 1N9SA 3C95A 2ZPEB 5CVIA 1W2BA 1VQ7T 1AHJB 1IZ6A 4M78B 4BE1A 5LJ3j 2X4YA 1IREB 2JUFA 2H3JA 1QP2A 3CC7T 1VIFA 2DZCA 2YHTA 3H8ZA 3JB9I 3L2QA 4P5NA 4DOWA 1M1GA 5IN1A 2DD5A 2PVGB 3R6OA 4EMKC 1O9SA 1YI2T 4V2SA 3WXMB 2EJFA 2QQRA 3F70A 4J83A 5EG2A 1WGSA 3V7SA 3ZBDA 4C8QG 1LNXA 2K5LA 4PLIA 4OP0A 4BI4A 2FL7A 1VQOT 3CCVA 2D6FA 5GAN5 2XHCA 3PTAA 2A7YA 5GANd 3CPWS 1VQ6A 2VGMA 2PU9B 4J7FA 5GAN7 3CBOA 4QQ6A 1KQ1A 3CMAA 2DAQA 4JS4A 2P4TA 5KCHA 3M59A 1QW1A 3QBYA 3JAME 3QJ6A 2I2LA 2K4YA 4MMKA 1JJ2S 4M7AE 1D3BA 2DD4A 2CS7A 4JUVA 4M77D 2K3XA 4F7UB 5GAMh 3UDCA 1VQ7A 4M77G 4CI0C 3P8HA 4X34A 4B9XA 4A4FA 3VV0A 2VV5A 1YBYA 2IG0A 1FWZA 4IURA 3VU3C 1UB4A 1Q82U 4PL6A 3DB4A 4JRIA 4IUTA 4J6XA 5LJ5j 3MCAB 4N0AC 2ZPIB 3PT9A 1VQNA 1Q81U 3CCMA 5FU7C 3OS2A 1FXXA 4M75C 4QQGA 1OZ2A 4XU2A 5D6YA 4NL2A 3ER0A 3RESA 4O6JA 1EIFA 2DK3A 2DXBA 3L2ZA 3MP6A 4BB7A 1KD1U 3META 5GAMg 5GANe 3LW5E 3SWNA 3M56A 3VUBA 3GP8A 4PJOA 4HKEA 4TVRA 4EMKB 1YJ9T 5KE3A 3S3MA 1U8RA 2L8DA 4ZGEB 2FYKA 3LGLA 5FRNA 2O4XB 2XI9A 4M7AD 5DM7R 3CCRA 4KUIA 1K73U 2EQKA 1HXDA 1VQMT 4HT8A 5AYFA 2V8KA 2GCXA 1BIBA 2HNIA 2M9UA 4J8OA 5CKBA 4KBMB 4F7UF 5LJ5e 1Q86U 3OY9A 2OTJT 4FIBA 1N6AA 4XTYA 5A0LA 2VUBA 2QTXA 1N8RU 3WVEB 1M1KU 4LDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RH2 A;  2RK1 A;  3UDC A;  1VIF A;  3T9N A;  2GQV A;  3SFM A;  2RK2 A;  1VIE A;  2VV5 A;  2OAU A;  2P4T A; 
#chains in the Genus database with same CATH topology
 3A8M B;  3UWN A;  5GAO m;  1UHF A;  4C5G A;  4Y91 A;  2RJF A;  3CCS A;  2BUD A;  4MML A;  4AG1 C;  1RI9 A;  4RTT A;  1PM3 A;  3CC7 Q;  4F7U E;  1Y0M A;  2J7I A;  2B86 A;  5FLX E;  3OYF A;  2GNC A;  5FU6 C;  1FX7 A;  2KR3 A;  4UC4 A;  2DXU A;  3QG1 A;  2RQR A;  2XU8 A;  1UJ0 A;  3KFV A;  2NUT A;  1H3Z A;  3I55 T;  4JDS A;  4Z89 A;  4OMN A;  3T9N A;  1ZBX A;  3A5Z B;  4MZM A;  3EG3 A;  1LCK A;  3KXT A;  5GAN 8;  2KY9 A;  4JJB A;  1MMN A;  1UE9 A;  1NPR A;  2E5Q A;  5IHN A;  3ZFJ A;  2R57 A;  4B9W A;  2LMJ A;  2EJG A;  3MP1 A;  4M78 E;  3RNJ A;  4A4H A;  1NE8 A;  3CCQ T;  3QWY A;  5D6W A;  3OYH A;  2WSF E;  1JJ2 A;  3OB9 A;  3SHW A;  2B8A A;  2EKH A;  4J9F A;  3OYA A;  1K9M C;  1D1A A;  2DMO A;  1GRI A;  1D1C A;  4JJD A;  5KYN A;  2ZGW A;  4N4G A;  1AWW A;  5KCO A;  3CEY A;  2GTJ A;  2GF7 A;  5L8R E;  4Y28 E;  2MMP A;  2QA4 Q;  3EAE A;  2CZ6 B;  4J5Y A;  2AHJ B;  4M78 A;  1IHW A;  1Q7Y U;  1SG5 A;  2LTO A;  2HCK A;  1WYX A;  2OTL Q;  3PIP A;  3H0F A;  1XOV A;  2K9G A;  2KRN A;  2OAW A;  2MPX C;  2DRK A;  5HK0 A;  2FHD A;  3JB9 D;  1MMA A;  4M77 C;  2RPN A;  2JTM A;  3EG0 A;  4LDW A;  1VQK T;  3VS6 A;  1U06 A;  2DIQ A;  1M30 A;  3LH0 A;  5KYU B;  2VB6 A;  3S6W A;  1UEB A;  1Q82 R;  2VGN A;  2EYQ A;  4ZN3 A;  4IUQ A;  3L2W A;  2F5K A;  2G6F X;  2CZ1 B;  1TSF A;  4RTV A;  3E9G A;  5KE2 A;  2AKK A;  2YWW A;  4N4H A;  2DTI A;  2LNH B;  3P8B B;  2DL3 A;  2QQB A;  2JXB A;  2LX9 A;  4A63 B;  1VA7 A;  4AFU C;  2RH2 A;  5GAO n;  2HD0 A;  2FRY A;  3M4G A;  2KSS A;  2IVW A;  3MO8 A;  3OSS C;  1E6H A;  2ZPH B;  1KC8 U;  4BDY A;  4C92 B;  5GJW B;  2DZ9 A;  2OX7 A;  2V8I A;  1HJD A;  3G6E Q;  3H0I A;  4X9C A;  2LCL A;  2QDY B;  4FYV B;  2QEX Q;  4C92 E;  3GPL A;  2DYB A;  2HL5 C;  1G3S A;  5FRM A;  4E7I A;  1VOM A;  1RAC B;  3GOX A;  2DL7 A;  3BDL A;  2P84 A;  1C6V X;  2A08 A;  1WXB A;  3CCU Q;  2VC8 A;  4M75 A;  4XU1 A;  1PD1 A;  4C0D B;  4ZTJ A;  1BBZ A;  3OS1 A;  3DB3 A;  3WVD B;  3MP8 A;  1BI0 A;  2V1R A;  1IB8 A;  2QGF B;  1I5L A;  3JB9 H;  1XJW B;  2QYZ A;  2VVK A;  1VQN Q;  4BE1 A;  2GFU A;  4PKC C;  1VQ8 T;  3ASK A;  1T0J A;  5GAN 2;  2VXF A;  1IGQ A;  5GAO l;  4OF1 A;  5CAI A;  4BE0 A;  4OMO A;  2D1X A;  3JV3 A;  1CSK A;  1ZA2 B;  2GFA A;  2RI3 A;  4HA8 A;  4M77 E;  2M51 A;  2CSQ A;  2W10 A;  1QVP A;  