2RK1A

Dhfr r67 complexed with nadp and dihydrofolate
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
b'NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase type 2
publication title Crystal structure of a type II dihydrofolate reductase catalytic ternary complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rk1A00
2RK2A 2VV5A 2RK1A 1VIFA 2OAUA 1VIEA 3UDCA 2P4TA 3T9NA 2GQVA 3SFMA 2RH2A
chains in the Genus database with same CATH superfamily
4E7JA 3H0HA 2ENMA 3V8LA 3RESA 2K5LA 4XTWA 5KYWB 5HK0A 2B8AA 4QW2A 5DM7R 1AWOA 1ZUYA 1B7TA 3RKWA 3MKDA 1W70A 5IHIA 3REBB 2MF2A 3QZ9B 3QHSA 1VQMQ 1U8RA 5CQYA 2JTFA 2PZ1A 1W1FA 2AKLA 4X1VA 1VYTA 1OULA 2E5QA 4HCCA 1NPPA 2EGEA 1D0YA 1WQ7A 2L5QA 3TVTA 2G3RA 3JCMf 3H0FA 3LWIA 4PFZA 3TEEA 4Y91A 3I5SA 3DB4A 3FIFA 3FRNA 4JDSA 4A54A 1VQ9A 2JM8A 4RKUE 2LX7A 2X35A 2X3XD 1I5OB 1AVZC 3JB9F 4PL6A 5IAYA 4CI0C 2O4XA 1ZA1B 3G6ET 1ZSZC 5IXFA 1QQJA 4B6MA 1PC0A 4PKCC 4KBMB 1I81A 2O4XB 1SG5A 3V7SA 5J39A 1T3LA 3CCQA 2J06A 2DAQA 1R0BG 2DL8A 4HXJA 4MZTA 1K9MU 4BDYA 4BDZA 1WPYA 1KC8R 2MMPA 1PNJA 1OZ3A 2HSEB 3NFCA 1YI2Q 1NEGA 1FX7A 3KBGA 4RUGA 1I0CA 1PG5B 4OB3B 1ZSZA 2XIDA 5IHKA 2KI7A 2QQBA 3CEYA 3HRSA 2YSQA 1U1SA 3A8GB 1VQ6A 1BYMA 2RN8A 4N0AA 4C8QD 3CCUA 1PCXA 4LDUA 2GQIA 2MK5A 2YRCA 2DLPA 5GAMh 2CH4A 3I9QA 1WX6A 4J9BA 4C0DB 5LL6S 2CS7A 4M7DD 5CQXA 3PTAA 4TVRA 1UJYA 2DJZA 2FRYA 3CD6T 4LUDA 4B9XA 2RHXA 2W0ZA 2V8JA 1ZSGA 3FLGA 2EWNA 2OTJQ 1X6BA 4FSSA 3CC7Q 3MP8A 1WJQA 1YJ9Q 4C8QG 2X3WD 1R8OB 3MO8A 1OEBA 1RL2A 1W4SA 4CRIA 1YCSB 1FWZA 3PIPA 1UB4A 1KQSA 1IHWA 4M7DG 3FEOA 1KQ2A 2A3LA 2RQWA 2LP5A 4M75C 2LNHB 1RADB 4QT7A 1H3ZA 5D6YA 2Z0WA 4FYVB 1GRIA 2C0IA 2VC8A 1ZBJA 3CCEA 3JCMe 4HCBA 2FPEA 2EYYA 3OSVA 1B3QA 1QCFA 2F2WA 1AEYA 1DJ7B 3UF4A 2VGNA 3JSCA 1W2BP 5DY9A 4LD6A 4DA4A 4XTZA 5FU6C 3EFOA 2HBWA 2LQKA 3MCAB 2XDBA 4M75A 3CCLQ 1D1AA 2XMFA 1E6GA 3JCMb 4GLKA 1VQ4T 3VS4A 1NYFA 3DKMA 1KQ1A 2ZPIB 1E6HA 3QBYA 3QIIA 2CSIA 2RJDA 2L3PA 1G3WA 1LPLA 1K0XA 3OBYA 3PNWC 3C0CA 4LDVA 2RQVA 2QTVA 1RAAB 4KULA 1OZ2A 2A0FB 1MMNA 1Q7YR 4C0GA 2QI2A 4RMOA 1PHTA 1D3BB 3CMAQ 3QDRB 4M7DC 3HPWA 1Y96B 2I2LA 3RMSA 3X28B 3M0UA 1SSHA 1V76A 4JRIA 5GAN5 1PSEA 4LNPA 5KYNA 3JCMd 9ATCB 4OMOA 1Q81U 2MWOA 2FZKB 2JTEA 3CPWP 4C8QA 2DXTA 1BK2A 1X6GA 1AZEA 4X9DA 4KT0E 3EG2A 4J6WA 4C8QB 3VS0A 1WJRA 2O2OA 1TUGB 2ECZA 4M7DA 1S72T 3JCMh 3I56Q 1BI3A 4E7LA 3P8DA 2KAFA 1X01A 1WHJA 2FZGB 2YXYA 2WSFE 2KDSA 3HRTA 2O31A 2AK5A 2P0QA 1M90C 2DL7A 2E6NA 4J7FA 4IUPA 1VQ8T 3RUXA 2LZ6B 4RTZA 4C92D 2ESWA 1YI2A 1JO8A 2EYZA 3CC2T 3ASKA 1NEBA 3OYDA 2DVJA 2P0PA 1LVKA 5FWBA 2ZPFB 3CCJQ 2L3RA 1NG2A 4NOYA 2A37A 3G71Q 4EMKB 1JQQA 1MGQA 4MZPA 4J7IA 4BI8B 1T3SA 3EG0A 5L23A 3QXEB 4A4HA 