2RK1A

Dhfr r67 complexed with nadp and dihydrofolate
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a type II dihydrofolate reductase catalytic ternary complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase type 2
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rk1A00
2GQVA 2RK2A 1VIFA 2P4TA 2RH2A 3UDCA 2VV5A 3T9NA 3SFMA 2RK1A 1VIEA 2OAUA
chains in the Genus database with same CATH superfamily
1YHQQ 1WA7A 4GLMA 3G4SQ 2KSSA 4XU0A 3VS6A 2YUNA 2ED0A 4A53A 3UATA 1I8FA 2DERA 1QP3A 1MV3A 1PWTA 1SRMA 2FO0A 3MPUB 1EIFA 3VS3A 4PJOC 1R0BG 2XDDA 5GAMf 1HYOA 3ZL7C 5GANd 1TS9A 1NPRA 4DOWA 4C8QB 4EMKB 2QI2A 3SHWA 2J6KA 4C8QG 2DNUA 2EIFA 2PUOB 3S3NA 1VIEA 4RTUA 1HJDA 3MP1A 2M02A 2EGCA 2CZ7B 9ATCB 1JO8A 1GFCA 2Y90A 5LJ3h 2RO0A 3S3OA 2YRCA 5FU6B 1F1BB 3A8OB 1YWPA 2WACA 2LT4A 1M3CA 2L2PA 3QHSA 3RMQA 1U3OA 2CS7A 1LPLA 3GNGA 2DETA 2QA4A 2M51A 5GAOm 1FWZA 2LMJA 1VQPQ 2Z0WA 3REBB 1QCNA 1KSWA 2LCSA 1WPYA 4LN2A 3HRUA 1Y57A 2GNCA 3TU4K 2E41A 2KRMA 3TQ7P 2O01E 1ACMB 3CCJT 4FW1A 4CRIA 2VXEA 3X26B 1VQLQ 2RJDA 3OYFA 3M59A 3MEVA 4AFZC 2JVVA 1NG2A 3H9NA 2CP3A 1AZEA 2GF7A 2R5AA 4KT0E 1ZUUA 1M4ZA 1M3AA 2D0NA 2RJFA 1K9MR 2QGGA 1VQNT 3A8HB 2GTJA 4RTTA 4FT4A 5DLOA 2LCLA 4CC7A 4RMOA 3R6NA 2CSQA 4E7IA 1VQOQ 1VQ7A 3JCMJ 1VQ6T 2AHJB 3RIRA 3G6ET 3CC7A 2QASA 3CCLQ 5FRNA 4J7FA 2VKNA 2ESWA 2F2XA 4F16A 3BDUA 3M0QA 1TOVA 4Y28E 4E7KA 1FYNA 5D7UA 2RQWA 3OYEA 4BE1A 1BI1A 3HKSA 3RNJA 4E7JA 2C0OA 2L3PA 4RG8A 2A7YA 3E19A 4J9DA 1D3BB 4M75G 3CCMA 1YJNA 2O9VA 1ZA1B 2KVQG 2K2VA 1KD1U 3LWIA 2DFUA 2J05A 3CMEQ 2NWMA 2DZ9A 3LW5E 2D9TA 4J5YA 2DILA 4DBRA 2QXFA 2K7AA 1M30A 2DL7A 4F04B 4PJOF 1BU1A 2V1RA 1W1FA 2DL4A 1PSFA 2RQUA 2VC8A 1M2OA 1WHLA 3OYBA 1NLOC 4R0KA 4M7AD 1PG5B 2IPOB 1K9AA 2XIDA 2LNVA 3CCQT 4KULA 3R6OA 3CMAQ 3JCMf 4AG2C 3VJPA 1I5OB 1XNIA 2RNAA 3OYJA 1Y71A 1X6GA 1NZ9A 3OW2S 2EJFA 2MWOA 4L5GA 2KXDA 2QA4Q 4JS4A 3THKA 1WXUA 2EYYA 3VS5A 4E7SA 1BIAA 4X1VA 4JJCA 5KYNA 3QO3A 3ME9A 4PK4A 5IN1A 4ANJA 4HKEA 1GBRA 1B7TA 2E3IA 1S72Q 2E65A 2KBTA 2ZAEA 4M78F 1HD3A 1UE9A 3AHUA 3QKJA 2C06A 1MMGA 1M9SA 1MMDA 2OTLQ 4PLLA 3MO8A 4OVAA 4KBMB 2R58A 2V8KA 8AT1B 3HRSA 4A4GA 3C95A 3JCMg 1TH7A 2JOYA 2E10A 5GMKi 4C92E 3EFSA 1DJ7B 4NL3A 1OOTA 2V1QA 1T0JA 3M5AA 4J9FA 4IKFA 1H8KA 1JXMA 4BY6C 3JCMW 1UHCA 1YIJA 1UHFA 1M5Q1 1JXOA 1N9SA 3QIIA 3FRNA 2DBKA 4HVVA 5GANg 2VASA 4KUIA 5HK3A 1OEBA 2YT6A 2K5IA 1K73U 2EVRA 5KE3A 2VUBA 5LJ5f 3CC4A 4LD9K 4M75D 5DM7R 1VYTA 2IVWA 3P8HA 1GL5A 3C12A 2M1HA 4L6V5 1QW1A 2DM1A 1QQJA 1UGRB 3FLGA 2MOXA 3LX7A 1SKUB 2JNGA 4EDUA 5LJ5d 3OB9A 4DEXA 5GAN3 1SG5A 5FU6C 4M77F 3TSWA 5HCKA 1IRXA 2FPFA 3L2UA 1AD5A 2LQ8A 1PRMC 2DPPB 2CGHA 1YHQA 1KC8U 2LQKA 4OMNA 4ORZA 4IUQA 4E7ZA 1CSKA 4J9BA 4XTZA 3PIPA 4QQGA 1TTHB 3GOXA 4HT9A 4DBFA 1ZSZC 5GAOn 4ATOA 1K4US 2RM4A 4OB2B 3M9QA 2WSCE 1VQLT 3RUXA 2CH4W 3KFVA 2L3QA 3CXCA 1QVFS 2GFAA 2J6FA 2OTLT 1VQ4T 3EG0A 3QWYA 2XICA 1U1SA 3ULRB 1X69A 5FU7B 3GIBA 2VYTA 4N4IA 4MMLA 1VUBA 2QGFB 2YXYA 4AFUC 1IHWA 2HL5C 4JRIA 1AEYA 1EX4A 1PHTA 4PKCC 3J81E 3ASKA 3C4SA 2GTOA 1GXIE 1YIJQ 2ZPIB 4M7DC 2YRVA 1NEGA 3CQTA 2OTJA 2YWWA 4J6XA 2VGNA 1G2BA 4CC4B 4A4EA 1UJYA 3CXCP 4BD3A 5IAYA 1W2BA 3E9FA 2ATCB 4IURA 1E7OA 3H6ZA 1WXTA 1QMCA 2AIRB 1G83A 1P92A 1SRLA 5EG2A 2KNBB 2PU9B 1Y96A 1ZUKA 1YP5A 2VGMA 3UF4A 1WJSA 1X2QA 4QVDA 2V26A 1YIJT 1ZA2B 3V8KA 4PJNA 1SHFA 4J83A 2F69A 4ZN1A 2QEXA 2PVOB 3MEAA 2ZPHB 3CC4T 1PD1A 2FZKB 1VQPT 2HD0A 2KRSA 3EAEA 1FX7A 4YTLA 4LXCA 2ZZDA 2HL3A 2JTFA 1WQ7A 2KAFA 3EG9A 4M75C 2K9GA 2AKLA 2HSPA 3LGFA 1VQMT 4JRPA 4J6YA 4OGCA 4M7AB 1UEBA 2ZPFB 2COWA 3ZFJA 1UJ0A 1PKSA 1WI7A 4PJLA 1M1KC 4XTXA 4OP0A 5J39A 4M7AG 2DE0X 2OTLA 1T3LA 1W4SA 5FLXE 1BYMA 2HZYA 3CCVA 4BI8B 1XQHA 3CCQQ 1LJOA 2F1LA 1GBQA 3MP8A 4QKUA 1WQWA 4NL2A 1K8AC 3H0FA 2KE9A 5I11A 5GMKl 4CC2A 3OBWA 3JAME 1RI0A 3FIFA 2QQRA 2EQJA 4A4HA 1J3TA 3MHXA 2RPNA 1Q82R 1IHVA 1SF9A 1ZSZA 4J8OA 2PZ1A 4M77C 3TSZA 1GCQC 1O75A 2LRQA 1G3WA 3M4YA 1AWXA 1AWJA 3JCMV 2QTVA 1KC8C 2DD5A 1NYGA 1FMKA 1JJ2S 2COZA 4EMGA 2DXUA 1D0YA 3GNFB 2PNIA 1VQNA 2H3JA 4J9EA 3QXEB 2GFUA 2LDMA 2W10A 4ZN3A 3OS2A 3RKYA 5GMKm 4QQDA 1X27A 2LT1A 4M7DA 4M75B 1AOJA 4C92G 3EGXB 2EYXA 3G6EQ 1QVPA 2RD1A 4KGXB 5AYFA 4XTWA 2AK5A 2JM9A 3QPHA 4WCIA 1WHMA 3PFSA 4E7HA 3VV0A 2JTEA 1HK9A 4RKUE 4GLKA 1WHHA 2EKHA 3QDFA 1KQ2A 1N8RR 4BI4A 2FL7A 4QT7A 2LCCA 5L8RE 5A2QE 4OMPA 2M16A 2DIQA 4N0AA 3JCMh 4JRQA 3IQLA 3SWNC 1G3SA 2AZSA 5KYWA 1OULA 2DYBA 3G71T 2X4XA 4Z89A 2ZPBB 3QUIA 3NTIA 3A1PA 3H0IA 2PVDB 1U8RA 4BE0A 4QVCA 3EG2A 3JB9D 5IXFA 1QKXA 1Q82U 1ARKA 4QVZA 4JUVA 3CBOA 1O9SA 1TUDA 2Y4XA 3JB9J 2C0TA 1VQ6Q 3QDRB 1SHGA 4IIOA 3QWXX 1N9RA 3CMAT 2HBWA 2DYIA 2O2OA 1KQSP 4E7LA 1VQOA 1VQ7Q 2HKNA 3LYIA 2YRDA 1M8MA 1WGSA 3CBPA 1R8OB 1RL2A 1GCPA 4EMHA 3X24B 1KD1C 1W2BP 3O5ZA 2EJGA 2F2VA 3EG3A 1NM7A 2RH2A 1N5ZA 2DXCA 1S72T 3WXMB 4M7AE 1CKAA 5KYWB 2OAWA 3QJYA 4B6MA 1D0ZA 4M77D 5CR2A 1WIEA 2J6OA 5GAMe 2GGRA 3BFMA 4XQ3A 2FRYA 2BZXA 5CKDA 5GAN5 4OMLA 2JUFA 1X01A 1Q95G 3ZEHA 4HCBA 3LH5A 3CBMA 2XMFA 1R77A 3ZBDA 4F7UB 1KHCA 2F5TX 2EQKA 3DLLA 3P8BB 3I35A 1JBMA 1OV3A 2KGTA 4LNPA 4MMKA 4AMCA 1KIKA 3X28B 3V8LA 1TWBA 4C5GA 1TU0B 1UTIA 3SDZA 1AZGB 3FDRA 3UWNA 1VQ5A 4EPCA 2QQBA 1RACB 3I9QA 1WJQA 2E70A 2A08A 2RQVA 1BIBA 2P84A 1X2KA 3JCMb 3EHQA 3JCMc 2XU8A 4M4ZA 1UB4A 2GCXA 2WSFE 2LVMA 3M53A 1NLPC 1YCSB 5CQXA 3E1SA 1WHGA 1CKBA 1YHQT 1AHJB 3G4ST 3J80E 2RI3A 2BZ8A 1K1ZA 5GMKj 2V8IA 2HQEA 3I56T 1D1CA 3VS0A 3OYAA 4J7IA 5IHIA 5CKBA 3GBQA 4OMFB 5GAMg 3CPWS 2RF0A 3RMSA 4AFSC 3OS1A 4XU3A 2VVKA 4FYVB 5CQYA 3SB2A 5GMKe 1MHNA 5KYYA 2KYMA 2DD4A 3UDCA 2O4XB 5D6WA 3NFCA 2LJ3A 2D8HA 1OZ3A 2EGAA 1UGSB 4N4HA 4ESRA 5GANe 5LJ3f 3SFMA 4PJOD 2K5FA 3VUZA 4KUDK 4DBQA 4D8KA 1IB8A 1K9MU 5HKCA 1C0MA 3VYHB 1VQKQ 4WF2A 5KYUA 4M78E 1H3HA 1Q7YR 4Z8AA 2D8JA 2DVEA 1YJWT 1ZUYA 2FEIA 2JM8A 5FWCA 3L1AA 2QA4T 2RJEA 1OQKA 2NUTB 3PNWC 2EQMA 4BUGA 1FMVA 4BB7A 1U06A 1BI3A 1T0HA 4TVRA 1KQSA 2ROLA 2QEXQ 2D6FA 5CVIA 3RDVA 3CXCS 5C6SA 2K3XA 2DMOA 1M90C 1RAFB 4BE2A 3I5RA 1ABQA 4JPBW 3E9GA 3EG9B 4X9CA 2COYA 3JB9I 1B34A 5GAN4 2A3LA 3OS5A 4VUBA 3VRZA 2RJCA 4C8QF 7AT1B 3HPWA 2JZ2A 1M8VA 4HCZA 3G6EA 3EGDA 