3CD6 T;  4LD9 K;  1W4S A;  2X9H A;  1M2V A;  1BYM A;  1NYG A;  3OSV A;  2LZ6 B;  4YTL A;  3X28 B;  2EWN A;  1X6B A;  2XMF A;  3DLL A;  1MV0 B;  1JU5 C;  3HL8 A;  3KBG A;  1MGQ A;  5J39 A;  1ZSZ B;  5LJ5 d;  4KH0 B;  1VYV A;  2K2V A;  2A0F B;  2C0I A;  1HK9 A;  4DQ2 A;  3NTH A;  3GNG A;  4M7D F;  1QVF A;  5GJV B;  2LDM A;  4JRQ A;  1FMW A;  1KG1 A;  5DLO A;  1IO6 A;  1QVF S;  1M3A A;  1WJR A;  4PNO A;  4XU3 A;  3OYY A;  2LJ1 A;  1BCO A;  1K9A A;  3C0C A;  1VQP Q;  1U1T A;  4ATO A;  4MDX A;  2X4W A;  2EKO A;  2GQI A;  3L1A A;  4XTX A;  3CXC S;  1IHV A;  1K1Z A;  3FLG A;  4OMQ A;  4BI8 B;  5CIU A;  1RAB B;  1KC8 C;  4IUP A;  1KIK A;  1YIT Q;  5IHK A;  3JCM P;  4OB1 B;  4L59 A;  2GTO A;  1YJN A;  2EJ9 A;  4EPC A;  3PVL A;  2FZC B;  5IT9 E;  2DBK A;  3M0U A;  3HHT B;  4XTV A;  1TUC A;  1YJW A;  1GFD A;  1NLP C;  1U5S A;  3NMZ C;  3FIF A;  3J80 E;  5CKF A;  4Q5W A;  4JLG A;  2J6K A;  2PUO B;  4JZ3 A;  2QK0 A;  1VQP A;  2LQK A;  2HQE A;  5LJ3 f;  2XG8 D;  4QVD A;  2CP2 A;  1NJI C;  2L3R A;  2BE9 B;  2LT1 A;  4L6V 5;  4E7K A;  3M0T A;  2L89 A;  1IXD A;  4JRK A;  2EVR A;  2E1H A;  4EDU A;  1KQS P;  3CD6 Q;  1QMC A;  3I56 A;  1VIE A;  4OB2 B;  3GF5 A;  5FU7 B;  3OYM A;  1S72 A;  2DM1 A;  3M4Y A;  5LJ3 h;  4E7J A;  3CPW P;  3QHS A;  2CH4 A;  1N9S A;  3FJ5 A;  3C95 A;  1J3T A;  2ZPE B;  2A28 A;  1AHJ B;  1IZ6 A;  2X4Y A;  3EG9 A;  1OEB A;  1Q81 R;  1VIF A;  2YHT A;  4RTZ A;  5IN1 A;  3R6O A;  4PJL A;  4V2S A;  3VS3 A;  2QQR A;  2KRM A;  1GCP A;  2EGC A;  2QGG A;  4J9B A;  2XHC A;  1SKU B;  4FW2 A;  1QVF P;  2PU9 B;  5GAN 7;  3CBO A;  4QQ6 A;  1KQ1 A;  1TUD A;  2P4T A;  1WXT A;  5KCH A;  3JAM E;  3QJ6 A;  1JJ2 S;  2YUN A;  2RNA A;  1VQ7 A;  4J9G A;  2HBW A;  4A4F A;  2VV5 A;  2YRC A;  1YBY A;  1UB4 A;  1Q82 U;  3DB4 A;  1VQN A;  1UHC A;  2K79 A;  3OS2 A;  1FMK A;  4M75 C;  1PKT A;  3L2Z A;  4BB7 A;  1KD1 U;  3MP6 A;  1UDL A;  3SWN A;  5FW9 A;  4HKE A;  4TVR A;  2L8D A;  2K6D A;  2XI9 A;  3A1P A;  2GCX A;  2HNI A;  2JM8 A;  1Q86 U;  3AT1 B;  1T0H A;  4FIB A;  2VUB A;  2CH4 W;  2D8J A;  3WVE B;  1UEC A;  1UJY A;  3IQL A;  1M1K U;  1AWJ A;  5GMK h;  1NJI R;  2A3L A;  4RMO A;  1GCQ A;  2KT8 A;  1TG0 A;  1X75 C;  1D0X A;  2COY A;  1R0B G;  1OX9 A;  2EPD A;  3OYE A;  3H0H A;  2DXC A;  4WF2 A;  1WLP B;  3VS2 A;  5HKC A;  4JZ4 A;  2RB6 A;  2BKD N;  5GMK i;  2NLU A;  1K73 R;  4PFP A;  1TXQ A;  4LDY A;  4ZGJ B;  4PJO B;  2LX7 A;  2DX1 A;  2EQJ A;  1GL5 A;  2DTH A;  1WI7 A;  2P0Q A;  4IUV A;  2Y4Y A;  2J06 A;  2NUP B;  5C0M A;  3G6E T;  1B34 B;  2FO0 A;  3X24 B;  4DBF A;  5GMK l;  1BIA A;  3CC4 Q;  3NPF A;  3QDR B;  1RAH B;  2L3Q A;  4DBR A;  3CCQ A;  3QSU A;  1UTI A;  4GY5 A;  4J9H A;  2E6N A;  4C5I A;  2KK4 A;  1SPK A;  1K0X A;  1IRX A;  1RAA B;  3HP9 A;  2YRV A;  2W0Z A;  2LC4 A;  7AT1 B;  2HAX A;  1SEM A;  1X2Q A;  2J6O A;  1VQO A;  2EQI A;  3H9N A;  2F2W A;  2JM9 A;  4OGE A;  1FMV A;  2H3E B;  1B34 A;  1W2B S;  1I07 A;  2L2P A;  1YP5 A;  3MEA A;  4OB3 B;  2K3B A;  3G71 T;  2O31 A;  2MI6 A;  2EAY A;  5FWB A;  4RTX A;  1G3T A;  1LJO A;  2EYY A;  2EGA A;  4B6M A;  1KSW A;  1TU0 B;  3QDF A;  4BY6 C;  5LL6 S;  2YT6 A;  2RQU A;  4DOV A;  3CCE A;  3QYG B;  3NGP A;  3QII A;  3OYD A;  1H64 1;  1X69 A;  3OYG A;  4C92 F;  1S72 T;  3OS5 A;  2BTT A;  5IXF A;  5GAM d;  2X4J A;  1DJ7 B;  3L2U A;  4FU6 A;  3PMI A;  3X26 B;  2XID A;  1NG2 A;  4J9C A;  4QVC A;  4BY6 B;  4C5H A;  5A2Q E;  2QDL A;  2HSE B;  4RCC A;  1NZ9 A;  1AOJ A;  4J6W A;  4QW2 A;  3SWN B;  1UGQ B;  2CP0 A;  1EFN A;  5GAM f;  2MWO A;  3A8O B;  1QVG S;  4C0D C;  3MKD A;  1LVK A;  1OI1 A;  2Y4X A;  4AFZ C;  2PNI A;  2RHY A;  2JMA A;  3LWH A;  2CGH A;  1JB0 E;  1UG1 A;  1Q82 C;  1NM7 A;  1R77 A;  4AT1 B;  3NFC A;  3J7A F;  