4C92G 3X24B 1X6OA 1YHQQ 3M54A 2LRQA 4FCYA 2DE0X 5DLQE 4IIOA 4M78D 1G8XA 1UHCA 2E4HA 2OTJA 3JB9J 4DBFA 4F7UG 3N5BB 2XK0A 3LH5A 1YJ9A 3JCMc 2EKHA 3M58A 1EX4A 2DBMA 4OB1B 2RHUA 3LWHA 2I0NA 2FHDA 4OB0B 3HRUA 4E2FB 4R55A 3FJ5A 1UTIA 4M78G 5GAN2 2F2VA 1MV3A 2FEIA 2RD1A 3LW5E 4J9FA 3I35A 1D1CA 1PD1A 2RJEA 2CYZB 4EMHA 3JAME 1UGRB 2LVMA 1K9AA 3CPFA 4XAXB 1WDXA 1GL5A 2OJ2A 1ZUUA 4OGEA 5CKEA 4PJOE 2P84A 1WYXA 4M7AD 2O9VA 3HKSA 4M77E 3VYGA 4C0FA 1VQNQ 1G3SA 4C92C 2A7YA 1FYNA 3H8ZA 1MUZA 1VQKT 4PJOB 2FPDA 3A1PA 4CC2A 5GAOn 1WHGA 4JRQA 1TU0B 3CXCS 2HD0A 2MWPA 4BY6C 4J6YA 3PIOA 3M0RA 2CP2A 4ZN3A 4BUGA 4M7AG 2EYWA 1NJIC 1CSKA 4RTXA 1VQPQ 2AKKA 4C92A 3CMAA 3EFRA 1Q86R 2JS0A 4M4ZA 2QEXT 2A28A 2KNBB 4M78C 1YJNT 3CC4A 2NWMA 1QVGP 3SEMA 4J9CA 3CCLT 4HCKA 1M1KR 2BE7D 3OA6A 1WZOA 5A0DA 3QJYA 2BUDA 4MDWA 4F7UB 1UE9A 5IN1A 2GF7A 1K76A 2GFUA 2QQRA 1X43A 3I56A 1RACB 1YWPA 3C4SA 2DETA 2VV5A 4M78A 1KIKA 1VQ5T 3CCSQ 4KGZB 1BI1A 2JTMA 2LQNA 4RTTA 2DL3A 1OI1A 3VYHB 1H3HA 1M5Q1 4C5IA 1YIJT 1KC8U 1RI0A 3CCVQ 2Y4YA 4QQGA 2K7AA 4ATOA 3CCJA 2DM1A 1U1TA 2DIGA 3NTHA 4Z8AA 4M7AC 2FVUA 5KYYA 1OV3A 3CBMA 4FIBA 3CPWS 3OW2P 2ZAEA 4OF1A 3PVQA 3HP9A 1UGQB 3G71A 2OX7A 1FMWA 4FW2A 2E12A 3BDLA 1VQ6Q 4PJOF 4F16A 2RI3A 3GNFB 3EG3A 1OOTA 1WXBA 4M77F 1YHQA 1Y57A 5GMKh 2JT4A 2LJ1A 1R77A 2O9SA 4QQDA 4QQ6A 1YJWT 4M7AA 5CCAA 1WIEA 2FO0A 5ECAA 2CSQA 1G3YA 2ED1A 4C0ZA 1TWBA 2BZ8A 1YWOA 2K57A 2IVWA 5KYXA 1OQKA 3JCMP 4Z02A 3DLLA 4F17A 2RM4A 1WLPB 1O75A 1AD5A 2GBQA 4FL6A 1ARKA 1TXQA 1B34A 1PRMC 1KJWA 2M9UA 4PJLA 1SF9A 4IUUA 1HK9A 2EYXA 1TG0A 2PVOB 1B34B 1K73R 4GY5A 2KMTA 1N27A 2A08A 2E3IA 5GAOq 2CT3A 2P4RA 1KD1C 5FROA 2KXDA 4HT9A 4P5NA 2RK2A 1MNEA 1QCOA 1QKXA 2KEAA 3ER0A 3CCEQ 5GANj 1K8AC 1XTDA 1NYGA 1MMDA 4J9HA 2LX9A 3MEWA 5GAOp 1VQOT 1VQNA 3EH2A 2LCCA 2PNIA 8AT1B 2DVEA 4LXCA 2QGFB 2XD0A 5KYUB 3SDZA 3QYGB 4KRTA 3CBOA 1KQSP 1UEBA 3SWNB 1AHJB 2DZ9A 3CCRQ 3THKA 2CP7A 2HEQA 3TSWA 2LJ0A 1WHMA 3DB3A 4IUTA 3EGXA 1MHNA 4QVZA 3GBQA 1VUBA 4ZGDB 2YT6A 1M2OA 2P4TA 1UUEA 1VQPA 3EGXB 1HD3A 5C6SA 3EGUA 1I07A 1Q7YU 5I2MA 2EQIA 4E47A 3ZFJA 4OMQA 4JLIA 3RIRA 4LDYA 2DZCA 2GTJA 2MOXA 5FU7B 2PVGB 2EBPA 1KHCA 3OMCA 3L2WA 1TUCA 2EJ9A 4M75D 3I55T 4IUVA 4E7HA 3WXMB 2DX1A 3L2VA 2HBPA 5GANf 1XJWB 5L8RE 2X51A 4JS5A 3CMEA 1IGUA 3CCSA 1I1JA 1U5SA 3EFSA 3AT1B 5GANg 2LJ3A 3RERA 1X2QA 2LT1A 1NBEB 2VKNA 1UGPB 2OTLQ 1ZBXA 3TCJA 2PVDB 1BBZA 4M75G 2SRCA 4PJMA 1YP5A 3CCVA 1I8FA 1IO6A 1QVGS 3OYAA 2CP6A 2AZSA 1M1GA 2CGHA 2V1RA 3OS0A 1K9MC 2QASA 5LJ5j 2LDMA 2XI9A 2B86A 2YHTA 1VQ9T 1OX9A 4IIMA 4A4EA 1D1BA 3MP6A 1ZSZB 2RH2A 3META 5I22A 2MIOA 4JUVA 3L42A 1BI0A 2F69A 4OGCA 1N8RR 2D6FA 2RHYA 1Q82R 2J6OA 1RAGB 4D8KA 1I5LA 2CKKA 2EW3A 