4M78C 1YCYA 3KBGA 3M0RA 3RBBB 3VS7A 1WFWA 3OYYA 3VUBA 3CCET 1NBEB 3NGPA 2CP5A 4WTOB 3LH0A 3M56A 1IZ6A 4C92B 4C0DC 1U1TA 2KK4A 1KQSS 1BK2A 1JQQA 4C92F 2LP5A 2QQ9A 3CMEA 1M2VB 4BY6B 1Q81R 4M78G 2DIGA 1BBZA 4JDSA 2EYZA 5GJWB 1VQKA 5GANj 1AWWA 4LUDA 1Q7YU 4BDZA 4LDVA 2QAZA 5KYXB 1QLYA 4IUUA 3L2WA 3QG1A 1PNJA 2LJ1A 1NJIC 2AT1B 2MYSA 1YNZA 2YHTA 1E6GA 1YJ9A 2NYSA 1SPKA 4D8DA 5I2SA 2KYBA 1HSQA 4K11A 5KCHA 4J9HA 3I55Q 2HCKA 1MMNA 3DLMA 1XTDA 3JRZA 3REAB 1VQMQ 3G71Q 5IHKA 3HHTB 1BCOA 2NUPB 4HVUA 2M0YA 3SEMA 3OYKA 2KY9A 2RQRA 2NUTA 1BI2A 2KQWA 4KGVB 2EQUA 4FL6A 2DZCA 4M7AA 3G1JA 5KCOA 4IUVA 1VQ9Q 3OMCA 1MMAA 3CCRT 1VQ7T 1YITT 4LDWA 4FIBA 5A0LA 2DXBA 3PMIA 1N6AA 1FXXA 4OMOA 2LX7A 1GFDA 5CKFA 3JCMd 2CUDA 1NYFA 5KYXA 1RAAB 3INZA 2RI5A 3L2ZA 2X3XD 3V8JA 2E3HA 2A0FB 5DLQE 4L59A 2RK2A 3PMTA 3CCMQ 2FPEA 4LDYA 1YJNQ 3J7AF 1QP2A 4XU2A 3CPFA 1OZ2A 4M78A 4NOYA 3CCLA 1VIFA 3EH2A 1VQ9T 2BZYA 3VRYA 2CZ0B 3BW1A 4M7DD 2DL3A 3HTRA 4HA8A 5DY9A 1OI1A 2EYQA 2IIMA 3FJPA 2BIVA 1PKTA 5LJ3e 5CKEA 3S3MA 2FG0A 2JS0A 3M57A 1Y07A 1RAHB 1RAGB 4F7UG 3URGA 1ABOA 3CMAA 1QCOA 1YJ9Q 4MZTA 2QDLA 2HDAA 2DTOA 1BB9A 1VQOT 4JRKA 2IG0A 2EKOA 2X3WD 3H8ZA 3CCMT 1YJNT 2RHZA 1IGUA 5I2MA 2KEAA 4M75E 1WHJA 2CUBA 3PVQA 1TUGB 3M0PA 2HNIA 1AVZC 4O6JA 5CK9A 2RA2A 5GAN2 3M58A 3QZ5B 4ME7A 1YJ9T 1PCXA 4O5VA 1M27C 4AT1B 2X51A 4RTWA 3C0CA 4FU6A 4E47A 2E6NA 3CCQA 4C8QA 2X9HA 3V7RA 4B9XA 1G5VA 3HL8A 3CCEQ 2L3SA 3TREA 2J7IA 2LQWA 3CCJA 5LJ5e 1UDLA 1K8AU 2K57A 1YI2A 1YJWQ 1JEGA 2B8AA 2R57A 1W70A 1WDXA 3FB9A 5LJ3j 3HFNA 2A36A 3I5SA 1WX6A 2BE9B 5I21A 3LLRA 1VQ5Q 2QG9B 1I0CA 3CCSQ 3DB4A 1S1NA 2EBPA 3JCMX 2PVGB 1ZSGA 4M75A 3VS1A 4C8QE 4A63B 1VQ6A 5ECAA 3PE0A 2L89A 1PC0A 4MDXA 1UECA 4XTVA 1OX8A 2FB7A 5GJVB 3QBYA 4F17A 3NTHA 2HEQA 4EMKC 3JB9H 2W0ZA 2JMCA 3HFOA 1G3TA 4E2FB 1VQ8T 2L0AA 3WVEB 1RAEB 3CEYA 2AKKA 4PL6A 1UGPB 1M90R 4R56A 4OB3B 4OF1A 2DXTA 4ZTJA 2ZGWA 1GCQA 3CCJQ 2EWNA 1RLQC 2E12A 4R55A 1QVGS 2JTMA 4FCYA 3CC4Q 1VA7A 1IREB 3MKDA 4C92D 3G71A 2PTKA 5AT1B 5GAOq 3QJ6A 5IHNA 3KUFA 3AT1B 3CCSA 4V2SA 1JB0E 4Y91A 3S6WA 1RABB 3I56A 1T3SA 4HT8A 3OYIA 4Z88A 3I55T 3JCMQ 2DF6A 1VYVA 1PRLC 1MV0B 3FC3A 3SWNA 1B34B 1V1CA 2BUDA 3EG1A 4J9CA 1YI2Q 4C8QD 2A37A 4A54A 3FEOA 1K8AR 5L23A 2HKQB 3WVDB 2G3RA 4F7UF 1IXDA 4DEYA 3OA6A 2DJQA 4QW2A 2RB6A 4A4KA 1KFZA 1D3BA 1OX9A 2BE7D 2F5KA 4C92C 1YFNA 4C0GA 2X4JA 3L2RA 2O4XA 3EFRA 3UA6A 3CCUT 2XKOC 1QCFA 5GAN6 1H92A 2JN0A 2CDTA 2PUKB 5A0GA 2SRCA 2JJ9A 2RQTA 2GQVA 1X75C 3EFOA 1RLPC 3QSUA 3PTAA 1YITA 1QKWA 1UUEA 2X4WA 1PM3A 4ZGEB 1G3YA 1N8RU 2MMPA 3A8MB 3A8LB 1VQLA 1AT1B 4JZ4A 2JMAA 3OW2A 4M77G 4OB0B 2XHCA 1YWOA 3OYGA 3MEWA 2ED1A 3SWNB 3UPUA 5FW9A 1ZBXA 2E5QA 3JV3A 4P5NA 4PFZA 4C5IA 1D1AA 4X34A 2H3EB 2L3RA 2FRWA 4N0AC 1Z9ZA 3BDLA 1VQ5T 4DBHA 3M0TA 3CC2A 2MF2A 2NUPA 5A0DA 2HAXA 3GP8A 5GAN8 2MWPA 1MGQA 2O9SA 4M7DF 1JRIA 1PD0A 4M7DE 3CCEA 2LQNA 5LJ5j 2LX9A 2RI2A 3NMZC 4HCKA 3MEUA 5LJ3d 4PJOG 4XTYA 2K2MA 1QVGA 2CREA 4M7AF 1KG1A 4J9IA 1SEMA 1XOVA 2CP2A 5IXBA 2FYKA 2OJ2A 3HP9A 3A5ZB 3RERA 1C6VX 3PT9A 4BACA 1EZZB 1ZBJA 2C0IA 2LC4A 3C94A 2DK3A 1H3ZA 4X9DA 3PGGA 2YLCA 3P8DA 5KH6A 1M2VA 3TEEA 3CCVT 1K0XA 2DVJA 2DRMA 2KRNA 3MCAB 3CCUA 2DEUA 2G6FX 3SD4A 1M1KU 1KD1R 1C1AA 3GPLA 2OTJT 2EPDA 4M77A 3I55A 1FMWA 4JJDA 1UGVA 5FROA 5GAMd 5GANh 4GY5A 2VV5A 3T9NA 4PNOA 2FHDA 2MI6A 4IUTA 2X4YA 4KH1B 1TXQA 4JLGA 4XU1A 3M4GA 4C5HA 4OB1B 4DQ2A 1TG0A 2D1XA 5HY6A 5LJ5g 5GMKh 1XJWB 2P0QA 3CPWA 1WZOA 1Q86C 3G7ZA 4FYWB 3OYDA 4RTVA 2DAQA 2O31A 2MCNA 2K3BA 5CIUA 3U23A 4RG2A 2FPDA 1VQ8Q 4IIMA 3D7SB 5J3BA 2DX1A 1YJWA 4KH0B 2YUPA 2ENMA 2CSIA 1NPPA 1UGQB 2FVUA 2MPXC 4PFPA 1KK7A 4PFOA 1I1JA 3PVLA 2RHYA 4LE9A 1Y0MA 5J26A 2L8DA 3A98A 4JJNK 3FJ5A 5LJ5h 4PJMA 1Q86U 5I22A 1D0XA 4HCCA 2QYZA 2EGEA 4MZPA 3VS4A 1QWEA 4DA4A 4IUPA 4J9GA 3JB9F 3OYHA 1W2BS 2DTHA 1MNEA 1OU9A 1VQKT 2A28A 4Z02A 4M7DB 2SEMA 3X20B 3LWHA 3TCJA 1M1KR 2OTJQ 1MNDA 4HVWA 2DO3A 3M54A 2RN8A 3EHRA 4DOVA 4CI0C 3NPFA 2BKDN 4A4FA 4JS5A 3G4SA 2EFIA 1K73R 4FSSA 4OMQA 4EIKA 3DKMA 1OPKA 5CO7A 2K6DA 2JT4A 3V7CA 5GAOp 3BE3A 1WYXA 2I2LA 2J06A 3CCRQ 4MDWA 4M7DG 2M0OA 1TSFA 5FRMA 1VQ4A 2CZ6B 1W6XA 3CD6T 5HK0A 4RTYA 1Z9QA 2E6ZA 1LOJA 3JCMP 1S72A 2K79A 4AFQC 2YLBA 2LTOA 4FM4B 1ZQ1A 3E2UA 1UG1A 1OU8A 2O88A 1KC8R 1Q7YC 2CKKA 2FZGB 3CPWP 4RUGA 4XK8E 1WHKA 3HSBA 3VS2A 2KDSA 5LL6S 1LNXA 2JS2A 1NE8A 3OS0A 2LNHB 2HQXA 2QTXA 5FWBA 2E4HA 2MIOA 4OMMA 4ZTFA 4F7UE 2CP0A 3L2QA 1I5LA 3RKWA 4AG1C 5IT9E 4RCCA 2VWFA 1Q86R 2OAUA 4PJJA 4Y92A 4RTZA 3PIOA 5GAOl 1UFFA 1ZSZB 4F7UA 4E6RA 3JB9G 3CCLT 4D6WA 1ZHIA 4BI3A 2HMAA 3QZ9B 3VKIA 2QEXT 1VQNQ 1G8XA 4II1A 1KJWA 1IO6A 3N5BB 1PSEA 1AWOA 2CT4A 3OSSC 3UA7A 4C0ZA 4C5EA 1BKBA 1M1GA 5M9OA 4EMKA 1JJ2A 1Q81U 1WLPB 2WSEE 3DB3A 2DL8A 4C92A 5GAOr 1VQ9A 3EFOB 1RI9A 1QVFP 3EGUA 5CAIA 1V76A 3RR6A 3MJXA 3EGXA 1BI0A 4FT2A 3V7SA 3L42A 1QVGP 1ZLMA 5LJ3g 2HBPA 2RMOA 1A0NB 1QWFA 1YN8A 4FW2A 2CT3A 1NEBA 3RKXA 3GLXA 1ZX6A 3OYCA 4ZGDB 2ROTA 2F2WA 2KT1A 2RK1A 1D09B 3OYNA 2LZ6B 2ZPEB 2QQSA 2XI9A 3CD6A 2EQIA 1VYUA 3O8VA 2VB6A 5KYUB 1SSHA 1K76A 2ABLA 2KR3A 1D1BA 4OGEA 2P4TA 2EAYA 2B86A 3JCMe 3OY9A 3M0SA 4F14A 4XTUA 1N27A 1I81A 1V29B 2EW3A 1YITQ 2DL5A 2KXCA 3F70A 3VYGA 4M78B 1B3QA 1X6OA 3OW2P 2EYWA 1HXDA 2DEQA 4FYXB 4FSXA 2YSQA 3OYLA 3OMGA 5D6YA 2QQAA 3H41A 1LVKA 4RCBA 5D6XA 2DLPA 4JLIA 2KT8A 4C0FA 4KGZB 3EH1A 4ZNXA 3VU3C 2DJZA 1KQ1A 2FZCB 5GAN7 4B9WA 1RADB 3NHNA 1NJIU 5KE2A 2ZPGB 3BY7A 1KHIA 1K9MC 3CC7Q 4N4GA 2Y4YA 3CC2Q 2NUZA 1X43A 3Q1JA 4MZMA 1U5SA 2KI7A 3KXTA 1JU5C 3OYMA 4UC4A 2NLUA 2YUQA 2H8HA 1RUWA 4FYYB 4PJOB 4JZ3A 1YI2T 3ER0A 5CKHA 1B07A 3LGLA 4RTXA 4QQ6A 2CP6A 1Y96B 5EC7A 1N8RC 2LJ0A 4GBQA 4C8QC 3MP6A 3CC2T 1E6HA 2E5KA 2XK0A 4J6WA 3I56Q 1M1FA 1VQ8A 1YBYA 4PLIA 3CC7T 2DBMA 1VQPA 3OQ5A 1H641 1VQMA 3EGDB 1MUZA 2KMTA 5IH2A 2OI3A 5FU7C 1QVFA 1BCMA 1M3BA 5GANf 2CZ1B 2CH4A 2QK0A 4LDUA 1JJ2P 2HQHA 4M77B 3NTKA 3CCUQ 2VXFA 2ZCFB 3RESA 5C0MA 2ECZA 4ELYC 2RHXA 3OBYA 2E64A 4M75F 2JW4A 1Q81C 5GAMj 1WNLA 3HRTA 2I0NA 2BTTA 1OPLA 1I4K1 2XD0A 5GAMh 2K3YA 2KROA 4LUEA 4M77E 5KYYB 3QYHB 3X25B 3TVTA 1WJRA 5CCAA 1NJIR 6AT1B 1Y7XA 2OX7A 2PQWA 2YUOA 1K73C 1K0SA 1LCKA 1VOMA 3CCST 2P0PA 3CMET 1SSFA 2MAMA 3A8GB 4CC3A 2RHIA 2V8JA 3META 2K4YA 3M55A 1EFNA 2K5LA 4C0DB 2P4RA 1IGQA 4HXJA 4ELZC 3JSCA 2DKGA 3M0UA 2D0QB 3GF5A 1I07A 1VQ4Q 4JJBA 2P0KA 4M78D 2E1HA 2XG8D 3CCRA 1TUCA 1X6BA 1Q82C 1M90U 2M9UA 4PJOE 2R5MA 4Q5WA 1WXBA 2L5QA 2CYZB 4M7AC 4BDYA 2DRKA 4XAXB 2JXBA 3CD6Q 3CCVQ 4LD6A 2CP7A 4PJOA 1OYXA 3OSVA 3QYGB 3UT1A 4LDXA 4KRTA 2HSEB 4NS5A 2X35A 1GRIA 2QDYB 2AZVA 2YDLA 1R0CB 3H0HA 2MK5A 2DA9A 2DTIA 2EJ9A 2XDBA 2XDPA 2GQIA 3L2VA 2RHUA 2GBQA 1RAIB 8ATCB 4ZGJB