2PUK B;  4JLI A;  3QPH A;  2COW A;  2E5K A;  2XDD A;  3CC7 A;  5CO7 A;  3JCM b;  2F1L A;  1Y96 A;  3EH2 A;  1VUB A;  3FDR A;  3OMC A;  3OMG A;  4E7S A;  2ZPG B;  4LDX A;  4LN2 A;  1RAG B;  1MNE A;  1OV3 A;  2QEX T;  3MEV A;  4C8Q F;  3EFO A;  4A53 A;  1D0Y A;  4A4K A;  1PRM C;  4C8Q C;  1M8V A;  2KDS A;  3EG9 B;  3EGX B;  3HFN A;  2BE7 D;  1KK7 A;  4M7D E;  4PFZ A;  1OYX A;  1KHI A;  1OU9 A;  3CCL A;  2Y90 A;  4HVV A;  3EFR A;  2KRO A;  5CR2 A;  2HQX A;  3M9Q A;  2M16 A;  4X1V A;  3RBB B;  3CQT A;  1B07 A;  5AT1 B;  3G4S T;  2DEU A;  1V29 B;  5I22 A;  1NEG A;  1GCQ C;  1K76 A;  2EYX A;  4F04 B;  3JCM g;  1W2B P;  3EHQ A;  1TOV A;  1TWB A;  2DJQ A;  4PJN A;  2HDA A;  4R56 A;  8AT1 B;  4J6Y A;  4MZP A;  3OYK A;  5J26 A;  4OMP A;  2DPP B;  4KH1 B;  1ZX6 A;  2BZY A;  1WZO A;  1VQ5 T;  5CKE A;  3LLR A;  2ZCF B;  2C06 A;  3PE0 A;  2MCN A;  2DE0 X;  1X6O A;  1QLY A;  3VS0 A;  1Q7Y C;  3BE3 A;  1VQL Q;  2ROT A;  2QXF A;  2MAM A;  1YIJ A;  2KXC A;  2XDB A;  3CCL T;  3SB2 A;  1BKB A;  1M3B A;  1JRI A;  2SRC A;  2ABL A;  2DIG A;  2CRE A;  3M0S A;  1MUZ A;  1KJW A;  2F2X A;  4NS5 A;  3V8K A;  3EGX A;  4D6W A;  1GBR A;  2JZ2 A;  2WSC E;  1GBQ A;  2KYB A;  1UFF A;  1YI2 Q;  1WHH A;  3EFO B;  2AK5 A;  2KMT A;  2DEQ A;  1XTD A;  2YSQ A;  2QI2 A;  3CD6 A;  2EIF A;  1BI2 A;  2RF0 A;  3M55 A;  4VUB A;  4OVA A;  2D8H A;  2E6Z A;  1Y96 B;  3SDZ A;  1WIE A;  2RJC A;  2YUP A;  4GLK A;  1ACM B;  1MV3 A;  2WAC A;  3VYG A;  1WQW A;  4J7I A;  2DYI A;  2BIV A;  3CMA T;  4IKF A;  1M90 U;  1WX6 A;  1M3C A;  4BUG A;  3OYB A;  4DA4 A;  3CC2 A;  2DNU A;  4PJO F;  1N5Z A;  1PRL C;  3OYL A;  3NTI A;  3VYH B;  1GXI E;  1YJN Q;  2CKK A;  3BFM A;  2EGE A;  1I5O B;  2KAF A;  4FYY B;  2R5M A;  1H3H A;  2CZ7 B;  2L0A A;  4FM4 B;  2JW4 A;  2K5F A;  2DVE A;  2RHI A;  1U1S A;  1M2V B;  1VQO Q;  2JN0 A;  1B7T A;  1LPL A;  1AWX A;  4CC4 B;  1BU1 A;  1M2O A;  2FRW A;  2DL4 A;  2C0O A;  2BZX A;  2V26 A;  2F69 A;  3JB9 G;  3E19 A;  1JXO A;  3HSB A;  2VYT A;  4M4Z A;  4XTW A;  4KGX B;  3TSZ A;  3VUZ A;  1YIJ T;  4LUE A;  1I8F A;  2K3Y A;  4J9D A;  3A98 A;  1VQ6 T;  2E10 A;  2CDT A;  3M53 A;  2A37 A;  3TCJ A;  3MEU A;  1Z9Q A;  3E9F A;  5D6X A;  5I2S A;  1WA7 A;  2DVJ A;  3EG1 A;  3VKI A;  1VQ4 Q;  1QP2 A;  2DZC A;  3H8Z A;  4P5N A;  2M02 A;  1YI2 T;  2PVG B;  4EMK C;  4K11 A;  2E3I A;  3ZBD A;  2EJF A;  4J83 A;  4PLI A;  4OP0 A;  3CCV A;  2A7Y A;  5GAN d;  3CPW S;  6AT1 B;  3CMA A;  2DAQ A;  3M59 A;  3QBY A;  2JJ9 A;  1JO8 A;  1IGU A;  2K3X A;  2ATC B;  4M77 G;  2KXD A;  1CKB A;  4IUR A;  2X3W D;  1T3S A;  2QG9 B;  4PL6 A;  4AFS C;  4IUT A;  5LJ5 j;  4N0A C;  2L3S A;  1Q81 U;  4IIM A;  4XU2 A;  1OZ2 A;  4NL2 A;  2NUP A;  3RES A;  1OUL A;  1EIF A;  2DK3 A;  3M56 A;  4PJO A;  1YJ9 T;  1WXU A;  1ZSZ C;  1NEB A;  3S3M A;  1U8R A;  2FYK A;  5DM7 R;  1BB9 A;  1HXD A;  2V8K A;  1AT1 B;  5CKB A;  4J9E A;  2OTJ T;  4KGZ B;  2QTX A;  1N8R U;  5KYU A;  4LDV A;  4E6R A;  1SSF A;  3CCJ A;  1NLO C;  2GGR A;  5HK3 A;  2V1Q A;  3UF4 A;  5GAN h;  1K8A C;  1X01 A;  2DBM A;  3GIB A;  4MZT A;  1MND A;  3CMA Q;  4FCY A;  5GAO r;  1PD0 A;  2LCS A;  2O9S A;  4C92 D;  2DXT A;  1WPY A;  5GAN g;  3RDV A;  2E41 A;  4ORZ A;  3V7R A;  2K5I A;  4WCI A;  3RR6 A;  2DER A;  1VQ4 A;  1UGV A;  1VQP T;  2YUO A;  1OQK A;  3C94 A;  3CCJ T;  1WJS A;  3PIO A;  1S72 Q;  2WSE E;  2A36 A;  2MWP A;  1Z9Z A;  3JB9 F;  1WHM A;  4D8K A;  1G5V A;  1D0Z A;  1QKX A;  2CZ0 B;  4CC2 A;  1KHC A;  1P92 A;  3FB9 A;  2HL3 A;  3CPF A;  1BCM A;  1K9M U;  2KE9 A;  3JCM W;  5IAY A;  2KGT A;  3HRT A;  4C92 C;  1BI3 A;  3J81 E;  2OTL A;  1M27 C;  1YJW Q;  3G4S A;  1UGR B;  1SF9 A;  2RO0 A;  4FSX A;  2KI7 A;  1RUW A;  4M7D G;  3U23 A;  3OW2 S;  1ZHI A;  4PK4 