3CCQT 3EHQA 2RB6A 3VS2A 3M4YA 2RJFA 1RI9A 3L2UA 2HKQB 3G4SQ 3D7SB 1OPKA 1IGQA 2HKNA 3VRYA 5IH2A 3CXCP 3OW2S 4D8DA 2DYIA 3EH1A 3J7AF 1SEMA 1QWFA 3RKXA 2CZ6B 5I11A 1CKBA 3CCUT 2AHJB 1WXTA 3VRZA 3QO3A 2O88A 2WACA 3VV0A 1BCMA 2JNGA 1T0HA 4II1A 2E10A 1YFNA 3CCMA 2JVVA 4HVUA 1C6VX 1A0NB 2QDLA 2JOYA 1C1AA 3KXTA 2ZPEB 2R57A 3F70A 3BY7A 2E1HA 5GAN8 5GAN4 3NMZC 5GAN7 4NL2A 4PJJA 1VQLA 2YRVA 1YNZA 3X26B 2K3YA 3L2ZA 2GFAA 1IZ6A 1JJ2P 4F14A 5LJ5g 2DXCA 3EFOB 2HNIA 1G5VA 2DD5A 2KYMA 2DXUA 4OP0A 4M75B 4DBHA 1PM3A 5GJWB 3CCRA 1W6XA 2KR3A 2J6FA 2KT8A 4ZGJB 4O6JA 2V8IA 1SKUB 3M53A 2DBKA 3CCET 3M4GA 1NZ9A 1QVFA 5FU6B 2LT4A 4E7IA 2E6ZA 1H92A 3OYJA 1Q86U 4WF2A 4JPBW 1ZQ1A 1RAIB 3SD4A 3CC4Q 1K0SA 4C8QE 3GPLA 2QA4Q 1M1FA 1VYVA 4K11A 1M1KU 3P8BB 5GANd 1AWXA 2X4WA 3HTRA 4B9WA 4RCBA 1SHGA 3NHNA 4NS5A 1KQSS 1G83A 2J6KA 1JB0E 2EGCA 1M2VA 3U23A 1K1ZA 2NYSA 4R0KA 3PMTA 3MJXA 2YUPA 4M7DB 1X69A 2HL3A 2EJGA 2KSSA 4FYYB 5LJ3j 2OTLA 2OI3A 3V7RA 2COYA 1VQMT 2JMAA 3M9QA 2DFUA 3H41A 2EQUA 3RDVA 4L5GA 3JCMX 2LQWA 3RNJA 4OMMA 1B07A 1VQ7Q 2HSPA 4XQ3A 4BI4A 2CT4A 3UDCA 2L8DA 1N9SA 3M5AA 2WSCE 5D6WA 3VJPA 1M4ZA 3E1SA 2KRMA 3MEVA 2OAUA 2BIVA 4ME7A 1TUDA 3P8HA 4D6WA 4J8OA 3HHTB 1Z9QA 2R5AA 1SHFA 2J7IA 1NLOC 4PK4A 2RJCA 1YCYA 3FC3A 3QWXX 1YI2T 3G4SA 2L0AA 5FRNA 4XU0A 3V8JA 2DL5A 3C12A 4AG1C 1W2BA 1QVPA 5LJ3f 2DKGA 1H8KA 2DYBA 4E6RA 1XOVA 1UG1A 1YITQ 5LJ3g 4DOVA 2DRMA 1K73U 4C8QF 2PUKB 2RI5A 5LJ5d 4KUDK 1GFDA 1WHLA 3OS2A 2CZ1B 4DEYA 4BE2A 1M9SA 2DTOA 5HKCA 2HZYA 2OTJT 3GNGA 3FDRA 3CC7T 2A36A 1YJ9T 4M77C 1YN8A 4LDXA 1AWJA 1J3TA 4N4HA 4XTUA 2D9TA 3S6WA 2QGGA 2XDDA 3QJ6A 2QEXA 2L2PA 4AFQC 1BB9A 2QQAA 4WTOB 4XK8E 4C92E 2HAXA 3CPWA 3LLRA 1PWTA 3JB9D 1X75C 5FRMA 5D7UA 4BE0A 3A8OB 2VGMA 2RHZA 4FU6A 4KGXB 1HXDA 3EGDA 1P92A 4JLGA 3IQLA 8ATCB 3M0SA 5GAOl 4C92B 5CR2A 4F7UE 2E70A 1AOJA 3EGDB 4WCIA 5GAMj 2QA4A 1JJ2S 3JCMV 3HFOA 3G6EQ 2IIMA 4BY6B 1QW1A 4FSXA 3A8LB 1AZGB 3E9FA 3SB2A 3M56A 3JB9G 4AT1B 3OSSC 3R6NA 3TREA 2G6FX 4CC7A 2XDPA 1Y0MA 2EPDA 3CMEQ 3MP1A 1FMVA 5KE2A 1SSFA 1D09B 3NPFA 4PJNA 4M78B 1S1NA 3CMAT 2KRSA 1ZHIA 4PFPA 3MEUA 1IRXA 4YTLA 5J26A 1NM7A 1PKTA 3JCMJ 4R56A 1M90R 4BI3A 4PFOA 3CC4T 4OMFB 3JCMW 4QKUA 4DBRA 2HQEA 2RQUA 2XHCA 2XU8A 4N4IA 1VQ7A 1IREB 2BZYA 1BKBA 4XTVA 2LQ8A 2BTTA 3GP8A 1KC8C 3M55A 3CD6Q 1QKWA 5KYYB 3I56T 4LN2A 1RAFB 1JBMA 2AZVA 3INZA 2K5IA 5GAMf 1AT1B 3SHWA 1UJ0A 4FT2A 3FB9A 1N8RU 1UECA 1Q82U 2D0NA 3MEAA 1TS9A 5GAMg 4M7AB 1RAHB 3EAEA 4F04B 1WHKA 5CO7A 4DOWA 2LC4A 4PLIA 5LJ3d 4ORZA 4C92F 3H9NA 3CCJT 4Y28E 4JS4A 5I21A 5KYXB 1MV0B 4JZ4A 4RTWA 4RG2A 1UFFA 4LE9A 3OYKA 3G71T 1FMKA 3PE0A 5GMKi 4HT8A 1KG1A 1YITA 1VQOA 2AT1B 1WFWA 5FLXE 4F7UF 1N6AA 3GLXA 3I5RA 1YHQT 