chains in the Genus database with same CATH topology
5J39A 4M7AG 2OTLA 1W4SA 4RG2A 5FLXE 1BYMA 2KSSA 3CCVA 4XU0A 4BI8B 1XQHA 1XTDA 3DLMA 3JRZA 1LJOA 5J3BA 3MP8A 1WQWA 4NL2A 1K8AC 4A53A 3HHTB 5GMKl 1YJWA 1I8FA 3JAME 3OBWA 1RI0A 3FIFA 2QQRA 3OYKA 1QP3A 2EQJA 1NPPA 1UGQB 2FVUA 2KY9A 1BI2A 2KQWA 4A4HA 1EIFA 4PJOC 2RHYA 2XDDA 5GAMf 2EQUA 3MHXA 4FL6A 5GANd 2DZCA 5J26A 4M7AA 5KCOA 2L8DA 4J8OA 4M77C 4IUVA 1NPRA 3OMCA 4JJNK 4DOWA 4C8QB 4EMKB 5LJ5h 2QI2A 3CCRT 1Q86U 1VQ7T 1O75A 2LRQA 1G3WA 3M4YA 4HCCA 1YITT 4LDWA 4FIBA 4MZPA 3JCMV 5A0LA 4C8QG 1KC8C 2DD5A 2DXBA 3PMIA 1N6AA 2EIFA 2PUOB 1FXXA 4DA4A 4IUPA 3S3NA 5CKFA 3JCMd 1VIEA 1JJ2S 3JB9F 4EMGA 3MP1A 3INZA 2DXUA 3OYHA 2RI5A 3L2ZA 3V8JA 3GNFB 5DLQE 1W2BS 2CZ7B 1VQNA 4L59A 2DTHA 2RK2A 3PMTA 4LDYA 2H3JA 2Y90A 5LJ3h 1VQKT 2RO0A 3QXEB 3S3OA 3J7AF 1QP2A 2GFUA 4XU2A 4Z02A 4M7DB 5FU6B 3CPFA 1OZ2A 3A8OB 2LDMA 4M78A 4NOYA 3X20B 3RKYA 4ZN3A 3TCJA 3OS2A 5GMKm 1VIFA 2DO3A 3M54A 4QQDA 2WACA 2LT4A 1VQ9T 4DOVA 3QHSA 3RMQA 4CI0C 2CS7A 2CZ0B 3BW1A 3GNGA 4M7DD 2BKDN 2LT1A 4A4FA 4M7DA 2QA4A 4M75B 4JS5A 4C92G 3G4SA 4HA8A 5DY9A 2EFIA 1OI1A 2EYQA 5GAOm 1FWZA 1QVPA 3FJPA 3DKMA 5CO7A 3V7CA 2BIVA 2RD1A 5GAOp 2I2LA 5LJ3e 1WPYA 5AYFA 4XTWA 5CKEA 3S3MA 3HRUA 3QPHA 3M57A 4MDWA 3TU4K 2E41A 4M7DG 2M0OA 3PFSA 5FRMA 4LD9K 1Y07A 4E7HA 1VQ4A 2CZ6B 3VV0A 2O01E 3CCJT 4F7UG 3CD6T 5HK0A 3URGA 1HK9A 2E6ZA 4RKUE 4GLKA 4CRIA 2VXEA 3CMAA 1KQ2A 3X26B 1LOJA 4MZTA 3JCMP 2RJDA 4BI4A 1S72A 3OYFA 3M59A 2DTOA 3MEVA 2FL7A 1VQOT 4JRKA 2LCCA 2IG0A 2JVVA 2YLBA 2LTOA 2EKOA 3H8ZA 5L8RE 3CCMT 1YJNT 1ZQ1A 2GF7A 2M16A 2R5AA 2DIQA 4FM4B 4KT0E 5A2QE 4N0AA 1M4ZA 2RJFA 2RHZA 3JCMh 4JRQA 1VQNT 3SWNC 5I2MA 1G3SA 3A8HB 1Q7YC 2CKKA 4FT4A 3G71T 2X4XA 5DLOA 4M75E 2LCLA 4XK8E 3HSBA 2KDSA 5LL6S 4RMOA 4E7IA 1LNXA 2HNIA 2ZPBB 3QUIA 4O6JA 1NE8A 2AHJB 3NTIA 3OS0A 5CK9A 3JCMJ 3RIRA 3G6ET 2HQXA 2PVDB 2RA2A 3CC7A 1U8RA 3LWHA 2QTXA 5GAN2 4QVCA 4BE0A 5FRNA 3M58A 3QZ5B 4ME7A 4J7FA 3JB9D 1YJ9T 4ZTFA 4O5VA 1Q82U 4F7UE 4QVZA 3L2QA 1I5LA 3RKWA 3BDUA 4FU6A 4JUVA 4E47A 3CBOA 4RCCA 5IT9E 2E6NA 1O9SA 4Y28E 2OAUA 4C8QA 3CCQA 2Y4XA 3V7RA 4E7KA 3JB9J 3QDRB 4B9XA 3PIOA 3HL8A 1G5VA 3OYEA 5GAOl 4BE1A 1BI1A 3TREA 4F7UA 3HKSA 3CCJA 5LJ5e 1N9RA 3JB9G 1K8AU 3CCLT 4D6WA 2K57A 1ZHIA 4E7JA 1YI2A 3CMAT 4RG8A 2A7YA 2B8AA 4BI3A 3E19A 2R57A 3FB9A 5LJ3j 3QZ9B 3HFNA 4E7LA 1VQOA 3VKIA 1VQ7A 1D3BB 2QEXT 3LYIA 4M75G 1WGSA 3CBPA 1R8OB 4II1A 5I21A 3CCMA 1YJNA 3LLRA 3N5BB 1RL2A 1PSEA 2KVQG 3OSSC 2K2VA 1KD1U 4EMHA 3X24B 4C0ZA 4C5EA 3DB4A 3LWIA 1KD1C 1BKBA 1M1GA 5M9OA 4EMKA 1JJ2A 1Q81U 2WSEE 3JCMX 3DB3A 4C92A 2EJGA 2PVGB 2DZ9A 3LW5E 4M75A 4C8QE 5GAOr 2D9TA 1VQ9A 4J5YA 5CAIA 1VQ6A 2RH2A 2L89A 2QXFA 2DXCA 1BI0A 4FT2A 1S72T 3V7SA 3WXMB 4M7AE 3L42A 4PJOF 4MDXA 4XTVA 2FB7A 3QJYA 5LJ3g 2HBPA 3QBYA 1PSFA 2VC8A 4M77D 5CR2A 3NTHA 5GAMe 3OYBA 4EMKC 3JB9H 4M7AD 3HFOA 1G3TA 1VQ8T 3RKXA 3WVEB 3GLXA 2XIDA 2LNVA 3CEYA 3CCQT 4KULA 3BFMA 3R6OA 4PL6A 4XQ3A 1UGPB 3OYCA 3JCMf 5CKDA 4ZGDB 3VJPA 5GAN5 1XNIA 1X01A 2JUFA 4R56A 3ZEHA 3OYJA 4OB3B 1Y71A 4OF1A 2DXTA 2RK1A 4HCBA 1NZ9A 4ZTJA 3OYNA 3CBMA 3OW2S 2ZPEB 2ZGWA 2QQSA 2EJFA 2MWOA 2XI9A 4L5GA 3CD6A 3O8VA 3ZBDA 2EWNA 4F7UB 4JS4A 1KHCA 2E12A 2EQKA 2F5TX 4R55A 3DLLA 1QVGS 2JTMA 3P8BB 1VQ6T 1JBMA 4MMKA 4OGEA 2P4TA 2EAYA 1IREB 4C92D 3G71A 1BIAA 3X28B 3V8LA 4C5GA 3JCMe 3OY9A 3SDZA 5GAOq 4XTUA 3QO3A 3QJ6A 1N27A 3ME9A 1I81A 3FDRA 1V29B 5IN1A 3KUFA 4HKEA 3UWNA 3F70A 3VYGA 2E65A 4M78F 3CCSA 1VQ5A 4V2SA 4EPCA 1JB0E 4M78B 1X6OA 4Y91A 3QKJA 2QQBA 2C06A 3S6WA 3AHUA 1HXDA 2DEQA 4FSXA 1M9SA 3OYLA 1WJQA 3I56A 2E70A 3OMGA 4PLLA 4HT8A 5D6YA 3OYIA 3MO8A 4OVAA 2QQAA 4KBMB 3I55T 3JCMQ 2R58A 2V8KA 1BIBA 4RCBA 5D6XA 3HRSA 4JLIA 4A4GA 3JCMc 3JCMb 3FC3A 3SWNA 1B34B 2BUDA 3C95A 4C0FA 3JCMg 4C8QD 1TH7A 4A54A 3FEOA 2DJZA 1KQ1A 2XU8A 3VU3C 2JOYA 1UB4A 2E10A 2GCXA 5GMKi 4C92E 2WSFE 2LVMA 2G3RA 3EFSA 1DJ7B 3WVDB 4F7UF 4NL3A 3M53A 5GAN7 4B9WA 3M5AA 3E1SA 5CQXA 1NJIU 4IKFA 3OA6A 1YHQT 5KE2A 2ZPGB 3BY7A 4BY6C 1AHJB 1KHIA 3G4ST 1K9MC 3J80E 4QW2A 2RI3A 2RB6A 1M5Q1 3JCMW 1YIJA 4N4GA 1N9SA 2Y4YA 5GMKj 3QIIA 4A4KA 1D3BA 3FRNA 2V8IA 2F5KA 3Q1JA 4C92C 5GANg 2HQEA 3I56T 4MZMA 4C0GA 4KUIA 5HK3A 3OYAA 2X4JA 3KXTA 3L2RA 3OYMA 4J7IA 4UC4A 2K5IA 2NLUA 5CKBA 4OMFB 1K73U 5KE3A 2VUBA 5LJ5f 2O4XA 3EFRA 5GAMg 3CPWS 3CC4A 3RMSA 4PJOB 3OS1A 4XU3A 4M75D 5DM7R 2XKOC 3CCUT 5GAN6 1YI2T 2JN0A 3ER0A 2IVWA 2PUKB 3P8HA 3LGLA 5CKHA 5CQYA 3SB2A 5GMKe 3C12A 2M1HA 4L6V5 5A0GA 1MHNA 1QW1A 1UGRB 2GQVA 1X75C 3FLGA 2DD4A 3LX7A 3QSUA 2JNGA 3UDCA 4EDUA 2O4XB 3OB9A 4QQ6A 5D6WA 3NFCA 5LJ5d 3PTAA 1YITA 1OZ3A 2X4WA 1UGSB 4N4HA 5GAN3 4ZGEB 1G3YA 1Y96B 5FU6C 1N8RU 4M77F 2MMPA 1N8RC 5GANe 3A8MB 5LJ3f 4C8QC 3MP6A 3A8LB 3SFMA 1VQLA 3CC2T 4PJOD 2K5FA 2XK0A 4J6WA 3VUZA 4KUDK 3L2UA 1M1FA 1VQ8A 2LQ8A 1YBYA 4PLIA 3CC7T 1K9MU 5HKCA 2DPPB 3OW2A 4M77G 3VYHB 2CGHA 1YHQA 1VQPA 1KC8U 4OB0B 2XHCA 4WF2A 3OQ5A 4M78E 1H641 2LQKA 3OYGA 1VQMA 4IUQA 2DVEA 3MEWA 3SWNB 2KMTA 3UPUA 1YJWT 4XTZA 3PIPA 5FU7C 1QVFA 1ZBXA 2E5QA 4QQGA 3GOXA 4P5NA 2CZ1B 4C5IA 5GANf 4X34A 4HT9A 3L1AA 4LDUA 2QA4T 2RJEA 4M77B 5GAOn 4ATOA 2RM4A 2L3RA 3NTKA 4OB2B 3PNWC 2VXFA 2EQMA 2ZCFB 3RESA 4BUGA 5C0MA 4N0AC 3CCLA 3BDLA 4BB7A 1VQ5T 4ELYC 2RHXA 2WSCE 3M9QA 1VQLT 3OBYA 3RUXA 2MF2A 3CC2A 2E64A 1BI3A 4M75F 1QVFS 3CXCA 5A0DA 2HAXA 2GFAA 5GAMj 4TVRA 1Q81C 1KQSA 2OTLT 2D6FA 5CVIA 1VQ4T 3GP8A 2XICA 1U1SA 1WNLA 5GAN8 3HRTA 2MWPA 5FU7B 1MGQA 3GIBA 2VYTA 4N4IA 4M7DF 3CXCS 1JRIA 5C6SA 2K3XA 4M7DE 3CCEA 1M90C 1I4K1 5LJ5j 4MMLA 2LX9A 1VUBA 5GAMh 2K3YA 2RI2A 4BE2A 2XD0A 4M77E 3QYHB 3MEUA 4JRIA 3X25B 5LJ3d 