A;  5CKH A;  3HFO A;  4KRT A;  4OMF B;  1YHQ Q;  3SFM A;  3VS5 A;  2DO3 A;  2OAU A;  2RN8 A;  3RER A;  3EG2 A;  4FT4 A;  4M7D C;  2AT1 B;  1QWE A;  3ME9 A;  3QJY A;  3TQ7 P;  3RMQ A;  2NUT B;  4M75 D;  2QA4 A;  1G8X A;  2F2V A;  2LNV A;  2QTV A;  3JRZ A;  1G3Y A;  3OA6 A;  1KQS S;  2L3P A;  1QKW A;  2FEI A;  2GBQ A;  3BW1 A;  3KUF A;  1UGP B;  1MHN A;  1RAE B;  4E7H A;  1K9M R;  3EHR A;  5GAM e;  1NYF A;  4R55 A;  2RM4 A;  3UPU A;  3QKJ A;  2GQV A;  1M1K R;  4XTU A;  3EGD B;  1RAI B;  1N8R R;  2DTO A;  4M75 E;  1F1B B;  3CBP A;  1AZG B;  5LJ3 e;  1YI2 A;  5CQX A;  4RG8 A;  4EMK A;  2LQN A;  2D9T A;  3GBQ A;  3H6Z A;  5FRO A;  2LJ3 A;  4C5E A;  3JCM V;  2YLB A;  3EFS A;  5GMK e;  5GAN j;  2CT3 A;  2RHX A;  2HQH A;  1TUG B;  1JJ2 P;  3CME A;  2HEQ A;  1VQL A;  4JPB W;  2FPE A;  2YLC A;  2E3H A;  2KYM A;  2RK2 A;  4BAC A;  3JCM J;  1Q95 G;  1AVZ C;  1PWT A;  5CKD A;  2QQS A;  2RJE A;  3CXC P;  4C0Z A;  1I81 A;  4LE9 A;  3GNF B;  5KYW A;  2HKQ B;  3DLM A;  1M4Z A;  3MHX A;  2DLP A;  5LJ5 f;  4PJJ A;  1EX4 A;  2RHU A;  1JXM A;  4C0G A;  3FJP A;  1YJW T;  5HCK A;  8ATC B;  3OYC A;  1ZSZ A;  2KT1 A;  4QT7 A;  4ELY C;  2CT4 A;  3RMS A;  3C4S A;  3M54 A;  2PQW A;  2LT4 A;  5HY6 A;  2FPD A;  1N8R C;  5CQY A;  1OU8 A;  1QVG P;  2HSP A;  2COZ A;  3LH5 A;  4C92 G;  1HYO A;  2VWF A;  4M78 D;  5LJ5 g;  4KT0 E;  2BZ8 A;  2QEX A;  4M77 B;  4QVZ A;  2KBT A;  3M58 A;  3G6E A;  3RUX A;  5GAO p;  3ZL7 C;  3FRN A;  3LGF A;  2K2M A;  1VQ9 A;  3A8G B;  5IXB A;  1VQK A;  2NWM A;  2CP7 A;  2CP3 A;  4C0F A;  2OJ2 A;  2MYS A;  1PSF A;  1BK2 A;  3O8V A;  3TRE A;  3G71 A;  3QUI A;  4N4I A;  1PC0 A;  3TVT A;  2H8H A;  4M7A G;  5J3B A;  4DEX A;  2G3R A;  1VQL T;  1ZSG A;  1X27 A;  2LQW A;  1E7O A;  1HD3 A;  2FVU A;  5GMK j;  3CCV T;  2JT4 A;  2RJD A;  4C8Q E;  4ANJ A;  3I5R A;  1M90 R;  4BE2 A;  3G7Z A;  4II1 A;  9ATC B;  4M75 B;  2FZK B;  3CCE T;  2LJ0 A;  3HPW A;  2RHZ A;  4MDW A;  1Q86 C;  1VQM Q;  4LDU A;  4JJN K;  3UA6 A;  1KD1 R;  3HRU A;  1JBM A;  1H8K A;  2JTE A;  4JRP A;  2RMO A;  3C12 A;  3HTR A;  4HCK A;  3INZ A;  3I35 A;  1JQQ A;  3OW2 P;  1BI1 A;  3QO3 A;  2DJZ A;  4PLL A;  4C8Q D;  4E2F B;  2XK0 A;  4JS5 A;  1UGS B;  2YDL A;  4C92 A;  5A0D A;  2PVO B;  1AZE A;  3CCE Q;  1VQ5 Q;  3EGU A;  5GAN 4;  1AD5 A;  3SWN C;  1PSE A;  2CUB A;  1X2K A;  2E4H A;  2V8J A;  4M7A A;  3JSC A;  1M8M A;  4QQD A;  3OQ5 A;  2JNG A;  2MF2 A;  3TU4 K;  1ZUK A;  4FYX B;  2DF6 A;  3V8J A;  3V7C A;  2EQM A;  1PCX A;  3SEM A;  4M7D A;  2E64 A;  4IUU A;  2ENM A;  1FYN A;  1VQ9 T;  3I9Q A;  4PFO A;  4OB0 B;  5KYX B;  5FU6 B;  2J05 A;  3I55 A;  3FEO A;  1C1A A;  1SHG A;  4F16 A;  1QCF A;  1WQ7 A;  3UAT A;  1HSQ A;  4KGV B;  1RLQ C;  4ZGD B;  2XD0 A;  5DY9 A;  2DL5 A;  2NUZ A;  4M78 F;  3TSW A;  4OMM A;  3PMT A;  3OS0 A;  1XNI A;  3PNW C;  1GFC A;  3SD4 A;  3HKS A;  4M78 G;  4CC7 A;  3CCQ Q;  3E1S A;  4LD6 A;  3CC4 A;  2P0K A;  2JMC A;  3EH1 A;  3CCR T;  1OOT A;  2M1H A;  1VQM A;  5I2M A;  3CPW A;  5CVI A;  4M78 B;  5LJ3 j;  2HZY A;  2H3J A;  2ESW A;  3CC7 T;  3L2Q A;  3JB9 I;  1ABO A;  2P4R A;  1OX8 A;  1ZUU A;  3WXM B;  5KYY B;  1ZUY A;  4BI4 A;  2FL7 A;  4FYW B;  1VQO T;  5GAN 5;  3PTA A;  1VQ6 A;  2VGM A;  1CKA A;  4JS4 A;  1AWO A;  1QW1 A;  2AKL A;  3R6N A;  2I2L A;  2K4Y A;  1D3B A;  2DD4 A;  4M77 D;  2AZS A;  3CCS Q;  4F7U B;  4FSS A;  4X34 A;  2O2O A;  4B9X A;  3VV0 A;  2IG0 A;  1T3L A;  2O9V A;  2ZPI B;  3PT9 A;  1Q7Y R;  3I5S A;  2YUQ A;  3CCM A;  1FXX A;  3ULR B;  1KFZ A;  4Y92 A;  3ER0 A;  4HVU A;  4O6J A;  5GAM g;  3LW5 E;  2MK5 A;  5KE3 A;  5FRN A;  1W6X A;  2Z0W A;  4KUI A;  3CCR A;  2EQK A;  1VQM T;  2M9U A;  1W70 A;  4J8O A;  4KBM B;  2CP6 A;  3D7S B;  3OY9 A;  1PHT A;  4ZNX A;  5EC7 