1SPKA 5DLOA 2D1XA 1Q95G 1VOMA 4BD3A 1VQ4Q 3PVLA 3ULRB 3CCMQ 2DXBA 5CKHA 3PGGA 1GBRA 2CP0A 4ZTJA 4BACA 1NPRA 1VQLQ 1N5ZA 4M78F 3FJPA 2NUTA 3J80E 1GBQA 2AIRB 4ESRA 1RUWA 4AFZC 1T0JA 2RMOA 7AT1B 3RBBB 1JEGA 5I2SA 1PSFA 2D8JA 4AG2C 2VWFA 5HK3A 1ZX6A 2DTIA 4MDXA 1SRMA 3ZBDA 2RQTA 4A4FA 3X20B 3BE3A 2K2MA 4QVCA 2ZCFB 3OYBA 2HMAA 4XTXA 1X27A 1JRIA 2FRWA 2KYBA 3UA7A 4MMLA 1WJSA 2QG9B 2EQJA 4MZMA 2NLUA 3C94A 3OS5A 4XTYA 2CZ7B 3A98A 1NJIR 3PFSA 3I55A 3UWNA 1I4K1 1XQHA 4KH0B 5KYWA 2GCXA 2EKOA 1VQNT 4CC4B 1S72Q 3H0IA 3WVEB 1X2KA 1Q7YC 4J9DA 3G6EA 1KFZA 3URGA 5CAIA 5GAMe 4M7AF 4EPCA 5IXBA 3QDFA 2HQXA 3MPUB 5AYFA 2MYSA 3O5ZA 2C06A 2VXEA 2XICA 1JXOA 2VXFA 2RA2A 4QVDA 2K4YA 2CZ0B 2O01E 2SEMA 1VQ8Q 3V7CA 4KH1B 2L89A 3CC2Q 1EZZB 5AT1B 2RQRA 1VQPT 1QVFP 2MI6A 3RKYA 4DBQA 2RF0A 3OW2A 2XG8D 4HVVA 1ZLMA 2M0YA 2DTHA 3H6ZA 4EDUA 3JCMg 2DD4A 2ROTA 2VUBA 1RAEB 3OB9A 3OQ5A 2K2VA 2NUPA 3OS1A 3A8MB 3OBWA 3S3NA 4ZGEB 1G3TA 1OPLA 1UDLA 2OAWA 4X34A 2NUPB 1M3BA 1TH7A 4RTUA 3CD6A 2ZPHB 4N0AC 2FPFA 4C0DC 1VYUA 2GGRA 2QK0A 2Y90A 3UT1A 1EIFA 4JZ3A 3CMET 5GAMd 3CCST 4HCZA 3LH0A 3GIBA 2DRKA 2IG0A 4E7KA 3E19A 2DK3A 4Q5WA 2M02A 5D6XA 5IT9E 3LGLA 3BDUA 2EAYA 5FWCA 4RTYA 3CCVT 1LNXA 1EFNA 4A4GA 1QP3A 4ZNXA 2C0OA 2KXCA 3Q1JA 2E5KA 5A2QE 2DIQA 2HCKA 2DA9A 4ZN1A 2P0KA 2ROLA 5GMKl 2QTXA 1G2BA 1LCKA 1V1CA 1VQ6T 3GF5A 1CKAA 3BFMA 2X9HA 1VQ4A 1KD1R 2KK4A 2V8KA 3L1AA 3ZL7C 3VS5A 1VQKQ 3CQTA 4OMPA 3OYEA 2F5TX 2CP5A 5LJ5f 1K8AR 5GANe 2KE9A 4M75E 3LGFA 2H3EB 1H641 1QCNA 2K6DA 2L3QA 3M0QA 1PRLC 4JJCA 2EFIA 2F1LA 5A0LA 1PD0A 4XU1A 5FW9A 1MNDA 2M51A 2VYTA 1ZUKA 4HVWA 4E7SA 4J6XA 2E41A 1PKSA 3OYNA 2V1QA 1NLPC 3S3OA 3OYLA 4L59A 3SFMA 3G7ZA 4RTVA 2QEXQ 2V26A 1WNLA 2MCNA 3PT9A 3L2QA 1YJNQ 5KH6A 1D0XA 3RR6A 3LX7A 2QYZA 2ED0A 2BKDN 2VVKA 3CCMT 2X4YA 4E7ZA 2ZPGB 3HSBA 1WHHA 4V2SA 1RABB 2LCSA 2K3BA 1VQLT 1F1BB 2M0OA 1V29B 1S72A 3VUZA 1HJDA 1JXMA 1LOJA 3HFNA 1BI2A 1D3BA 4C8QC 4DEXA 1XNIA 2GQVA 4C5GA 2ZPBB 1M8MA 1VQ5Q 1U06A 5GMKj 1Y96A 2GNCA 1Q86C 4PLLA 4RCCA 3CCRT 1U3OA 2YRDA 2K5FA 1K4US 4M7DE 2H8HA 4CC3A 1Q81C 4OB2B 1VQMA 3A8HB 1VQ8A 5GAOm 1M1KC 1WI7A 2KY9A 3CC2A 5HY6A 1WA7A 1YIJQ 1VIFA 1SRLA 1M2VB 2DMOA 4FW1A 5GANh 4BB7A 1KSWA 1MMAA 4PJOD 3TQ7P 3ME9A 2K3XA 1O9SA 3X25B 2DL4A 4UC4A 4M77D 2NUZA 4GBQA 4VUBA 1ABOA 2DF6A 2LMJA 3NTKA 2R5MA 1M90U 2JN0A 4EMKC 1AWWA 2W10A 1RLPC 5GAN3 1BU1A 3E2UA 2FZCB 2YWWA 3BW1A 1K9MR 5LJ5e 2FB7A 1YJWQ 3CBPA 2X4XA 4PJOG 1WXUA 2YLCA 3EG1A 4M75F 4M77G 1Z9ZA 2KVQG 3QSUA 3C95A 1BIBA 2KQWA 3NTIA 1ACMB 1UGVA 4BE1A 4OMNA 4EMKA 4XU2A 1QVFS 4PNOA 2OTLT 1M30A 3CXCA 3PMIA 1KHIA 2DEQA 2KROA 4IKFA 5A0GA 4OMLA 2EYQA 3OYYA 2COZA 5GJVB 5GAOr 2KT1A 1D0ZA 1WGSA 2RO0A 2EVRA 4A53A 1HSQA 