1WJRA 3E9GA 5CCAA 4PJOG 4PKCC 3J81E 4X9CA 1Y7XA 2PQWA 3ASKA 4XTYA 1QVGA 1K73C 3JB9I 3C4SA 4M7AF 1KG1A 1GXIE 3CCST 1XOVA 1B34A 2ZPIB 2A3LA 2YRVA 5GAN4 2P0PA 4M7DC 2FYKA 3CMET 2OTJA 3OS5A 1SSFA 3HP9A 4VUBA 2MAMA 3A8GB 4J6XA 2RJCA 3A5ZB 4C8QF 2VGNA 3RERA 2RHIA 2V8JA 3HPWA 3META 2JZ2A 1M8VA 4A4EA 3PT9A 4HCZA 3G6EA 2K4YA 4BD3A 5IAYA 4BACA 1W2BA 3E9FA 4M78C 3M55A 1YCYA 4IURA 3C94A 2LC4A 3KBGA 2K5LA 3H6ZA 4C0DB 3OYYA 3VUBA 4ELZC 3CCET 2DK3A 3JSCA 1H3ZA 2DKGA 4X9DA 3PGGA 2D0QB 2YLCA 3GF5A 3LH0A 3P8DA 5KH6A 3M56A 1IZ6A 1P92A 2P0KA 4M78D 2E1HA 5EG2A 2XG8D 3TEEA 3CCRA 3CCVT 2PU9B 3MCAB 4C92B 1Y96A 4C0DC 2VGMA 1Q82C 1U1TA 1WJSA 3CCUA 2KK4A 4QVDA 1M90U 1KQSS 3SD4A 2M9UA 1YIJT 1M1KU 4C92F 2QQ9A 3V8KA 3CMEA 3GPLA 4PJOE 2OTJT 4J83A 2R5MA 4Q5WA 4BY6B 2L5QA 2CYZB 4M78G 4M77A 3I55A 2F69A 5FROA 4ZN1A 4M7AC 2DIGA 2QEXA 4BDYA 4JDSA 5GAMd 4XAXB 5GANh 4GY5A 2VV5A 3T9NA 2PVOB 4LD6A 4PNOA 4PJOA 1OYXA 2FHDA 3MEAA 2MI6A 2ZPHB 3OSVA 4IUTA 3CC4T 5GANj 2X4YA 1VQKA 1VQPT 1Q7YU 4BDZA 4LDVA 2HD0A 3QYGB 3UT1A 4LDXA 4JLGA 4XU1A 3M4GA 4NS5A 4C5HA 2X35A 1FX7A 3EAEA 4IUUA 4OB1B 2QDYB 4YTLA 2ZZDA 4DQ2A 2JTFA 3QG1A 1WQ7A 3L2WA 5HY6A 1NJIC 2KAFA 5LJ5g 5GMKh 4M75C 2P0QA 3CPWA 2YHTA 1Q86C 3G7ZA 3LGFA 1VQMT 4JRPA 4J6YA 4OGCA 2DTIA 2EJ9A 1UEBA 4M7AB 1YJ9A 2ZPFB 3OYDA 2XDBA 2XDPA 5I2SA 2DAQA 3ZFJA 1M1KC 3L2VA 2RHUA 4XTXA 5CIUA 5KCHA 4OP0A 4ZGJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQV A;  2RK2 A;  1VIF A;  2P4T A;  2RH2 A;  3UDC A;  2VV5 A;  3T9N A;  3SFM A;  2RK1 A;  1VIE A;  2OAU A; 
#chains in the Genus database with same CATH topology
 1YHQ Q;  1WA7 A;  4GLM A;  3G4S Q;  2KSS A;  4XU0 A;  3VS6 A;  2YUN A;  2ED0 A;  4A53 A;  3UAT A;  1I8F A;  2DER A;  1QP3 A;  1MV3 A;  1PWT A;  1SRM A;  2FO0 A;  3MPU B;  1EIF A;  3VS3 A;  4PJO C;  1R0B G;  2XDD A;  5GAM f;  1HYO A;  3ZL7 C;  5GAN d;  1TS9 A;  1NPR A;  4DOW A;  4C8Q B;  4EMK B;  2QI2 A;  3SHW A;  2J6K A;  4C8Q G;  2DNU A;  2EIF A;  2PUO B;  3S3N A;  1VIE A;  4RTU A;  1HJD A;  3MP1 A;  2M02 A;  2EGC A;  2CZ7 B;  9ATC B;  1JO8 A;  1GFC A;  2Y90 A;  5LJ3 h;  2RO0 A;  3S3O A;  2YRC A;  5FU6 B;  1F1B B;  3A8O B;  1YWP A;  2WAC A;  2LT4 A;  1M3C A;  2L2P A;  3QHS A;  3RMQ A;  1U3O A;  2CS7 A;  1LPL A;  3GNG A;  2DET A;  2QA4 A;  2M51 A;  5GAO m;  1FWZ A;  2LMJ A;  1VQP Q;  2Z0W A;  3REB B;  1QCN A;  1KSW A;  2LCS A;  1WPY A;  4LN2 A;  3HRU A;  1Y57 A;  2GNC A;  3TU4 K;  2E41 A;  2KRM A;  3TQ7 P;  2O01 E;  1ACM B;  3CCJ T;  4FW1 A;  4CRI A;  2VXE A;  3X26 B;  1VQL Q;  2RJD A;  3OYF A;  3M59 A;  3MEV A;  4AFZ C;  2JVV A;  1NG2 A;  3H9N A;  2CP3 A;  1AZE A;  2GF7 A;  2R5A A;  4KT0 E;  1ZUU A;  1M4Z A;  1M3A A;  2D0N A;  2RJF A;  1K9M R;  2QGG A;  1VQN T;  3A8H B;  2GTJ A;  4RTT A;  4FT4 A;  5DLO A;  2LCL A;  4CC7 A;  4RMO A;  3R6N A;  2CSQ A;  4E7I A;  1VQO Q;  1VQ7 A;  3JCM J;  1VQ6 T;  2AHJ B;  3RIR A;  3G6E T;  3CC7 A;  2QAS A;  3CCL Q;  5FRN A;  4J7F A;  2VKN A;  2ESW A;  2F2X A;  4F16 A;  3BDU A;  3M0Q A;  1TOV A;  4Y28 E;  4E7K A;  1FYN A;  5D7U A;  2RQW A;  3OYE A;  4BE1 A;  1BI1 A;  3HKS A;  3RNJ A;  4E7J A;  2C0O A;  2L3P A;  4RG8 A;  2A7Y A;  3E19 A;  4J9D A;  1D3B B;  4M75 G;  3CCM A;  1YJN A;  2O9V A;  1ZA1 B;  2KVQ G;  2K2V A;  1KD1 U;  3LWI A;  2DFU A;  2J05 A;  3CME Q;  2NWM A;  2DZ9 A;  3LW5 E;  2D9T A;  4J5Y A;  2DIL A;  4DBR A;  2QXF A;  2K7A A;  1M30 A;  2DL7 A;  4F04 B;  4PJO F;  1BU1 A;  2V1R A;  1W1F A;  2DL4 A;  1PSF A;  2RQU A;  2VC8 A;  1M2O A;  1WHL A;  3OYB A;  1NLO C;  4R0K A;  4M7A D;  1PG5 B;  2IPO B;  1K9A A;  2XID A;  2LNV A;  3CCQ T;  4KUL A;  3R6O A;  3CMA Q;  3JCM f;  4AG2 C;  3VJP A;  1I5O B;  1XNI A;  2RNA A;  3OYJ A;  1Y71 A;  1X6G A;  1NZ9 A;  3OW2 S;  2EJF A;  2MWO A;  4L5G A;  2KXD A;  2QA4 Q;  4JS4 A;  3THK A;  1WXU A;  2EYY A;  3VS5 A;  4E7S A;  1BIA A;  4X1V A;  4JJC A;  5KYN A;  3QO3 A;  3ME9 A;  4PK4 A;  5IN1 A;  4ANJ A;  4HKE A;  1GBR A;  1B7T A;  2E3I A;  1S72 Q;  2E65 A;  2KBT A;  2ZAE A;  4M78 F;  1HD3 A;  1UE9 A;  3AHU A;  3QKJ A;  2C06 A;  1MMG A;  1M9S A;  1MMD A;  2OTL Q;  4PLL A;  3MO8 A;  4OVA A;  4KBM B;  2R58 A;  2V8K A;  8AT1 B;  3HRS A;  4A4G A;  3C95 A;  3JCM g;  1TH7 A;  2JOY A;  2E10 A;  5GMK i;  4C92 E;  3EFS A;  1DJ7 B;  4NL3 A;  1OOT A;  2V1Q A;  1T0J A;  3M5A A;  4J9F A;  4IKF A;  1H8K A;  1JXM A;  4BY6 C;  3JCM W;  1UHC A;  1YIJ A;  1UHF A;  1M5Q 1;  1JXO A;  1N9S A;  3QII A;  3FRN A;  2DBK A;  4HVV A;  5GAN g;  2VAS A;  4KUI A;  5HK3 A;  1OEB A;  2YT6 A;  2K5I A;  1K73 U;  2EVR A;  5KE3 A;  2VUB A;  5LJ5 f;  3CC4 A;  4LD9 K;  4M75 D;  5DM7 R;  1VYT A;  2IVW A;  3P8H A;  1GL5 A;  3C12 A;  2M1H A;  4L6V 5;  1QW1 A;  2DM1 A;  1QQJ A;  1UGR B;  3FLG A;  2MOX A;  3LX7 A;  1SKU B;  2JNG A;  4EDU A;  5LJ5 d;  3OB9 A;  4DEX A;  5GAN 3;  1SG5 A;  5FU6 C;  4M77 F;  3TSW A;  5HCK A;  1IRX A;  2FPF A;  3L2U A;  1AD5 A;  2LQ8 A;  1PRM C;  2DPP B;  2CGH A;  1YHQ A;  1KC8 U;  2LQK A;  4OMN A;  4ORZ A;  4IUQ A;  4E7Z A;  1CSK A;  4J9B A;  4XTZ A;  3PIP A;  4QQG A;  1TTH B;  3GOX A;  4HT9 A;  4DBF A;  1ZSZ C;  5GAO n;  4ATO A;  1K4U S;  2RM4 A;  4OB2 B;  3M9Q A;  2WSC E;  1VQL T;  3RUX A;  2CH4 W;  3KFV A;  2L3Q A;  3CXC A;  1QVF S;  2GFA A;  2J6F A;  2OTL T;  1VQ4 T;  3EG0 A;  3QWY A;  2XIC A;  1U1S A;  3ULR B;  1X69 A;  5FU7 B;  3GIB A;  2VYT A;  4N4I A;  4MML A;  1VUB A;  2QGF B;  2YXY A;  4AFU C;  1IHW A;  2HL5 C;  4JRI A;  1AEY A;  1EX4 A;  1PHT A;  4PKC C;  3J81 E;  3ASK A;  3C4S A;  2GTO A;  1GXI E;  1YIJ Q;  2ZPI B;  4M7D C;  2YRV A;  1NEG A;  3CQT A;  2OTJ A;  2YWW A;  4J6X A;  2VGN A;  1G2B A;  4CC4 B;  4A4E A;  1UJY A;  3CXC P;  4BD3 A;  5IAY A;  1W2B A;  3E9F A;  2ATC B;  4IUR A;  1E7O A;  3H6Z A;  1WXT A;  1QMC A;  2AIR B;  1G83 A;  1P92 A;  1SRL A;  5EG2 A;  2KNB B;  2PU9 B;  1Y96 A;  1ZUK A;  1YP5 A;  2VGM A;  3UF4 A;  1WJS A;  1X2Q A;  4QVD A;  2V26 A;  1YIJ T;  1ZA2 B;  3V8K A;  4PJN A;  1SHF A;  4J83 A;  2F69 A;  4ZN1 A;  2QEX A;  2PVO B;  3MEA A;  2ZPH B;  3CC4 T;  1PD1 A;  2FZK B;  1VQP T;  2HD0 A;  2KRS A;  3EAE A;  1FX7 A;  