A;  2C0T A;  1M1F A;  2J6F A;  3M5A A;  4E47 A;  5I11 A;  3PFS A;  3FC3 A;  1TTH B;  1VQ7 Q;  2RA2 A;  3LWI A;  4FL6 A;  1V1C A;  3A8H B;  2XKO C;  1O75 A;  4AG2 C;  1VYU A;  2CSI A;  1KQS A;  3RKW A;  1OZ3 A;  2HKN A;  4A54 A;  3CME Q;  4ELZ C;  1MMG A;  2X35 A;  3OW2 A;  4RTW A;  3L42 A;  4E7Z A;  4RCB A;  3CC2 T;  3OYI A;  3QWX X;  4A4G A;  3BDU A;  1NJI U;  1PNJ A;  2O4X A;  4BD3 A;  1X43 A;  3P8D A;  4OGC A;  4HCZ A;  4ZTF A;  4BDZ A;  3LYI A;  4M7D D;  4DEY A;  3M0Q A;  4E7L A;  3REB B;  3UT1 A;  5D7U A;  4M77 F;  3CCM T;  2EQU A;  3MPU B;  2OTJ Q;  3OBY A;  4LNP A;  3I56 Q;  3JB9 J;  2EFI A;  2ZZD A;  2O88 A;  3NHN A;  1OPL A;  3QZ9 B;  3JCM c;  3A8L B;  2PTK A;  1Q81 C;  1ARK A;  3H41 A;  3THK A;  1NPP A;  2P0P A;  4C8Q B;  3M0R A;  4M7A C;  4C8Q A;  1I0C A;  4J9I A;  2JTF A;  2ZAE A;  2X51 A;  2EYZ A;  4DBQ A;  1U3O A;  4CC3 A;  2E65 A;  4BI3 A;  4HXJ A;  4QKU A;  2RQW A;  3N5B B;  4D8D A;  4XTZ A;  3JCM X;  1YHQ A;  1ZBJ A;  2ED0 A;  4HCC A;  4NOY A;  2X3X D;  3MEW A;  1YIT A;  2HMA A;  5IHI A;  5IH2 A;  2OTL T;  4RUG A;  4HCB A;  3G4S Q;  1A0N B;  1Y7X A;  4PJO G;  2F5T X;  3RIR A;  3JCM f;  2ZPF B;  3REA B;  2KEA A;  4HVW A;  1K4U S;  1QWF A;  4ESR A;  3JCM Q;  3PGG A;  2QAS A;  4XQ3 A;  2LQ8 A;  4F14 A;  1KC8 R;  3M0P A;  5A0G A;  5M9O A;  3QZ5 B;  2OTJ A;  1I1J A;  1M9S A;  2AZV A;  2FZG B;  2VXE A;  1KD1 C;  1SHF A;  2FPF A;  1WNL A;  2KRS A;  2XIC A;  3UA7 A;  3ZEH A;  1WHG A;  5LJ3 d;  3E2U A;  4GBQ A;  4FW1 A;  3OYJ A;  3DKM A;  2IIM A;  1B3Q A;  4R0K A;  4AFQ C;  1YJ9 A;  1QP3 A;  4XK8 E;  2EYW A;  2FB7 A;  2IPO B;  2AIR B;  1MMD A;  5GAN 6;  3GLX A;  3VJP A;  2L5Q A;  1PKS A;  4EMG A;  4A4E A;  1S1N A;  1G3W A;  4M75 G;  3AHU A;  1RAF B;  1YCY A;  1YHQ T;  5GAO q;  3L2R A;  4F7U A;  2O01 E;  1WHJ A;  2R58 A;  1YFN A;  1D09 B;  1RI0 A;  1D3B B;  4M75 F;  3X20 B;  3M57 A;  5CCA A;  2VAS A;  1K8A R;  3VS1 A;  3CCJ Q;  5GAN 3;  1AEY A;  2RI2 A;  4Z88 A;  5FWC A;  3CME T;  1WDX A;  1TS9 A;  5KYY A;  1QCN A;  2YRD A;  4EIK A;  2RQV A;  1VQ8 A;  1KQ2 A;  3HRS A;  4CRI A;  1ABQ A;  3NTK A;  1M5Q 1;  3LX7 A;  2LCC A;  4RG2 A;  1VQ4 T;  4XU0 A;  3CCU A;  1ZQ1 A;  2CP5 A;  3CCS T;  2JVV A;  2DRM A;  2CUD A;  1VQ8 Q;  1M90 C;  3CC4 T;  4RKU E;  5DLQ E;  2X4X A;  2M0Y A;  1SRL A;  1XQH A;  2HBP A;  1Q86 R;  4XAX B;  5CK9 A;  1WHL A;  3X25 B;  3S3O A;  2YXY A;  4KUD K;  1ZA1 B;  5C6S A;  5I21 A;  1JEG A;  4NL3 A;  3V8L A;  1EZZ B;  1N27 A;  1E6G A;  2JOY A;  5LJ5 h;  4AMC A;  1M1K C;  2KVQ G;  1VQ6 Q;  3L2V A;  3CCV Q;  1Y71 A;  3VRZ A;  2DKG A;  2LVM A;  3JCM h;  5KYX A;  1WJQ A;  1YWP A;  2QQ9 A;  2D0Q B;  1RL2 A;  1G83 A;  2E12 A;  2RK1 A;  2KQW A;  1YJ9 Q;  3JCM d;  2DFU A;  1TH7 A;  4PJO D;  4M7D B;  2ED1 A;  4LUD A;  4ME7 A;  2PZ1 A;  4L5G A;  2PVD B;  4FT2 A;  2LRQ A;  1VQN T;  2QA4 T;  1RAD B;  4M7A B;  4IIO A;  2ROL A;  4F7U G;  2K7A A;  2QQA A;  3CCU T;  1YJN T;  2RI5 A;  1C0M A;  4N0A A;  1I4K 1;  4RTU A;  5ECA A;  5GMK m;  1ZLM A;  3OBW A;  2NYS A;  3RKX A;  1W1F A;  4PJO E;  2R5A A;  4PJO C;  4EMH A;  2K57 A;  2ECZ A;  1QVG A;  1N9R A;  1K73 C;  3Q1J A;  1SSH A;  3I55 Q;  2ZPB B;  4X9D A;  3TEE A;  3QYH B;  1YIT T;  5GAN f;  2RD1 A;  4DBH A;  1YWO A;  2MOX A;  1H92 A;  4HT9 A;  4OML A;  4ZN1 A;  2LP5 A;  2RQT A;  3BY7 A;  2EBP A;  4M78 C;  1D1B A;  2EW3 A;  2E70 A;  4M7A F;  3CXC A;  3VS4 A;  4KUL A;  4LXC A;  1K8A U;  3URG A;  1V76 A;  1LOJ A;  1QQJ A;  1R8O B;  4O5V A;  4RTY A;  1WFW A;  3CC2 Q;  2I0N A;  1WHK A;  3OYN A;  1VQ5 A;  1Y07 A;  2XDP A;  5LJ3 g;  1YCS B;  5GAM j;  4Z02 A;  3MJX A;  3QXE B;  4GLM A;  4Z8A A;  3CBM A;  4M77 A;  2CYZ B;  2JS2 A;  3I56 T;  5KH6 A;  4PJM A;  2KNB B;  2M0O A;  3JCM e;  3VRY A;  5L23 A;  3S3N