4X9CA 2K79A 3UA6A 3DLMA 2HQHA 2QAZA 3VS3A 1OX8A 1QP2A 2EGAA 2RNAA 2EJFA 3KFVA 2ZGWA 2MAMA 4AFUC 3KUFA 3CC7A 4HKEA 3L2RA 4N4GA 4LDWA 6AT1B 1JJ2A 3T9NA 1VQOQ 2CREA 2J05A 1KK7A 2JZ2A 3VKIA 3QKJA 3QPHA 2HL5C 1QWEA 3ZEHA 1VQKA 1UGSB 1OYXA 4J5YA 4GLMA 2QDYB 2X4JA 5C0MA 2F5KA 3OYHA 3S3MA 1OU8A 4M7DF 1K73C 2YUNA 2FG0A 4J9IA 4PJOC 3VU3C 4J83A 4KUIA 3VUBA 1TTHB 3VS1A 3G4ST 1R0CB 2PUOB 1GFCA 5LJ5h 1BCOA 4JRPA 1VIEA 2PQWA 1TOVA 1QLYA 3VS7A 5GAN6 2YUQA 1YJNA 4J9GA 2D8HA 4HA8A 3JRZA 4LUEA 3CCLA 3OMGA 3MHXA 4PJOA 1QMCA 4MMKA 4FM4B 2CP3A 4M77A 4NL3A 3GOXA 3TSZA 5KCHA 3A5ZB 3JV3A 3R6OA 2QQSA 1IHVA 2DO3A 4M77B 3I55Q 1NJIU 2H3JA 1YBYA 4LD9K 4ELYC 2EIFA 2CUBA 3JB9H 1Y71A 1GXIE 1VQ5A 1M8VA 2EQMA 5CVIA 5CK9A 2Y4XA 4XU3A 2F2XA 2DNUA 2FYKA 2LNVA 5GMKe 2DILA 1W2BS 2WSEE 1Q81R 2JMCA 2KGTA 4M78E 2RK1A 1ABQA 1MMGA 2VB6A 1YIJA 4F7UA 2YUOA 2RHIA 3QZ5B 1LJOA 1M27C 2KRNA 2RPNA 2EQKA 4Z89A 3TU4K 2M16A 2E64A 5LJ3e 5CIUA 2DEUA 3NGPA 1VQ9Q 2FL7A 2C0TA 4ELZC 5M9OA 3QYHB 3HL8A 2QA4T 2K9GA 2BE9B 4ZTFA 4IUQA 1ZA2B 2COWA 1M3AA 1YJWA 2GTOA 2L3SA 1Y07A 3LYIA 3WVDB 3EG9A 3CCQQ 3REAB 1IXDA 1BIAA 2JXBA 4OVAA 2CH4W 5KE3A 3EG9B 3JCMQ 2LTOA 1UHFA 4JJDA 3UATA 4M7AE 2YDLA 4FYXB 2E3HA 5IHNA 4FYWB 2RI2A 3QWYA 4IURA 5KCOA 2LCLA 2YLBA 1E7OA 2BZXA 3OYGA 3CCUQ 2MPXC 2QQ9A 4AMCA 2PTKA 3M59A 1VQ7T 3OYIA 1N8RC 1GCQC 1JU5C 1Q82C 3M0TA 2JM9A 2JS2A 1C0MA 4O5VA 2PU9B 2IPOB 2KBTA 5CKDA 1HYOA 3VS6A 2VASA 2CDTA 2CUDA 2XKOC 5EG2A 4FT4A 4JRKA 3M0PA 2M1HA 5HCKA 5LJ3h 2D0QB 3G1JA 4EMGA 1GCQA 2R58A 4J9EA 2JW4A 1KD1U 2ZZDA 3EHRA 3UPUA 4C5HA 2DJQA 2DERA 3E9GA 5GMKm 1TSFA 1OU9A 2JUFA 2JJ9A 3OYFA 1WQWA 3QG1A 3OY9A 3J81E 3OYMA 2ATCB 1M3CA 3SWNC 1K8AU 3OYCA 4KGVB 5J3BA 4RG8A 4Y92A 3QUIA 1IB8A 2NUTB 1N9RA 4JJNK 1FXXA 2DPPB 2ABLA 4AFSC 3RMQA 1YITT 1QVGA 1NE8A 5KYUA 4A4KA 2QXFA 1VA7A 5EC7A 3SWNA 1RLQC 5CKFA 2HDAA 3V8KA 4ANJA 3JB9I 3AHUA 3M57A 3O8VA 4L6V5 4JJBA 4EIKA 5FU7C 4C5EA 4DQ2A 4A63B 2E65A 5CKBA 4Z88A 1Y7XA 1GCPA
chains in the Genus database with same CATH topology
3HHTB 2F5TX 4E7JA 5LJ5f 1VQ5T 5GANe 3V8LA 3RESA 2R5AA 1BI1A 2K5LA 4M75E 4XTWA 3LGFA 2JTMA 5HK0A 2B8AA 1H641 4QW2A 5DM7R 2RJCA 2EFIA 3RKWA 1OI1A 1YCYA 3FC3A 1YI2T 5A0LA 3G4SA 4XU1A 3VYHB 2MF2A 1M5Q1 2VYTA 5FRNA 4XU0A 4C5IA 3V8JA 1YIJT 3QZ9B 1KC8U 1RI0A 4J6XA 2E41A 3QHSA 2Y4YA 3C12A 3OYNA 4QQGA 4ATOA 3S3OA 1U8RA 3OYLA 4L59A 3SFMA 5CQYA 3CCJA 1U1TA 2DIGA 2JTFA 1QVPA 3G7ZA 3NTHA 1W2BA 2FVUA 4M7AC 1WNLA 3CBMA 3PT9A 5LJ3f 2DKGA 2E5QA 4FIBA 3L2QA 3CPWS 5KH6A 4HCCA 1NPPA 3LX7A 4OF1A 1WQ7A 2L5QA 3HP9A 1UGQB 3G71A 2G3RA 3JCMf 1XOVA 2BKDN 3TEEA 3LWIA 4Y91A 5LJ3g 2E12A 3DB4A 3FIFA 3FRNA 4JDSA 2X4YA 3BDLA 4A54A 4DOVA 3CCMT 4PJOF 1K73U 2RI3A 4RKUE 2PUKB 