4YTL A;  4LXC A;  2ZZD A;  2HL3 A;  2JTF A;  1WQ7 A;  2KAF A;  3EG9 A;  4M75 C;  2K9G A;  2AKL A;  2HSP A;  3LGF A;  1VQM T;  4JRP A;  4J6Y A;  4OGC A;  4M7A B;  1UEB A;  2ZPF B;  2COW A;  3ZFJ A;  1UJ0 A;  1PKS A;  1WI7 A;  4PJL A;  1M1K C;  4XTX A;  4OP0 A;  5J39 A;  4M7A G;  2DE0 X;  2OTL A;  1T3L A;  1W4S A;  5FLX E;  1BYM A;  2HZY A;  3CCV A;  4BI8 B;  1XQH A;  3CCQ Q;  1LJO A;  2F1L A;  1GBQ A;  3MP8 A;  4QKU A;  1WQW A;  4NL2 A;  1K8A C;  3H0F A;  2KE9 A;  5I11 A;  5GMK l;  4CC2 A;  3OBW A;  3JAM E;  1RI0 A;  3FIF A;  2QQR A;  2EQJ A;  4A4H A;  1J3T A;  3MHX A;  2RPN A;  1Q82 R;  1IHV A;  1SF9 A;  1ZSZ A;  4J8O A;  2PZ1 A;  4M77 C;  3TSZ A;  1GCQ C;  1O75 A;  2LRQ A;  1G3W A;  3M4Y A;  1AWX A;  1AWJ A;  3JCM V;  2QTV A;  1KC8 C;  2DD5 A;  1NYG A;  1FMK A;  1JJ2 S;  2COZ A;  4EMG A;  2DXU A;  1D0Y A;  3GNF B;  2PNI A;  1VQN A;  2H3J A;  4J9E A;  3QXE B;  2GFU A;  2LDM A;  2W10 A;  4ZN3 A;  3OS2 A;  3RKY A;  5GMK m;  4QQD A;  1X27 A;  2LT1 A;  4M7D A;  4M75 B;  1AOJ A;  4C92 G;  3EGX B;  2EYX A;  3G6E Q;  1QVP A;  2RD1 A;  4KGX B;  5AYF A;  4XTW A;  2AK5 A;  2JM9 A;  3QPH A;  4WCI A;  1WHM A;  3PFS A;  4E7H A;  3VV0 A;  2JTE A;  1HK9 A;  4RKU E;  4GLK A;  1WHH A;  2EKH A;  3QDF A;  1KQ2 A;  1N8R R;  4BI4 A;  2FL7 A;  4QT7 A;  2LCC A;  5L8R E;  5A2Q E;  4OMP A;  2M16 A;  2DIQ A;  4N0A A;  3JCM h;  4JRQ A;  3IQL A;  3SWN C;  1G3S A;  2AZS A;  5KYW A;  1OUL A;  2DYB A;  3G71 T;  2X4X A;  4Z89 A;  2ZPB B;  3QUI A;  3NTI A;  3A1P A;  3H0I A;  2PVD B;  1U8R A;  4BE0 A;  4QVC A;  3EG2 A;  3JB9 D;  5IXF A;  1QKX A;  1Q82 U;  1ARK A;  4QVZ A;  4JUV A;  3CBO A;  1O9S A;  1TUD A;  2Y4X A;  3JB9 J;  2C0T A;  1VQ6 Q;  3QDR B;  1SHG A;  4IIO A;  3QWX X;  1N9R A;  3CMA T;  2HBW A;  2DYI A;  2O2O A;  1KQS P;  4E7L A;  1VQO A;  1VQ7 Q;  2HKN A;  3LYI A;  2YRD A;  1M8M A;  1WGS A;  3CBP A;  1R8O B;  1RL2 A;  1GCP A;  4EMH A;  3X24 B;  1KD1 C;  1W2B P;  3O5Z A;  2EJG A;  2F2V A;  3EG3 A;  1NM7 A;  2RH2 A;  1N5Z A;  2DXC A;  1S72 T;  3WXM B;  4M7A E;  1CKA A;  5KYW B;  2OAW A;  3QJY A;  4B6M A;  1D0Z A;  4M77 D;  5CR2 A;  1WIE A;  2J6O A;  5GAM e;  2GGR A;  3BFM A;  4XQ3 A;  2FRY A;  2BZX A;  5CKD A;  5GAN 5;  4OML A;  2JUF A;  1X01 A;  1Q95 G;  3ZEH A;  4HCB A;  3LH5 A;  3CBM A;  2XMF A;  1R77 A;  3ZBD A;  4F7U B;  1KHC A;  2F5T X;  2EQK A;  3DLL A;  3P8B B;  3I35 A;  1JBM A;  1OV3 A;  2KGT A;  4LNP A;  4MMK A;  4AMC A;  1KIK A;  3X28 B;  3V8L A;  1TWB A;  4C5G A;  1TU0 B;  1UTI A;  3SDZ A;  1AZG B;  3FDR A;  3UWN A;  1VQ5 A;  4EPC A;  2QQB A;  1RAC B;  3I9Q A;  1WJQ A;  2E70 A;  2A08 A;  2RQV A;  1BIB A;  2P84 A;  1X2K A;  3JCM b;  3EHQ A;  3JCM c;  2XU8 A;  4M4Z A;  1UB4 A;  2GCX A;  2WSF E;  2LVM A;  3M53 A;  1NLP C;  1YCS B;  5CQX A;  3E1S A;  1WHG A;  1CKB A;  1YHQ T;  1AHJ B;  3G4S T;  3J80 E;  2RI3 A;  2BZ8 A;  1K1Z A;  5GMK j;  2V8I A;  2HQE A;  3I56 T;  1D1C A;  3VS0 A;  3OYA A;  4J7I A;  5IHI A;  5CKB A;  3GBQ A;  4OMF B;  5GAM g;  3CPW S;  2RF0 A;  3RMS A;  4AFS C;  3OS1 A;  4XU3 A;  2VVK A;  4FYV B;  5CQY A;  3SB2 A;  5GMK e;  1MHN A;  5KYY A;  2KYM A;  2DD4 A;  3UDC A;  2O4X B;  5D6W A;  3NFC A;  2LJ3 A;  2D8H A;  1OZ3 A;  2EGA A;  1UGS B;  4N4H A;  4ESR A;  5GAN e;  5LJ3 f;  3SFM A;  4PJO D;  2K5F A;  3VUZ A;  4KUD K;  4DBQ A;  4D8K A;  1IB8 A;  1K9M U;  5HKC A;  1C0M A;  3VYH B;  1VQK Q;  4WF2 A;  5KYU A;  4M78 E;  1H3H A;  1Q7Y R;  4Z8A A;  2D8J A;  2DVE A;  1YJW T;  1ZUY A;  2FEI A;  2JM8 A;  5FWC A;  3L1A A;  2QA4 T;  2RJE A;  1OQK A;  2NUT B;  3PNW C;  2EQM A;  4BUG A;  1FMV A;  4BB7 A;  1U06 A;  1BI3 A;  1T0H A;  4TVR A;  1KQS A;  2ROL A;  2QEX Q;  2D6F A;  5CVI A;  3RDV A;  3CXC S;  5C6S A;  2K3X A;  2DMO A;  1M90 C;  1RAF B;  4BE2 A;  3I5R A;  1ABQ A;  4JPB W;  3E9G A;  3EG9 B;  4X9C A;  2COY A;  3JB9 I;  1B34 A;  5GAN 4;  2A3L A;  3OS5 A;  4VUB A;  3VRZ A;  2RJC A;  4C8Q F;  7AT1 B;  3HPW A;  2JZ2 A;  1M8V A;  4HCZ A;  3G6E A;  3EGD A;  4M78 C;  1YCY A;  3KBG A;  3M0R A;  3RBB B;  3VS7 A;  1WFW A;  3OYY A;  3VUB A;  3CCE T;  1NBE B;  3NGP A;  2CP5 A;  4WTO B;  3LH0 A;  3M56 A;  1IZ6 A;  4C92 B;  4C0D C;  1U1T A;  2KK4 A;  1KQS S;  1BK2 A;  1JQQ A;  4C92 F;  2LP5 A;  2QQ9 A;  3CME A;  1M2V B;  4BY6 B;  1Q81 R;  4M78 G;  2DIG A;  1BBZ A;  4JDS A;  2EYZ A;  5GJW B;  1VQK A;  5GAN j;  1AWW A;  4LUD A;  1Q7Y U;  4BDZ A;  4LDV A;  2QAZ A;  5KYX B;  1QLY A;  4IUU A;  3L2W A;  3QG1 A;  1PNJ A;  2LJ1 A;  1NJI C;  2AT1 B;  2MYS A;  1YNZ A;  2YHT A;  1E6G A;  1YJ9 A;  2NYS A;  1SPK A;  4D8D A;  5I2S A;  2KYB A;  1HSQ A;  4K11 A;  5KCH A;  4J9H A;  3I55 Q;  2HCK A;  1MMN A;  3DLM A;  1XTD A;  3JRZ A;  3REA B;  1VQM Q;  3G71 Q;  5IHK A;  3HHT B;  1BCO A;  2NUP B;  4HVU A;  2M0Y A;  3SEM A;  3OYK A;  2KY9 A;  2RQR A;  2NUT A;  1BI2 A;  2KQW A;  4KGV B;  2EQU A;  4FL6 A;  2DZC A;  4M7A A;  3G1J A;  5KCO A;  4IUV A;  1VQ9 Q;  3OMC A;  1MMA A;  3CCR T;  1VQ7 T;  1YIT T;  4LDW A;  4FIB A;  5A0L A;  2DXB A;  3PMI A;  1N6A A;  1FXX A;  4OMO A;  2LX7 A;  1GFD A;  5CKF A;  3JCM d;  2CUD A;  1NYF A;  5KYX A;  1RAA B;  3INZ A;  2RI5 A;  3L2Z A;  2X3X D;  3V8J A;  2E3H A;  2A0F B;  5DLQ E;  4L59 A;  2RK2 A;  3PMT A;  3CCM Q;  2FPE A;  4LDY A;  1YJN Q;  3J7A F;  1QP2 A;  4XU2 A;  3CPF A;  1OZ2 A;  4M78 A;  4NOY A;  3CCL A;  1VIF A;  3EH2 A;  1VQ9 T;  2BZY A;  3VRY A;  2CZ0 B;  3BW1 A;  4M7D D;  2DL3 A;  3HTR A;  4HA8 A;  5DY9 A;  1OI1 A;  2EYQ A;  2IIM A;  3FJP A;  2BIV A;  1PKT A;  5LJ3 e;  5CKE A;  3S3M A;  2FG0 A;  2JS0 A;  3M57 A;  1Y07 A;  1RAH B;  1RAG B;  4F7U G;  3URG A;  1ABO A;  3CMA A;  1QCO A;  1YJ9 Q;  4MZT A;  2QDL A;  2HDA A;  2DTO A;  1BB9 A;  1VQO T;  4JRK A;  2IG0 A;  2EKO A;  2X3W D;  3H8Z A;  3CCM T;  1YJN T;  2RHZ A;  1IGU A;  5I2M A;  2KEA A;  4M75 E;  1WHJ A;  2CUB A;  3PVQ A;  1TUG B;  3M0P A;  2HNI A;  1AVZ C;  4O6J A;  5CK9 A;  2RA2 A;  5GAN 2;  3M58 A;  3QZ5 B;  4ME7 A;  1YJ9 T;  1PCX A;  4O5V A;  1M27 C;  4AT1 B;  2X51 A;  4RTW A;  3C0C A;  4FU6 A;  4E47 A;  2E6N A;  3CCQ A;  4C8Q A;  2X9H A;  3V7R