A;  1OPK A;  2D0N A;  1G2B A;  1X6G A;  1W2B A;  1VQ7 T;  2OI3 A;  2DL8 A;  1Y57 A;  1IRE B;  2JUF A;  4DOW A;  1M1G A;  2DD5 A;  2JS0 A;  1O9S A;  1YIJ Q;  1K0S A;  1YNZ A;  3F70 A;  5EG2 A;  1WGS A;  2MIO A;  3V7S A;  4C8Q G;  1LNX A;  2K5L A;  4F17 A;  2D6F A;  5KYW B;  4J7F A;  4JJC A;  2DA9 A;  3G71 Q;  4MMK A;  4M7A E;  1YN8 A;  1SRM A;  2CS7 A;  4JUV A;  1PG5 B;  1RLP C;  1VQK Q;  5GAM h;  3UDC A;  4CI0 C;  1VQ9 Q;  3P8H A;  2SEM A;  1FWZ A;  2FG0 A;  3VU3 C;  3G1J A;  4JRI A;  4J6X A;  2DIL A;  3MCA B;  1QCO A;  5FU7 C;  4QQG A;  5D6Y A;  1UUE A;  3CCL Q;  3CCR Q;  1R0C B;  2DXB A;  2DET A;  4WTO B;  3MET A;  5GAN e;  3GP8 A;  3VUB A;  4EMK B;  4ZGE B;  3LGL A;  2O4X B;  4M7A D;  1K73 U;  4HT8 A;  3PVQ A;  5AYF A;  1VYT A;  1BIB A;  2QAZ A;  4F7U F;  5LJ5 e;  3CCM Q;  3O5Z A;  1N6A A;  4XTY A;  5A0L A;  3EGD A;  3VS7 A;  3RKY A;  2VKN A;  1NBE B; 
#chains in the Genus database with same CATH homology
 1M1F A;  1SSF A;  3A8M B;  3UWN A;  5GAO m;  3M5A A;  4E47 A;  3CCJ A;  4C5G A;  5HK3 A;  3PFS A;  5GMK h;  3FC3 A;  4Y91 A;  2RJF A;  3CCS A;  2A3L A;  2BUD A;  4MML A;  2RA2 A;  5GAN h;  1K8A C;  4RMO A;  1X01 A;  3LWI A;  4FL6 A;  4F7U E;  3A8H B;  2XKO C;  1O75 A;  1X75 C;  3GIB A;  4MZT A;  5FLX E;  3OYF A;  5FU6 C;  5GAO r;  1FX7 A;  1KQS A;  3RKW A;  4UC4 A;  1OZ3 A;  2DXU A;  4C92 D;  2DXT A;  3OYE A;  4A54 A;  3QG1 A;  4ELZ C;  2XU8 A;  2DXC A;  2X35 A;  3OW2 A;  4WF2 A;  5HKC A;  1H3Z A;  3I55 T;  1WPY A;  3L42 A;  2RB6 A;  4JDS A;  5GAN g;  2BKD N;  2E41 A;  4RCB A;  3CC2 T;  5GMK i;  2NLU A;  3T9N A;  3V7R A;  3OYI A;  4A4G A;  1ZBX A;  3BDU A;  3A5Z B;  4MZM A;  4LDY A;  1NJI U;  4BD3 A;  2O4X A;  2K5I A;  3P8D A;  4ZGJ B;  4OGC A;  4HCZ A;  3KXT A;  1VQ4 A;  4ZTF A;  5GAN 8;  4BDZ A;  4PJO B;  3LYI A;  2KY9 A;  1VQP T;  4M7D D;  2EQJ A;  1NPR A;  2DTH A;  2E5Q A;  2P0Q A;  4IUV A;  2Y4Y A;  3ZFJ A;  3C94 A;  3CCJ T;  4E7L A;  1WJS A;  2R57 A;  5C0M A;  4B9W A;  3G6E T;  1B34 B;  3UT1 A;  3X24 B;  3PIO A;  2WSE E;  5GMK l;  2EJG A;  3MP1 A;  2EQU A;  4M78 E;  4M77 F;  3CCM T;  2MWP A;  1BIA A;  4A4H A;  3JB9 F;  3OBY A;  1NE8 A;  3QDR B;  3CCQ T;  3JB9 J;  2EFI A;  3CCQ A;  5D6W A;  3OYH A;  3QSU A;  2ZZD A;  1G5V A;  2CZ0 B;  2WSF E;  3QZ9 B;  3OB9 A;  4GY5 A;  2E6N A;  1JJ2 A;  3JCM c;  4C5I A;  2KK4 A;  2B8A A;  3A8L B;  1KHC A;  1Q81 C;  1P92 A;  3FB9 A;  1NPP A;  2P0P A;  4C8Q B;  3CPF A;  3OYA A;  1K9M C;  1YHQ T;  3HP9 A;  4M7A C;  4C8Q A;  2YRV A;  1K9M U;  2JTF A;  2ZGW A;  4N4G A;  3JCM W;  5KCO A;  2LC4 A;  3CEY A;  5IAY A;  2HAX A;  3HRT A;  4C92 C;  2GF7 A;  1VQO A;  1BI3 A;  5L8R E;  3J81 E;  2OTL A;  4Y28 E;  2MMP A;  4OGE A;  3G4S A;  1UGR B;  2E65 A;  4BI3 A;  2RO0 A;  4FSX A;  4M7D G;  1B34 A;  1W2B S;  3EAE A;  3OW2 S;  1ZHI A;  3N5B B;  2CZ6 B;  3MEA A;  4OB3 B;  4J5Y A;  5CKH A;  3HFO A;  4OMF B;  4XTZ A;  2AHJ B;  3G71 T;  2MI6 A;  4M78 A;  3JCM X;  3SFM A;  2EAY A;  2DO3 A;  2OAU A;  1YHQ A;  1Q7Y U;  3RER A;  1G3T A;  4HCC A;  4NOY A;  1LJO A;  3MEW A;  4FT4 A;  4M7D C;  1YIT A;  3ME9 A;  3QJY A;  2LTO A;  2OTL T;  3RMQ A;  4M75 D;  4BY6 C;  2QA4 A;  4HCB A;  1Y7X A;  4PJO G;  3PIP A;  2LNV A;  2F5T X;  1XOV A;  5LL6 S;  3RIR A;  3JCM f;  4DOV A;  3CCE A;  3JRZ A;  2ZPF B;  5HK0 A;  3QYG B;  2FHD A;  3QII A;  3OYD A;  3JB9 D;  1G3Y A;  3OA6 A;  1KQS S;  1H64 1;  4M77 C;  3BW1 A;  2JTM A;  3KUF A;  3OYG A;  1UGP B;  4C92 F;  3JCM Q;  4LDW A;  1MHN A;  3PGG A;  4E7H A;  1S72 T;  1VQK T;  3OS5 A;  2DIQ A;  5GAM e;  4XQ3 A;  3LH0 A;  5GAM d;  2RM4 A;  2X4J A;  2LQ8 A;  4R55 A;  1DJ7 B;  3L2U A;  5A0G A;  4FU6 A;  5M9O A;  3UPU A;  3PMI A;  3X26 B;  3QKJ A;  2GQV A;  4XTU A;  3S6W A;  3QZ5 B;  1UEB A;  3CC4 T;  