3GNFB 4C8QF 2ZPGB 2RI5A 5LJ5d 2X35A 4KUDK 3HSBA 4V2SA 4M77F 1YHQA 3JB9F 4PL6A 3OS2A 2CZ1B 5IAYA 5GMKh 4CI0C 1VQLT 2O4XA 2M0OA 4BE2A 1V29B 1S72A 3VUZA 1M9SA 1LOJA 2DTOA 4QQDA 3HFNA 4QQ6A 5HKCA 3G6ET 1YJWT 4M7AA 2OTJT 3GNGA 3FDRA 3CC7T 4PKCC 1BI2A 1D3BA 4KBMB 4C8QC 1I81A 5CCAA 1XNIA 2GQVA 2O4XB 1YJ9T 4C5GA 2ZPBB 3V7SA 4C0ZA 1G3YA 4M77C 5J39A 3CCQA 5GMKj 1Y96A 4LDXA 2DAQA 2K57A 1Q86C 4PLLA 4MZTA 2IVWA 4N4HA 4RCCA 1K9MU 3JCMP 4Z02A 4BDYA 3CCRT 4BDZA 1WPYA 4XTUA 2K5FA 2MMPA 3DLLA 2D9TA 2RM4A 4M7DE 1OZ3A 1Q81C 1O75A 4OB2B 1VQMA 3S6WA 3A8HB 3NFCA 1VQ8A 4FL6A 2XDDA 5GAOm 3QJ6A 1M1KC 2QEXA 1FX7A 2KY9A 1B34A 3CC2A 5HY6A 3KBGA 2M9UA 4OB3B 1VIFA 1HK9A 4IUUA 2QQAA 2XIDA 4XK8E 2PVOB 1B34B 2QQBA 3CEYA 4GY5A 5GANh 2KMTA 3HRSA 4BB7A 1N27A 4C92E 1U1SA 3A8GB 1VQ6A 2HAXA 1BYMA 4PJOD 3CPWA 3ME9A 4N0AA 4C8QD 3CCUA 5GAOq 2K3XA 1KD1C 1O9SA 4LDUA 5FROA 3X25B 3LLRA 4UC4A 4P5NA 2RK2A 4HT9A 4M77D 3JB9D 5GAMh 1X75C 4VUBA 5FRMA 4BE0A 3A8OB 3ER0A 2VGMA 2RHZA 4FU6A 3NTKA 1HXDA 2R5MA 4C0DB 1P92A 4JLGA 5LL6S 5GANj 2CS7A 5GAOl 4C92B 1XTDA 5CR2A 1K8AC 1M90U 4F7UE 2JN0A 4M7DD 5CQXA 4EMKC 2E70A 2LX9A 3MEWA 5GAN3 3PTAA 4TVRA 2DJZA 2QA4A 5GAMj 1JJ2S 4B9XA 3CD6T 5GAOp 1VQOT 3BW1A 3JCMV 1VQNA 2RHXA 3HFOA 2V8JA 2LCCA 5LJ5e 2FB7A 3FLGA 2EWNA 4BY6B 1QW1A 4FSXA 3CBPA 2X4XA 3MP8A 1WJQA 4PJOG 4C8QG 2DVEA 3A8LB 1R8OB 3E9FA 3SB2A 2XD0A 3M56A 3MO8A 2YLCA 3QYGB 4M75F 4M77G 3SDZA 2KVQG 3CBOA 1RL2A 1UEBA 3SWNB 3JB9G 3QSUA 3C95A 1AHJB 1BIBA 1W4SA 2KQWA 3OSSC 4CRIA 2DZ9A 1FWZA 3TREA 3PIPA 1UB4A 1KQSA 2XDPA 3NTIA 4M7DG 3FEOA 4BE1A 4EMKA 3DB3A 4IUTA 4XU2A 1MHNA 3MP1A 4QVZA 4PNOA 2OTLT 1KQ2A 1VUBA 4ZGDB 5KE2A 1QVFS 2A3LA 3CXCA 1KHIA 2DEQA 1SSFA 3PMIA 4IKFA 5A0GA 2EYQA 2P4TA 4M75C 3OYYA 5GAOr 4M78B 1VQPA 3CMAT 1H3ZA 1ZHIA 1WGSA 5D6YA 3MEUA 2RO0A 5C6SA 4YTLA 4A53A 5J26A 2VC8A 3JCMJ 3CCEA 4R56A 4BI3A 3JCMe 1Q7YU 5I2MA 4X9CA 4HCBA 3CC4T 4OMFB 3OSVA 3JCMW 4E47A 3DLMA 1DJ7B 3ZFJA 2HQEA 2VGNA 2XHCA 2XU8A 3JSCA 4JLIA 4N4IA 5DY9A 1VQ7A 4LD6A 3RIRA 4LDYA 4DA4A 1QP2A 4XTZA 5FU6C 1IREB 2DZCA 1BKBA 2EJFA 4XTVA 2LQKA 2ZGWA 3MCAB 2LQ8A 5FU7B 2XDBA 2MAMA 2PVGB 3KUFA 4M75A 3CC7A 4HKEA 3GP8A 1KHCA 3L2RA 3OMCA 3JCMb 3M55A 4N4GA 4GLKA 4LDWA 3L2WA 2EJ9A 1VQ4T 3T9NA 1JJ2A 4M75D 3I55T 3DKMA 4IUVA 3I56T 4E7HA 1KQ1A 2ZPIB 2JZ2A 3VKIA 3WXMB 3L2VA 3QBYA 3QKJA 3QPHA 2HBPA 3QIIA 5GANf 5L8RE 3ZEHA 1VQKA 4JS5A 2RJDA 3CMEA 1UGSB 1JBMA 1G3WA 1OYXA 4J5YA 3CCSA 3INZA 2QDYB 2X4JA 5C0MA 2F5KA 3OBYA 3OYHA 3EFSA 3PNWC 2K5IA 4LDVA 5GAMf 5GANg 3S3MA 4M7DF 1K73C 3RERA 4FT2A 3FB9A 2LT1A 1N8RU 4PJOC 3VU3C 4J83A 4KULA 4KUIA 1Q82U 3VUBA 1OZ2A 3MEAA 4C0GA 1UGPB 2QI2A 4RMOA 1ZBXA 3TCJA 5GAMg 3G4ST 4M7AB 3EAEA 2PUOB 2PVDB 5CO7A 5LJ5h 