A;  4B9X A;  1G5V A;  3HL8 A;  3CCE Q;  2L3S A;  3TRE A;  2J7I A;  2LQW A;  3CCJ A;  5LJ5 e;  1UDL A;  1K8A U;  2K57 A;  1YI2 A;  1YJW Q;  1JEG A;  2B8A A;  2R57 A;  1W70 A;  1WDX A;  3FB9 A;  5LJ3 j;  3HFN A;  2A36 A;  3I5S A;  1WX6 A;  2BE9 B;  5I21 A;  3LLR A;  1VQ5 Q;  2QG9 B;  1I0C A;  3CCS Q;  3DB4 A;  1S1N A;  2EBP A;  3JCM X;  2PVG B;  1ZSG A;  4M75 A;  3VS1 A;  4C8Q E;  4A63 B;  1VQ6 A;  5ECA A;  3PE0 A;  2L89 A;  1PC0 A;  4MDX A;  1UEC A;  4XTV A;  1OX8 A;  2FB7 A;  5GJV B;  3QBY A;  4F17 A;  3NTH A;  2HEQ A;  4EMK C;  3JB9 H;  2W0Z A;  2JMC A;  3HFO A;  1G3T A;  4E2F B;  1VQ8 T;  2L0A A;  3WVE B;  1RAE B;  3CEY A;  2AKK A;  4PL6 A;  1UGP B;  1M90 R;  4R56 A;  4OB3 B;  4OF1 A;  2DXT A;  4ZTJ A;  2ZGW A;  1GCQ A;  3CCJ Q;  2EWN A;  1RLQ C;  2E12 A;  4R55 A;  1QVG S;  2JTM A;  4FCY A;  3CC4 Q;  1VA7 A;  1IRE B;  3MKD A;  4C92 D;  3G71 A;  2PTK A;  5AT1 B;  5GAO q;  3QJ6 A;  5IHN A;  3KUF A;  3AT1 B;  3CCS A;  4V2S A;  1JB0 E;  4Y91 A;  3S6W A;  1RAB B;  3I56 A;  1T3S A;  4HT8 A;  3OYI A;  4Z88 A;  3I55 T;  3JCM Q;  2DF6 A;  1VYV A;  1PRL C;  1MV0 B;  3FC3 A;  3SWN A;  1B34 B;  1V1C A;  2BUD A;  3EG1 A;  4J9C A;  1YI2 Q;  4C8Q D;  2A37 A;  4A54 A;  3FEO A;  1K8A R;  5L23 A;  2HKQ B;  3WVD B;  2G3R A;  4F7U F;  1IXD A;  4DEY A;  3OA6 A;  2DJQ A;  4QW2 A;  2RB6 A;  4A4K A;  1KFZ A;  1D3B A;  1OX9 A;  2BE7 D;  2F5K A;  4C92 C;  1YFN A;  4C0G A;  2X4J A;  3L2R A;  2O4X A;  3EFR A;  3UA6 A;  3CCU T;  2XKO C;  1QCF A;  5GAN 6;  1H92 A;  2JN0 A;  2CDT A;  2PUK B;  5A0G A;  2SRC A;  2JJ9 A;  2RQT A;  2GQV A;  1X75 C;  3EFO A;  1RLP C;  3QSU A;  3PTA A;  1YIT A;  1QKW A;  1UUE A;  2X4W A;  1PM3 A;  4ZGE B;  1G3Y A;  1N8R U;  2MMP A;  3A8M B;  3A8L B;  1VQL A;  1AT1 B;  4JZ4 A;  2JMA A;  3OW2 A;  4M77 G;  4OB0 B;  2XHC A;  1YWO A;  3OYG A;  3MEW A;  2ED1 A;  3SWN B;  3UPU A;  5FW9 A;  1ZBX A;  2E5Q A;  3JV3 A;  4P5N A;  4PFZ A;  4C5I A;  1D1A A;  4X34 A;  2H3E B;  2L3R A;  2FRW A;  4N0A C;  1Z9Z A;  3BDL A;  1VQ5 T;  4DBH A;  3M0T A;  3CC2 A;  2MF2 A;  2NUP A;  5A0D A;  2HAX A;  3GP8 A;  5GAN 8;  2MWP A;  1MGQ A;  2O9S A;  4M7D F;  1JRI A;  1PD0 A;  4M7D E;  3CCE A;  2LQN A;  5LJ5 j;  2LX9 A;  2RI2 A;  3NMZ C;  4HCK A;  3MEU A;  5LJ3 d;  4PJO G;  4XTY A;  2K2M A;  1QVG A;  2CRE A;  4M7A F;  1KG1 A;  4J9I A;  1SEM A;  1XOV A;  2CP2 A;  5IXB A;  2FYK A;  2OJ2 A;  3HP9 A;  3A5Z B;  3RER A;  1C6V X;  3PT9 A;  4BAC A;  1EZZ B;  1ZBJ A;  2C0I A;  2LC4 A;  3C94 A;  2DK3 A;  1H3Z A;  4X9D A;  3PGG A;  2YLC A;  3P8D A;  5KH6 A;  1M2V A;  3TEE A;  3CCV T;  1K0X A;  2DVJ A;  2DRM A;  2KRN A;  3MCA B;  3CCU A;  2DEU A;  2G6F X;  3SD4 A;  1M1K U;  1KD1 R;  1C1A A;  3GPL A;  2OTJ T;  2EPD A;  4M77 A;  3I55 A;  1FMW A;  4JJD A;  1UGV A;  5FRO A;  5GAM d;  5GAN h;  4GY5 A;  2VV5 A;  3T9N A;  4PNO A;  2FHD A;  2MI6 A;  4IUT A;  2X4Y A;  4KH1 B;  1TXQ A;  4JLG A;  4XU1 A;  3M4G A;  4C5H A;  4OB1 B;  4DQ2 A;  1TG0 A;  2D1X A;  5HY6 A;  5LJ5 g;  5GMK h;  1XJW B;  2P0Q A;  3CPW A;  1WZO A;  1Q86 C;  3G7Z A;  4FYW B;  3OYD A;  4RTV A;  2DAQ A;  2O31 A;  2MCN A;  2K3B A;  5CIU A;  3U23 A;  4RG2 A;  2FPD A;  1VQ8 Q;  4IIM A;  3D7S B;  5J3B A;  2DX1 A;  1YJW A;  4KH0 B;  2YUP A;  2ENM A;  2CSI A;  1NPP A;  1UGQ B;  2FVU A;  2MPX C;  4PFP A;  1KK7 A;  4PFO A;  1I1J A;  3PVL A;  2RHY A;  4LE9 A;  1Y0M A;  5J26 A;  2L8D A;  3A98 A;  4JJN K;  3FJ5 A;  5LJ5 h;  4PJM A;  1Q86 U;  5I22 A;  1D0X A;  4HCC A;  2QYZ A;  2EGE A;  4MZP A;  3VS4 A;  1QWE A;  4DA4 A;  4IUP A;  4J9G A;  3JB9 F;  3OYH A;  1W2B S;  2DTH A;  1MNE A;  1OU9 A;  1VQK T;  2A28 A;  4Z02 A;  4M7D B;  2SEM A;  3X20 B;  3LWH A;  3TCJ A;  1M1K R;  2OTJ Q;  1MND A;  4HVW A;  2DO3 A;  3M54 A;  2RN8 A;  3EHR A;  4DOV A;  4CI0 C;  3NPF A;  2BKD N;  4A4F A;  4JS5 A;  3G4S A;  2EFI A;  1K73 R;  4FSS A;  4OMQ A;  4EIK A;  3DKM A;  1OPK A;  5CO7 A;  2K6D A;  2JT4 A;  3V7C A;  5GAO p;  3BE3 A;  1WYX A;  2I2L A;  2J06 A;  3CCR Q;  4MDW A;  4M7D G;  2M0O A;  1TSF A;  5FRM A;  1VQ4 A;  2CZ6 B;  1W6X A;  3CD6 T;  5HK0 A;  4RTY A;  1Z9Q A;  2E6Z A;  1LOJ A;  3JCM P;  1S72 A;  2K79 A;  4AFQ C;  2YLB A;  2LTO A;  4FM4 B;  1ZQ1 A;  3E2U A;  1UG1 A;  1OU8 A;  2O88 A;  1KC8 R;  1Q7Y C;  2CKK A;  2FZG B;  3CPW P;  4RUG A;  4XK8 E;  1WHK A;  3HSB A;  3VS2 A;  2KDS A;  5LL6 S;  1LNX A;  2JS2 A;  1NE8 A;  3OS0 A;  2LNH B;  2HQX A;  2QTX A;  5FWB A;  2E4H A;  2MIO A;  4OMM A;  4ZTF A;  4F7U E;  2CP0 A;  3L2Q A;  1I5L A;  3RKW A;  4AG1 C;  5IT9 E;  4RCC A;  2VWF A;  1Q86 R;  2OAU A;  4PJJ A;  4Y92 A;  4RTZ A;  3PIO A;  5GAO l;  1UFF A;  1ZSZ B;  4F7U A;  4E6R A;  3JB9 G;  3CCL T;  4D6W A;  1ZHI A;  4BI3 A;  2HMA A;  3QZ9 B;  3VKI A;  2QEX T;  1VQN Q;  1G8X A;  4II1 A;  1KJW A;  1IO6 A;  3N5B B;  1PSE A;  1AWO A;  2CT4 A;  3OSS C;  3UA7 A;  4C0Z A;  4C5E A;  1BKB A;  1M1G A;  5M9O A;  4EMK A;  1JJ2 A;  1Q81 U;  1WLP B;  2WSE E;  3DB3 A;  2DL8 A;  4C92 A;  5GAO r;  1VQ9 A;  3EFO B;  1RI9 A;  1QVF P;  3EGU A;  5CAI A;  1V76 A;  3RR6 A;  3MJX A;  3EGX A;  1BI0 A;  4FT2 A;  3V7S A;  3L42 A;  1QVG P;  1ZLM A;  5LJ3 g;  2HBP A;  2RMO A;  1A0N B;  1QWF A;  1YN8 A;  4FW2 A;  2CT3 A;  1NEB A;  3RKX A;  3GLX A;  1ZX6 A;  3OYC A;  4ZGD B;  2ROT A;  2F2W A;  2KT1 A;  2RK1 A;  1D09 B;  3OYN A;  2LZ6 B;  2ZPE B;  2QQS A;  2XI9 A;  3CD6 A;  2EQI A;  1VYU A;  3O8V A;  2VB6 A;  5KYU B;  1SSH A;  1K76 A;  2ABL A;  2KR3 A;  1D1B A;  4OGE A;  2P4T A;  2EAY A;  2B86 A;  3JCM e;  3OY9 A;  3M0S A;  4F14 A;  4XTU A;  1N27 A;  1I81 A;  1V29 B;  2EW3 A;  1YIT Q;  2DL5 A;  2KXC A;  3F70 A;  3VYG A;  4M78 B;  1B3Q A;  1X6O A;  3OW2 P;  2EYW A;  1HXD A;  2DEQ A;  4FYX B;  4FSX A;  2YSQ A;  3OYL A;  3OMG A;  5D6Y A;  2QQA A;  3H41 A;  1LVK A;  4RCB A;  5D6X A;  2DLP A;  4JLI A;  2KT8 A;  4C0F A;  4KGZ B;  3EH1 A;  4ZNX A;  3VU3 C;  2DJZ A;  1KQ1 A;  2FZC B;  5GAN 7;  4B9W A;  1RAD B;  3NHN A;  1NJI U;  5KE2 A;  2ZPG B;  3BY7 A;  1KHI A;  1K9M C;  3CC7 Q;  4N4G A;  2Y4Y A;  3CC2 Q;  2NUZ A;  1X43 A;  3Q1J A;  4MZM A;  1U5S A;  2KI7 