2VGN A;  2XID A;  2OTJ A;  2EYQ A;  1M9S A;  4ZN3 A;  2DTO A;  4M75 E;  2VXE A;  1KD1 C;  3CBP A;  1WNL A;  4IUQ A;  2XIC A;  4QVC A;  2F5K A;  5LJ3 d;  3ZEH A;  3L2W A;  5LJ3 e;  3OYJ A;  1YI2 A;  4BY6 B;  4C5H A;  5CQX A;  5A2Q E;  3DKM A;  4RG8 A;  4RCC A;  2CZ1 B;  4EMK A;  1NZ9 A;  2D9T A;  4J6W A;  4QW2 A;  3SWN B;  1YJ9 A;  3H6Z A;  1UGQ B;  3E9G A;  1QP3 A;  4XK8 E;  5GAM f;  5KE2 A;  2MWO A;  2FB7 A;  3A8O B;  5FRO A;  4N4H A;  2DTI A;  3P8B B;  4C0D C;  4C5E A;  1QVG S;  3JCM V;  2YLB A;  3J7A F;  5GAN 6;  2QQB A;  3EFS A;  3GLX A;  5GMK e;  5GAN j;  3VJP A;  1OI1 A;  2L5Q A;  2RHX A;  2Y4X A;  4EMG A;  4A4E A;  2LX9 A;  1G3W A;  4M75 G;  3CME A;  1VQL A;  3AHU A;  2RHY A;  3LWH A;  2CGH A;  2RH2 A;  5GAO n;  1JB0 E;  1Q82 C;  2HD0 A;  2YLC A;  1YCY A;  3M4G A;  2RK2 A;  2KSS A;  2IVW A;  4BAC A;  3MO8 A;  3OSS C;  5GAO q;  3L2R A;  3NFC A;  2O01 E;  2PUK B;  4JLI A;  3QPH A;  4F7U A;  3JCM J;  2R58 A;  2ZPH B;  1KC8 U;  4BDY A;  4C92 B;  1RI0 A;  2XDD A;  3CC7 A;  1D3B B;  2DZ9 A;  4M75 F;  5CO7 A;  3X20 B;  5CKD A;  3JCM b;  2QQS A;  3M57 A;  2RJE A;  5CCA A;  4C0Z A;  1I81 A;  1Y96 A;  1VUB A;  3FDR A;  3GNF B;  2V8I A;  3DLM A;  3OMC A;  5GAN 3;  3OMG A;  1M4Z A;  4X9C A;  2LCL A;  2QDY B;  2RI2 A;  2ZPG B;  3MHX A;  5LJ5 f;  4C92 E;  3GPL A;  3CME T;  4LDX A;  2RHU A;  1G3S A;  4C0G A;  5FRM A;  3FJP A;  2QEX T;  4E7I A;  1VQ8 A;  1KQ2 A;  3HRS A;  3MEV A;  1YJW T;  4C8Q F;  4CRI A;  3OYC A;  3GOX A;  4A53 A;  4A4K A;  4C8Q C;  3BDL A;  3NTK A;  1M8V A;  1M5Q 1;  2KDS A;  3LX7 A;  2LCC A;  4ELY C;  4RG2 A;  3RMS A;  2VC8 A;  1VQ4 T;  3HFN A;  4M75 A;  4XU0 A;  3C4S A;  4XU1 A;  4C0D B;  3M54 A;  3CCU A;  4ZTJ A;  2PQW A;  2LT4 A;  5HY6 A;  4M7D E;  1ZQ1 A;  1OYX A;  3CCS T;  1N8R C;  1KHI A;  5CQY A;  2JVV A;  3DB3 A;  3MP8 A;  1BI0 A;  3WVD B;  3OS1 A;  3CCL A;  1I5L A;  2Y90 A;  4C92 G;  3EFR A;  3RKY A;  3JB9 H;  5CR2 A;  2HQX A;  1M90 C;  4M78 D;  3M9Q A;  2GFU A;  2M16 A;  4PKC C;  4KT0 E;  4RKU E;  5DLQ E;  5LJ5 g;  2QEX A;  1VQ8 T;  2X4X A;  4M77 B;  4QVZ A;  3G4S T;  3ASK A;  3M58 A;  3G6E A;  1V29 B;  2VXF A;  3RUX A;  5GAN 2;  5GAO p;  5GAO l;  3FRN A;  1XQH A;  3LGF A;  4OF1 A;  5CAI A;  2HBP A;  4BE0 A;  1VQ9 A;  3A8G B;  3JCM g;  1VQK A;  4XAX B;  5CK9 A;  2GFA A;  3X25 B;  4R56 A;  3S3O A;  2RI3 A;  4C0F A;  4KUD K;  4J6Y A;  4HA8 A;  4MZP A;  4M77 E;  5C6S A;  5I21 A;  1PSF A;  5J26 A;  3OYK A;  2DPP B;  3O8V A;  4NL3 A;  3TRE A;  3V8L A;  3G71 A;  3QUI A;  1VQ5 T;  4N4I A;  5CKE A;  1N27 A;  3LLR A;  2ZCF B;  4M7A G;  5J3B A;  2C06 A;  2JOY A;  5LJ5 h;  1M1K C;  1QVP A;  1X6O A;  2G3R A;  2KVQ G;  1VQL T;  3CD6 T;  3L2V A;  4LD9 K;  1W4S A;  1Q7Y C;  1Y71 A;  2FVU A;  5GMK j;  2DKG A;  1BYM A;  2LVM A;  3CCV T;  3JCM h;  2QXF A;  2MAM A;  3OSV A;  1WJQ A;  2QQ9 A;  1YIJ A;  2RJD A;  4YTL A;  2XDB A;  2D0Q B;  3X28 B;  4C8Q E;  1RL2 A;  3CCL T;  3SB2 A;  1BKB A;  2EWN A;  1JRI A;  2E12 A;  4BE2 A;  2DIG A;  3G7Z A;  4II1 A;  2RK1 A;  3DLL A;  2KQW A;  4NS5 A;  3V8K A;  3JCM d;  4M75 B;  3HL8 A;  1TH7 A;  3CCE T;  4PJO D;  3KBG A;  4D6W A;  3HPW A;  2JZ2 A;  2WSC E;  4M7D B;  2RHZ A;  1MGQ A;  4MDW A;  1Q86 C;  4LDU A;  5J39 A;  5LJ5 d;  4ME7 A;  4JJN K;  4L5G A;  2KMT A;  2PVD B;  2DEQ A;  1XTD A;  2K2V A;  3HRU A;  2LRQ A;  1JBM A;  1HK9 A;  4FT2 A;  3NTH A;  4DQ2 A;  3GNG A;  1VQN T;  2QA4 T;  1QVF A;  4M7D F;  2QI2 A;  3CD6 A;  2EIF A;  2LDM A;  4JRP A;  4JRQ A;  1BI2 A;  3C12 A;  3M55 A;  4VUB A;  4M7A B;  3INZ A;  4OVA A;  1KG1 A;  5DLO A;  4F7U G;  2E6Z A;  2QQA A;  3CCU T;  1QVF S;  1BI1 A;  1Y96 B;  3QO3 A;  2DJZ A;  1YJN T;  2RI5 A;  4PLL A;  4C8Q D;  4N0A A;  3SDZ A;  1WJR A;  1I4K 1;  2RJC A;  4PNO A;  2XK0 