1D3BB 4M75G 4DOWA 4JRPA 2LC4A 1VIEA 3QDRB 2PQWA 4M7DC 3HPWA 4PLIA 3CCVA 1I8FA 1Y96B 1QVGS 5LJ3d 3CCJT 2I2LA 4C92F 3RMSA 3OYAA 4Y28E 3X28B 4JS4A 5I21A 5GAN6 4RG2A 1M1GA 2CGHA 4JRIA 1PSEA 3JCMd 5GAN5 3OS0A 1YJNA 1K9MC 5LJ5j 1Q81U 3OYKA 4HA8A 2LDMA 3G71T 2MWOA 2XI9A 3JRZA 3CCLA 3OMGA 2YHTA 3MHXA 5GMKi 4HT8A 4C8QA 1YITA 4MMKA 1VQOA 4PJOA 1KG1A 1VQ9T 4A4EA 2DXTA 4FM4B 5FLXE 4F7UF 4M77A 3MP6A 1N6AA 3GLXA 4X9DA 2RH2A 4KT0E 3META 4NL3A 3GOXA 1YHQT 5DLOA 5KCHA 4J6WA 4C8QB 3A5ZB 3R6OA 1WJRA 4BD3A 4JUVA 2QQSA 3L42A 4M7DA 1BI0A 2DO3A 4M77B 2F69A 1S72T 1NJIU 3JCMh 2H3JA 1YBYA 4OGCA 4LD9K 4ELYC 2DXBA 2D6FA 1BI3A 2EIFA 2RHYA 4E7LA 3P8DA 2KAFA 1X01A 5CKHA 3PGGA 1KC8C 1I5LA 3JB9H 1Y71A 2KDSA 2WSFE 2CKKA 3HRTA 3CCQT 4BACA 1NPRA 4ZTJA 1VQ5A 4M78F 1GXIE 1M8VA 2EQMA 3FJPA 3J80E 5CVIA 5CK9A 2P0QA 2RB6A 2Y4XA 4XU3A 3M4YA 1M90C 2RJFA 2FYKA 1VQ9A 2E6NA 4J7FA 3L2UA 2LNVA 4IUPA 3RUXA 5I2SA 5GMKe 1PSFA 1VQ8T 4C92D 1W2BS 2WSEE 1YI2A 3CC2T 3ASKA 5HK3A 3OYDA 4M78E 2RK1A 2DTIA 4MDXA 2P0PA 3ZBDA 4A4FA 1YIJA 3X20B 4F7UA 3OW2S 4QVCA 2RHIA 1LJOA 2ZCFB 2L3RA 2ZPFB 3QZ5B 3OYBA 4XTXA 3J7AF 1JRIA 3RKXA 2CZ6B 4MMLA 3CCUT 1WJSA 2AHJB 4NOYA 2EQKA 2EQJA 3QO3A 2WACA 3TU4K 4MZMA 3VV0A 4EMKB 2NLUA 3C94A 3OS5A 2JNGA 2E64A 2M16A 1MGQA 2CZ7B 4MZPA 4XTYA 5LJ3e 4J7IA 5CIUA 4II1A 4BI8B 3PFSA 3I55A 2E10A 3UWNA 2FL7A 3CCMA 3QXEB 2JVVA 1I4K1 1XQHA 4A4HA 4C92G 4ELZC 5M9OA 2JOYA 3QYHB 3X24B 3KXTA 1X6OA 2ZPEB 2R57A 3F70A 2LRQA 3BY7A 2E1HA 3M54A 5GAN8 2GCXA 3HL8A 5GAN4 2QA4T 4ZTFA 4IUQA 2EKOA 5DLQE 5GAN7 4NL2A 1VQNT 1VQLA 2YRVA 4M78D 3WVEB 3X26B 1Q7YC 2K3YA 3G6EA 1YJWA 3L2ZA 1Y07A 1IZ6A 2GFAA 2OTJA 3JB9J 3URGA 5CAIA 4F7UG 3N5BB 5LJ5g 5GAMe 2XK0A 3LYIA 2DXCA 1YJ9A 4M7AF 4EPCA 2HNIA 3WVDB 1G5VA 2DD5A 2DXUA 3JCMc 3M58A 2HQXA 4OP0A 1BIAA 4M75B 4OB1B 5AYFA 2C06A 2RHUA 3CCRA 2VXEA 4OVAA 2XICA 5KE3A 3LWHA 2VXFA 2RA2A 4QVDA 2K4YA 2CZ0B 2LTOA 2O01E 3JCMQ 2FHDA 3V7CA 2L89A 4M7AE 4OB0B 3HRUA 4ZGJB 4O6JA 4R55A 2RI2A 4IURA 2V8IA 1VQPT 4M78G 5KCOA 5GAN2 2LCLA 2YLBA 2MI6A 3RKYA 3OW2A 2XG8D 3M53A 2RD1A 3CCET 3M4GA 1NZ9A 1QVFA 3LW5E 5FU6B 2DTHA 2LT4A 4E7IA 3H6ZA 3OYGA 2QQ9A 2RJEA 4EDUA 2CYZB 2E6ZA 3JCMg 4EMHA 2DD4A 3JAME 3M59A 1UGRB 1VQ7T 3OYIA 2VUBA 1N8RC 2LVMA 1Q82C 3CPFA 3OB9A 3OQ5A 3OYJA 4XAXB 2K2VA 3OS1A 1Q86U 3A8MB 4WF2A 3OBWA 3S3NA 1ZQ1A 4ZGEB 3SD4A 1G3TA 4OGEA 4O5VA 5CKEA 4PJOE 2PU9B 4C8QE 3GPLA 5CKDA 4X34A 4M7AD 1TH7A 3HKSA 1M1FA 4M77E 3VYGA 4C0FA 1M1KU 3P8BB 2ZPHB 4N0AC 3CD6A 1G3SA 2XKOC 5EG2A 4FT4A 4C0DC 5GANd 2X4WA 4C92C 2A7YA 4B9WA 4RCBA 4JRKA 3H8ZA 2Y90A 4NS5A 1KQSS 3UT1A 2M1HA 1VQKT 1EIFA 4PJOB 5LJ3h 3CMET 2D0QB 1JB0E 5GAMd 4EMGA 4HCZA 5GAOn 3LH0A 3CCST 4JRQA 3GIBA 3CXCS 2R58A 2IG0A 4E7KA 