A;  3KXT A;  1JU5 C;  3OYM A;  4UC4 A;  2NLU A;  2YUQ A;  2H8H A;  1RUW A;  4FYY B;  4PJO B;  4JZ3 A;  1YI2 T;  3ER0 A;  5CKH A;  1B07 A;  3LGL A;  4RTX A;  4QQ6 A;  2CP6 A;  1Y96 B;  5EC7 A;  1N8R C;  2LJ0 A;  4GBQ A;  4C8Q C;  3MP6 A;  3CC2 T;  1E6H A;  2E5K A;  2XK0 A;  4J6W A;  3I56 Q;  1M1F A;  1VQ8 A;  1YBY A;  4PLI A;  3CC7 T;  2DBM A;  1VQP A;  3OQ5 A;  1H64 1;  1VQM A;  3EGD B;  1MUZ A;  2KMT A;  5IH2 A;  2OI3 A;  5FU7 C;  1QVF A;  1BCM A;  1M3B A;  5GAN f;  2CZ1 B;  2CH4 A;  2QK0 A;  4LDU A;  1JJ2 P;  2HQH A;  4M77 B;  3NTK A;  3CCU Q;  2VXF A;  2ZCF B;  3RES A;  5C0M A;  2ECZ A;  4ELY C;  2RHX A;  3OBY A;  2E64 A;  4M75 F;  2JW4 A;  1Q81 C;  5GAM j;  1WNL A;  3HRT A;  2I0N A;  2BTT A;  1OPL A;  1I4K 1;  2XD0 A;  5GAM h;  2K3Y A;  2KRO A;  4LUE A;  4M77 E;  5KYY B;  3QYH B;  3X25 B;  3TVT A;  1WJR A;  5CCA A;  1NJI R;  6AT1 B;  1Y7X A;  2OX7 A;  2PQW A;  2YUO A;  1K73 C;  1K0S A;  1LCK A;  1VOM A;  3CCS T;  2P0P A;  3CME T;  1SSF A;  2MAM A;  3A8G B;  4CC3 A;  2RHI A;  2V8J A;  3MET A;  2K4Y A;  3M55 A;  1EFN A;  2K5L A;  4C0D B;  2P4R A;  1IGQ A;  4HXJ A;  4ELZ C;  3JSC A;  2DKG A;  3M0U A;  2D0Q B;  3GF5 A;  1I07 A;  1VQ4 Q;  4JJB A;  2P0K A;  4M78 D;  2E1H A;  2XG8 D;  3CCR A;  1TUC A;  1X6B A;  1Q82 C;  1M90 U;  2M9U A;  4PJO E;  2R5M A;  4Q5W A;  1WXB A;  2L5Q A;  2CYZ B;  4M7A C;  4BDY A;  2DRK A;  4XAX B;  2JXB A;  3CD6 Q;  3CCV Q;  4LD6 A;  2CP7 A;  4PJO A;  1OYX A;  3OSV A;  3QYG B;  3UT1 A;  4LDX A;  4KRT A;  2HSE B;  4NS5 A;  2X35 A;  1GRI A;  2QDY B;  2AZV A;  2YDL A;  1R0C B;  3H0H A;  2MK5 A;  2DA9 A;  2DTI A;  2EJ9 A;  2XDB A;  2XDP A;  2GQI A;  3L2V A;  2RHU A;  2GBQ A;  1RAI B;  8ATC B;  4ZGJ B; 
#chains in the Genus database with same CATH homology
 5J39 A;  4M7A G;  2OTL A;  1W4S A;  4RG2 A;  5FLX E;  1BYM A;  2KSS A;  3CCV A;  4XU0 A;  4BI8 B;  1XQH A;  1XTD A;  3DLM A;  3JRZ A;  1LJO A;  5J3B A;  3MP8 A;  1WQW A;  4NL2 A;  1K8A C;  4A53 A;  3HHT B;  5GMK l;  1YJW A;  1I8F A;  3JAM E;  3OBW A;  1RI0 A;  3FIF A;  2QQR A;  3OYK A;  1QP3 A;  2EQJ A;  1NPP A;  1UGQ B;  2FVU A;  2KY9 A;  1BI2 A;  2KQW A;  4A4H A;  1EIF A;  4PJO C;  2RHY A;  2XDD A;  5GAM f;  2EQU A;  3MHX A;  4FL6 A;  5GAN d;  2DZC A;  5J26 A;  4M7A A;  5KCO A;  2L8D A;  4J8O A;  4M77 C;  4IUV A;  1NPR A;  3OMC A;  4JJN K;  4DOW A;  4C8Q B;  4EMK B;  5LJ5 h;  2QI2 A;  3CCR T;  1Q86 U;  1VQ7 T;  1O75 A;  2LRQ A;  1G3W A;  3M4Y A;  4HCC A;  1YIT T;  4LDW A;  4FIB A;  4MZP A;  3JCM V;  5A0L A;  4C8Q G;  1KC8 C;  2DD5 A;  2DXB A;  3PMI A;  1N6A A;  2EIF A;  2PUO B;  1FXX A;  4DA4 A;  4IUP A;  3S3N A;  5CKF A;  3JCM d;  1VIE A;  1JJ2 S;  3JB9 F;  4EMG A;  3MP1 A;  3INZ A;  2DXU A;  3OYH A;  2RI5 A;  3L2Z A;  3V8J A;  3GNF B;  5DLQ E;  1W2B S;  2CZ7 B;  1VQN A;  4L59 A;  2DTH A;  2RK2 A;  3PMT A;  4LDY A;  2H3J A;  2Y90 A;  5LJ3 h;  1VQK T;  2RO0 A;  3QXE B;  3S3O A;  3J7A F;  1QP2 A;  2GFU A;  4XU2 A;  4Z02 A;  4M7D B;  5FU6 B;  3CPF A;  1OZ2 A;  3A8O B;  2LDM A;  4M78 A;  4NOY A;  3X20 B;  3RKY A;  4ZN3 A;  3TCJ A;  3OS2 A;  5GMK m;  1VIF A;  2DO3 A;  3M54 A;  4QQD A;  2WAC A;  2LT4 A;  1VQ9 T;  4DOV A;  3QHS A;  3RMQ A;  4CI0 C;  2CS7 A;  2CZ0 B;  3BW1 A;  3GNG A;  4M7D D;  2BKD N;  2LT1 A;  4A4F A;  4M7D A;  2QA4 A;  4M75 B;  4JS5 A;  4C92 G;  3G4S A;  4HA8 A;  5DY9 A;  2EFI A;  1OI1 A;  2EYQ A;  5GAO m;  1FWZ A;  1QVP A;  3FJP A;  3DKM A;  5CO7 A;  3V7C A;  2BIV A;  2RD1 A;  5GAO p;  2I2L A;  5LJ3 e;  1WPY A;  5AYF A;  4XTW A;  5CKE A;  3S3M A;  3HRU A;  3QPH A;  3M57 A;  4MDW A;  3TU4 K;  2E41 A;  4M7D G;  2M0O A;  3PFS A;  5FRM A;  4LD9 K;  1Y07 A;  4E7H A;  1VQ4 A;  2CZ6 B;  3VV0 A;  2O01 E;  3CCJ T;  4F7U G;  3CD6 T;  5HK0 A;  3URG A;  1HK9 A;  2E6Z A;  4RKU E;  4GLK A;  4CRI A;  2VXE A;  3CMA A;  1KQ2 A;  3X26 B;  1LOJ A;  4MZT A;  3JCM P;  2RJD A;  4BI4 A;  1S72 A;  3OYF A;  3M59 A;  2DTO A;  3MEV A;  2FL7 A;  1VQO T;  4JRK A;  2LCC A;  2IG0 A;  2JVV A;  2YLB A;  2LTO A;  2EKO A;  3H8Z A;  5L8R E;  3CCM T;  1YJN T;  1ZQ1 A;  2GF7 A;  2M16 A;  2R5A A;  2DIQ A;  4FM4 B;  4KT0 E;  5A2Q E;  4N0A A;  1M4Z A;  2RJF A;  2RHZ A;  3JCM h;  4JRQ A;  1VQN T;  3SWN C;  5I2M A;  1G3S A;  3A8H B;  1Q7Y C;  2CKK A;  4FT4 A;  3G71 T;  2X4X A;  5DLO A;  4M75 E;  2LCL A;  4XK8 E;  3HSB A;  2KDS A;  5LL6 S;  4RMO A;  4E7I A;  1LNX A;  2HNI A;  2ZPB B;  3QUI A;  4O6J A;  1NE8 A;  2AHJ B;  3NTI A;  3OS0 A;  5CK9 A;  3JCM J;  3RIR A;  3G6E T;  2HQX A;  2PVD B;  2RA2 A;  3CC7 A;  1U8R A;  3LWH A;  2QTX A;  5GAN 2;  4QVC A;  4BE0 A;  5FRN A;  3M58 A;  3QZ5 B;  4ME7 A;  4J7F A;  3JB9 D;  1YJ9 T;  4ZTF A;  4O5V A;  1Q82 U;  4F7U E;  4QVZ A;  3L2Q A;  1I5L A;  3RKW A;  3BDU A;  4FU6 A;  4JUV A;  4E47 A;  3CBO A;  4RCC A;  5IT9 E;  2E6N A;  1O9S A;  4Y28 E;  2OAU A;  4C8Q A;  3CCQ A;  2Y4X A;  3V7R A;  4E7K A;  3JB9 J;  3QDR B;  4B9X A;  3PIO A;  3HL8 A;  1G5V A;  3OYE A;  5GAO l;  4BE1 A;  1BI1 A;  3TRE A;  4F7U A;  3HKS A;  3CCJ A;  5LJ5 e;  1N9R A;  3JB9 G;  1K8A U;  3CCL T;  4D6W A;  2K57 A;  1ZHI A;  4E7J A;  1YI2 A;  3CMA T;  4RG8 A;  2A7Y A;  2B8A A;  4BI3 A;  3E19 A;  2R57 A;  3FB9 A;  5LJ3 j;  3QZ9 B;  3HFN A;  4E7L A;  1VQO A;  3VKI A;  1VQ7 A;  1D3B B;  2QEX T;  3LYI A;  4M75 G;  1WGS A;  3CBP A;  1R8O B;  4II1 A;  5I21 A;  3CCM A;  1YJN A;  3LLR A;  3N5B B;  1RL2 A;  1PSE A;  2KVQ G;  3OSS C;  2K2V A;  1KD1 U;  4EMH A;  3X24 B;  4C0Z A;  4C5E A;  3DB4 A;  3LWI A;  1KD1 C;  1BKB A;  1M1G A;  5M9O A;  4EMK A;  1JJ2 A;  1Q81 U;  2WSE E;  3JCM X;  3DB3 A;  4C92 A;  2EJG A;  2PVG B;  2DZ9 A;  3LW5 E;  4M75 A;  4C8Q E;  5GAO r;  2D9T A;  1VQ9 A;  4J5Y A;  5CAI A;  1VQ6 A;  2RH2 A;  2L89 A;  2QXF A;  2DXC A;  1BI0 A;  4FT2 A;  1S72 T;  3V7S A;  3WXM B;  4M7A E;  3L42 A;  4PJO F;  4MDX A;  4XTV A;  2FB7 A;  3QJY A;  5LJ3 g;  2HBP A;  3QBY A;  1PSF A;  2VC8 A;  4M77 D;  5CR2 A;  3NTH A;  5GAM e;  3OYB A;  4EMK C;  3JB9 H;  4M7A D;  3HFO A;  1G3T A;  1VQ8 T;  3RKX A;  3WVE B;  3GLX A;  2XID A;  2LNV A;  3CEY A;  3CCQ T;  4KUL A;  3BFM