A;  4GLK A;  4XU3 A;  2WAC A;  3OYY A;  1UGS B;  5GMK m;  3OBW A;  3VYG A;  1WQW A;  4JS5 A;  5A0D A;  4J7I A;  4C92 A;  3RKX A;  2PVO B;  1U1T A;  2BIV A;  4ATO A;  3CMA T;  4IKF A;  4MDX A;  4PJO E;  2R5A A;  2X4W A;  5GAN 4;  1M90 U;  2EKO A;  3L1A A;  1PSE A;  3SWN C;  4BUG A;  4XTX A;  4PJO C;  3CXC S;  4EMH A;  3OYB A;  4DA4 A;  2K57 A;  2V8J A;  3CC2 A;  3JSC A;  4M7A A;  4PJO F;  1QVG A;  3FLG A;  4QQD A;  3OQ5 A;  1N9R A;  1K73 C;  3Q1J A;  2JNG A;  4BI8 B;  5CIU A;  2MF2 A;  3OYL A;  3TU4 K;  1KC8 C;  2ZPB B;  4X9D A;  4IUP A;  3V8J A;  3NTI A;  3VYH B;  3TEE A;  3QYH B;  3V7C A;  2EQM A;  1YIT T;  5GAN f;  1GXI E;  2RD1 A;  4M7D A;  2E64 A;  4IUU A;  4OB1 B;  4L59 A;  3JCM P;  2CKK A;  1YJN A;  3BFM A;  2EJ9 A;  2KAF A;  4EPC A;  2R5M A;  4HT9 A;  4ZN1 A;  2CZ7 B;  3BY7 A;  5IT9 E;  4FM4 B;  4M78 C;  1VQ9 T;  2K5F A;  2DVE A;  2E70 A;  3HHT B;  4OB0 B;  2RHI A;  4XTV A;  3I55 A;  5FU6 B;  4M7A F;  1U1S A;  3FEO A;  1YJW A;  3CXC A;  4KUL A;  2JN0 A;  1K8A U;  3URG A;  1R8O B;  1LOJ A;  3FIF A;  4O5V A;  3J80 E;  5CKF A;  1WQ7 A;  4JLG A;  4Q5W A;  3OYN A;  1VQ5 A;  2PUO B;  2F69 A;  4ZGD B;  1Y07 A;  2XDP A;  3JB9 G;  5DY9 A;  1VQP A;  3E19 A;  2LQK A;  2XD0 A;  2HQE A;  5LJ3 f;  4M78 F;  2XG8 D;  5LJ3 g;  5GAM j;  3PMT A;  4Z02 A;  4QVD A;  3OS0 A;  1XNI A;  1NJI C;  3HSB A;  3PNW C;  2L3R A;  2VYT A;  4XTW A;  2LT1 A;  3QXE B;  4L6V 5;  3VUZ A;  4E7K A;  1YIJ T;  2L89 A;  3SD4 A;  3HKS A;  1I8F A;  2K3Y A;  4JRK A;  2E1H A;  3CBM A;  4M77 A;  4M78 G;  2CYZ B;  4EDU A;  3I56 T;  1VQ6 T;  2E10 A;  3M53 A;  3E1S A;  4LD6 A;  3TCJ A;  3I56 A;  1VIE A;  3CC4 A;  2P0K A;  4OB2 B;  3GF5 A;  5KH6 A;  2M0O A;  5FU7 B;  3MEU A;  3JCM e;  3OYM A;  1S72 A;  3E9F A;  5D6X A;  3S3N A;  5I2S A;  3M4Y A;  5LJ3 h;  4E7J A;  3CCR T;  2M1H A;  1VQM A;  5I2M A;  3CPW A;  3QHS A;  3VKI A;  1N9S A;  3C95 A;  2ZPE B;  5CVI A;  1W2B A;  1VQ7 T;  1AHJ B;  1IZ6 A;  4M78 B;  4BE1 A;  5LJ3 j;  2X4Y A;  1IRE B;  2JUF A;  2H3J A;  1QP2 A;  3CC7 T;  1VIF A;  2DZC A;  2YHT A;  3H8Z A;  3JB9 I;  3L2Q A;  4P5N A;  4DOW A;  1M1G A;  5IN1 A;  2DD5 A;  2PVG B;  3R6O A;  4EMK C;  1O9S A;  1YI2 T;  4V2S A;  3WXM B;  2EJF A;  2QQR A;  3F70 A;  4J83 A;  5EG2 A;  1WGS A;  3V7S A;  3ZBD A;  4C8Q G;  1LNX A;  2K5L A;  4PLI A;  4OP0 A;  4BI4 A;  2FL7 A;  1VQO T;  3CCV A;  2D6F A;  5GAN 5;  2XHC A;  3PTA A;  2A7Y A;  5GAN d;  3CPW S;  1VQ6 A;  2VGM A;  2PU9 B;  4J7F A;  5GAN 7;  3CBO A;  4QQ6 A;  1KQ1 A;  3CMA A;  2DAQ A;  4JS4 A;  2P4T A;  5KCH A;  3M59 A;  1QW1 A;  3QBY A;  3JAM E;  3QJ6 A;  2I2L A;  2K4Y A;  4MMK A;  1JJ2 S;  4M7A E;  1D3B A;  2DD4 A;  2CS7 A;  4JUV A;  4M77 D;  2K3X A;  4F7U B;  5GAM h;  3UDC A;  1VQ7 A;  4M77 G;  4CI0 C;  3P8H A;  4X34 A;  4B9X A;  4A4F A;  3VV0 A;  2VV5 A;  1YBY A;  2IG0 A;  1FWZ A;  4IUR A;  3VU3 C;  1UB4 A;  1Q82 U;  4PL6 A;  3DB4 A;  4JRI A;  4IUT A;  4J6X A;  5LJ5 j;  3MCA B;  4N0A C;  2ZPI B;  3PT9 A;  1VQN A;  1Q81 U;  3CCM A;  5FU7 C;  3OS2 A;  1FXX A;  4M75 C;  4QQG A;  1OZ2 A;  4XU2 A;  5D6Y A;  4NL2 A;  3ER0 A;  3RES A;  4O6J A;  1EIF A;  2DK3 A;  2DXB A;  3L2Z A;  3MP6 A;  4BB7 A;  1KD1 U;  3MET A;  5GAM g;  5GAN e;  3LW5 E;  3SWN A;  3M56 A;  3VUB A;  3GP8 A;  4PJO A;  4HKE A;  4TVR A;  4EMK B;  1YJ9 T;  5KE3 A;  3S3M A;  1U8R A;  2L8D A;  4ZGE B;  2FYK A;  3LGL A;  5FRN A;  2O4X B;  2XI9 A;  4M7A D;  5DM7 R;  3CCR A;  4KUI A;  1K73 U;  2EQK A;  1HXD A;  1VQM T;  4HT8 A;  5AYF A;  2V8K A;  2GCX A;  1BIB A;  2HNI A;  2M9U A;  4J8O A;  5CKB A;  4KBM B;  4F7U F;  5LJ5 e;  1Q86 U;  3OY9 A;  2OTJ T;  4FIB A;  1N6A A;  4XTY A;  5A0L A;  2VUB A;  2QTX A;  1N8R U;  3WVE B;  1M1K U;  4LDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...