A;  3R6O A;  4PL6 A;  4XQ3 A;  1UGP B;  3OYC A;  3JCM f;  5CKD A;  4ZGD B;  3VJP A;  5GAN 5;  1XNI A;  1X01 A;  2JUF A;  4R56 A;  3ZEH A;  3OYJ A;  4OB3 B;  1Y71 A;  4OF1 A;  2DXT A;  2RK1 A;  4HCB A;  1NZ9 A;  4ZTJ A;  3OYN A;  3CBM A;  3OW2 S;  2ZPE B;  2ZGW A;  2QQS A;  2EJF A;  2MWO A;  2XI9 A;  4L5G A;  3CD6 A;  3O8V A;  3ZBD A;  2EWN A;  4F7U B;  4JS4 A;  1KHC A;  2E12 A;  2EQK A;  2F5T X;  4R55 A;  3DLL A;  1QVG S;  2JTM A;  3P8B B;  1VQ6 T;  1JBM A;  4MMK A;  4OGE A;  2P4T A;  2EAY A;  1IRE B;  4C92 D;  3G71 A;  1BIA A;  3X28 B;  3V8L A;  4C5G A;  3JCM e;  3OY9 A;  3SDZ A;  5GAO q;  4XTU A;  3QO3 A;  3QJ6 A;  1N27 A;  3ME9 A;  1I81 A;  3FDR A;  1V29 B;  5IN1 A;  3KUF A;  4HKE A;  3UWN A;  3F70 A;  3VYG A;  2E65 A;  4M78 F;  3CCS A;  1VQ5 A;  4V2S A;  4EPC A;  1JB0 E;  4M78 B;  1X6O A;  4Y91 A;  3QKJ A;  2QQB A;  2C06 A;  3S6W A;  3AHU A;  1HXD A;  2DEQ A;  4FSX A;  1M9S A;  3OYL A;  1WJQ A;  3I56 A;  2E70 A;  3OMG A;  4PLL A;  4HT8 A;  5D6Y A;  3OYI A;  3MO8 A;  4OVA A;  2QQA A;  4KBM B;  3I55 T;  3JCM Q;  2R58 A;  2V8K A;  1BIB A;  4RCB A;  5D6X A;  3HRS A;  4JLI A;  4A4G A;  3JCM c;  3JCM b;  3FC3 A;  3SWN A;  1B34 B;  2BUD A;  3C95 A;  4C0F A;  3JCM g;  4C8Q D;  1TH7 A;  4A54 A;  3FEO A;  2DJZ A;  1KQ1 A;  2XU8 A;  3VU3 C;  2JOY A;  1UB4 A;  2E10 A;  2GCX A;  5GMK i;  4C92 E;  2WSF E;  2LVM A;  2G3R A;  3EFS A;  1DJ7 B;  3WVD B;  4F7U F;  4NL3 A;  3M53 A;  5GAN 7;  4B9W A;  3M5A A;  3E1S A;  5CQX A;  1NJI U;  4IKF A;  3OA6 A;  1YHQ T;  5KE2 A;  2ZPG B;  3BY7 A;  4BY6 C;  1AHJ B;  1KHI A;  3G4S T;  1K9M C;  3J80 E;  4QW2 A;  2RI3 A;  2RB6 A;  1M5Q 1;  3JCM W;  1YIJ A;  4N4G A;  1N9S A;  2Y4Y A;  5GMK j;  3QII A;  4A4K A;  1D3B A;  3FRN A;  2V8I A;  2F5K A;  3Q1J A;  4C92 C;  5GAN g;  2HQE A;  3I56 T;  4MZM A;  4C0G A;  4KUI A;  5HK3 A;  3OYA A;  2X4J A;  3KXT A;  3L2R A;  3OYM A;  4J7I A;  4UC4 A;  2K5I A;  2NLU A;  5CKB A;  4OMF B;  1K73 U;  5KE3 A;  2VUB A;  5LJ5 f;  2O4X A;  3EFR A;  5GAM g;  3CPW S;  3CC4 A;  3RMS A;  4PJO B;  3OS1 A;  4XU3 A;  4M75 D;  5DM7 R;  2XKO C;  3CCU T;  5GAN 6;  1YI2 T;  2JN0 A;  3ER0 A;  2IVW A;  2PUK B;  3P8H A;  3LGL A;  5CKH A;  5CQY A;  3SB2 A;  5GMK e;  3C12 A;  2M1H A;  4L6V 5;  5A0G A;  1MHN A;  1QW1 A;  1UGR B;  2GQV A;  1X75 C;  3FLG A;  2DD4 A;  3LX7 A;  3QSU A;  2JNG A;  3UDC A;  4EDU A;  2O4X B;  3OB9 A;  4QQ6 A;  5D6W A;  3NFC A;  5LJ5 d;  3PTA A;  1YIT A;  1OZ3 A;  2X4W A;  1UGS B;  4N4H A;  5GAN 3;  4ZGE B;  1G3Y A;  1Y96 B;  5FU6 C;  1N8R U;  4M77 F;  2MMP A;  1N8R C;  5GAN e;  3A8M B;  5LJ3 f;  4C8Q C;  3MP6 A;  3A8L B;  3SFM A;  1VQL A;  3CC2 T;  4PJO D;  2K5F A;  2XK0 A;  4J6W A;  3VUZ A;  4KUD K;  3L2U A;  1M1F A;  1VQ8 A;  2LQ8 A;  1YBY A;  4PLI A;  3CC7 T;  1K9M U;  5HKC A;  2DPP B;  3OW2 A;  4M77 G;  3VYH B;  2CGH A;  1YHQ A;  1VQP A;  1KC8 U;  4OB0 B;  2XHC A;  4WF2 A;  3OQ5 A;  4M78 E;  1H64 1;  2LQK A;  3OYG A;  1VQM A;  4IUQ A;  2DVE A;  3MEW A;  3SWN B;  2KMT A;  3UPU A;  1YJW T;  4XTZ A;  3PIP A;  5FU7 C;  1QVF A;  1ZBX A;  2E5Q A;  4QQG A;  3GOX A;  4P5N A;  2CZ1 B;  4C5I A;  5GAN f;  4X34 A;  4HT9 A;  3L1A A;  4LDU A;  2QA4 T;  2RJE A;  4M77 B;  5GAO n;  4ATO A;  2RM4 A;  2L3R A;  3NTK A;  4OB2 B;  3PNW C;  2VXF A;  2EQM A;  2ZCF B;  3RES A;  4BUG A;  5C0M A;  4N0A C;  3CCL A;  3BDL A;  4BB7 A;  1VQ5 T;  4ELY C;  2RHX A;  2WSC E;  3M9Q A;  1VQL T;  3OBY A;  3RUX A;  2MF2 A;  3CC2 A;  2E64 A;  1BI3 A;  4M75 F;  1QVF S;  3CXC A;  5A0D A;  2HAX A;  2GFA A;  5GAM j;  4TVR A;  1Q81 C;  1KQS A;  2OTL T;  2D6F A;  5CVI A;  1VQ4 T;  3GP8 A;  2XIC A;  1U1S A;  1WNL A;  5GAN 8;  3HRT A;  2MWP A;  5FU7 B;  1MGQ A;  3GIB A;  2VYT A;  4N4I A;  4M7D F;  3CXC S;  1JRI A;  5C6S A;  2K3X A;  4M7D E;  3CCE A;  1M90 C;  1I4K 1;  5LJ5 j;  4MML A;  2LX9 A;  1VUB A;  5GAM h;  2K3Y A;  2RI2 A;  4BE2 A;  2XD0 A;  4M77 E;  3QYH B;  3MEU A;  4JRI A;  3X25 B;  5LJ3 d;  1WJR A;  3E9G A;  5CCA A;  4PJO G;  4PKC C;  3J81 E;  4X9C A;  1Y7X A;  2PQW A;  3ASK A;  4XTY A;  1QVG A;  1K73 C;  3JB9 I;  3C4S A;  4M7A F;  1KG1 A;  1GXI E;  3CCS T;  1XOV A;  1B34 A;  2ZPI B;  2A3L A;  2YRV A;  5GAN 4;  2P0P A;  4M7D C;  2FYK A;  3CME T;  2OTJ A;  3OS5 A;  1SSF A;  3HP9 A;  4VUB A;  2MAM A;  3A8G B;  4J6X A;  2RJC A;  3A5Z B;  4C8Q F;  2VGN A;  3RER A;  2RHI A;  2V8J A;  3HPW A;  3MET A;  2JZ2 A;  1M8V A;  4A4E A;  3PT9 A;  4HCZ A;  3G6E A;  2K4Y A;  4BD3 A;  5IAY A;  4BAC A;  1W2B A;  3E9F A;  4M78 C;  3M55 A;  1YCY A;  4IUR A;  3C94 A;  2LC4 A;  3KBG A;  2K5L A;  3H6Z A;  4C0D B;  3OYY A;  3VUB A;  4ELZ C;  3CCE T;  2DK3 A;  3JSC A;  1H3Z A;  2DKG A;  4X9D A;  3PGG A;  2D0Q B;  2YLC A;  3GF5 A;  3LH0 A;  3P8D A;  5KH6 A;  3M56 A;  1IZ6 A;  1P92 A;  2P0K A;  4M78 D;  2E1H A;  5EG2 A;  2XG8 D;  3TEE A;  3CCR A;  3CCV T;  2PU9 B;  3MCA B;  4C92 B;  1Y96 A;  4C0D C;  2VGM A;  1Q82 C;  1U1T A;  1WJS A;  3CCU A;  2KK4 A;  4QVD A;  1M90 U;  1KQS S;  3SD4 A;  2M9U A;  1YIJ T;  1M1K U;  4C92 F;  2QQ9 A;  3V8K A;  3CME A;  3GPL A;  4PJO E;  2OTJ T;  4J83 A;  2R5M A;  4Q5W A;  4BY6 B;  2L5Q A;  2CYZ B;  4M78 G;  4M77 A;  3I55 A;  2F69 A;  5FRO A;  4ZN1 A;  4M7A C;  2DIG A;  2QEX A;  4BDY A;  4JDS A;  5GAM d;  4XAX B;  5GAN h;  4GY5 A;  2VV5 A;  3T9N A;  2PVO B;  4LD6 A;  4PNO A;  4PJO A;  1OYX A;  2FHD A;  3MEA A;  2MI6 A;  2ZPH B;  3OSV A;  4IUT A;  3CC4 T;  5GAN j;  2X4Y A;  1VQK A;  1VQP T;  1Q7Y U;  4BDZ A;  4LDV A;  2HD0 A;  3QYG B;  3UT1 A;  4LDX A;  4JLG A;  4XU1 A;  3M4G A;  4NS5 A;  4C5H A;  2X35 A;  1FX7 A;  3EAE A;  4IUU A;  4OB1 B;  2QDY B;  4YTL A;  2ZZD A;  4DQ2 A;  2JTF A;  3QG1 A;  1WQ7 A;  3L2W A;  5HY6 A;  1NJI C;  2KAF A;  5LJ5 g;  5GMK h;  4M75 C;  2P0Q A;  3CPW A;  2YHT A;  1Q86 C;  3G7Z A;  3LGF A;  1VQM T;  4JRP A;  4J6Y A;  4OGC A;  2DTI A;  2EJ9 A;  1UEB A;  4M7A B;  1YJ9 A;  2ZPF B;  3OYD A;  2XDB A;  2XDP A;  5I2S A;  2DAQ A;  3ZFJ A;  1M1K C;  3L2V A;  2RHU A;  4XTX A;  5CIU A;  5KCH A;  4OP0 A;  4ZGJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...