1KD1U 2ZZDA 3UPUA 2HD0A 2MWPA 4BY6C 4C5HA 4J6YA 3E9GA 3E19A 3PMTA 5GMKm 2DK3A 2JUFA 4Q5WA 3PIOA 1WQWA 3QG1A 2EJGA 2KSSA 3OY9A 5LJ3j 3OYFA 4M7DB 3J81E 5D6XA 4ZN3A 4BUGA 3OYMA 3SWNC 2OTLA 5IT9E 4M7AG 1K8AU 3V7RA 3OYCA 3LGLA 3BDUA 1NJIC 2EAYA 5J3BA 4C92A 4RG8A 3CMAA 3EFRA 3QUIA 3CCVT 1LNXA 1VQMT 4A4GA 1QP3A 1N9RA 3M9QA 2QEXT 2EQUA 4JJNK 3Q1JA 4L5GA 4M78C 3JCMX 1YJNT 3CC4A 5A2QE 2DIQA 4ZN1A 1FXXA 3CCLT 2DPPB 2P0KA 3OA6A 1YITT 3RMQA 4XQ3A 2QTXA 5GMKl 4BI4A 1NE8A 1QVGA 3UDCA 2L8DA 1N9SA 4A4KA 1VQ6T 5A0DA 2QXFA 3M5AA 2WSCE 3QJYA 3SWNA 5D6WA 2BUDA 3GF5A 4MDWA 4F7UB 5CKFA 3VJPA 1M4ZA 3BFMA 3E1SA 3V8KA 3JB9I 3AHUA 5IN1A 2GF7A 1VQ4A 3MEVA 2OAUA 3M57A 2GFUA 2KK4A 3O8VA 4L6V5 2BIVA 2QQRA 3I56A 2V8KA 4ME7A 3L1AA 3C4SA 5FU7C 2VV5A 4C5EA 3P8HA 4D6WA 4DQ2A 4J8OA 2E65A 4M78A 5CKBA 1Y7XA 3OYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RK2 A;  2VV5 A;  2RK1 A;  1VIF A;  2OAU A;  1VIE A;  3UDC A;  2P4T A;  3T9N A;  2GQV A;  3SFM A;  2RH2 A; 
#chains in the Genus database with same CATH topology
 4E7J A;  3H0H A;  2ENM A;  3V8L A;  3RES A;  2K5L A;  4XTW A;  5KYW B;  5HK0 A;  2B8A A;  4QW2 A;  5DM7 R;  1AWO A;  1ZUY A;  1B7T A;  3RKW A;  3MKD A;  1W70 A;  5IHI A;  3REB B;  2MF2 A;  3QZ9 B;  3QHS A;  1VQM Q;  1U8R A;  5CQY A;  2JTF A;  2PZ1 A;  1W1F A;  2AKL A;  4X1V A;  1VYT A;  1OUL A;  2E5Q A;  4HCC A;  1NPP A;  2EGE A;  1D0Y A;  1WQ7 A;  2L5Q A;  3TVT A;  2G3R A;  3JCM f;  3H0F A;  3LWI A;  4PFZ A;  3TEE A;  4Y91 A;  3I5S A;  3DB4 A;  3FIF A;  3FRN A;  4JDS A;  4A54 A;  1VQ9 A;  2JM8 A;  4RKU E;  2LX7 A;  2X35 A;  2X3X D;  1I5O B;  1AVZ C;  3JB9 F;  4PL6 A;  5IAY A;  4CI0 C;  2O4X A;  1ZA1 B;  3G6E T;  1ZSZ C;  5IXF A;  1QQJ A;  4B6M A;  1PC0 A;  4PKC C;  4KBM B;  1I81 A;  2O4X B;  1SG5 A;  3V7S A;  5J39 A;  1T3L A;  3CCQ A;  2J06 A;  2DAQ A;  1R0B G;  2DL8 A;  4HXJ A;  4MZT A;  1K9M U;  4BDY A;  4BDZ A;  1WPY A;  1KC8 R;  2MMP A;  1PNJ A;  1OZ3 A;  2HSE B;  3NFC A;  1YI2 Q;  1NEG A;  1FX7 A;  3KBG A;  4RUG A;  1I0C A;  1PG5 B;  4OB3 B;  1ZSZ A;  2XID A;  5IHK A;  2KI7 A;  2QQB A;  3CEY A;  3HRS A;  2YSQ A;  1U1S A;  3A8G B;  1VQ6 A;  1BYM A;  2RN8 A;  4N0A A;  4C8Q D;  3CCU A;  1PCX A;  4LDU A;  2GQI A;  2MK5 A;  2YRC A;  2DLP A;  5GAM h;  2CH4 A;  3I9Q A;  1WX6 A;  4J9B A;  4C0D B;  5LL6 S;  2CS7 A;  4M7D D;  5CQX A;  3PTA A;  4TVR A;  1UJY A;  2DJZ A;  2FRY A;  3CD6 T;  4LUD A;  4B9X A;  2RHX A;  2W0Z A;  2V8J A;  1ZSG A;  3FLG A;  2EWN A;  2OTJ Q;  1X6B A;  4FSS A;  3CC7 Q;  3MP8 A;  1WJQ A;  1YJ9 Q;  4C8Q G;  2X3W D;  1R8O B;  3MO8 A;  1OEB A;  1RL2 A;  1W4S A;  4CRI A;  1YCS B;  1FWZ A;  3PIP A;  1UB4 A;  1KQS A;  1IHW A;  4M7D G;  3FEO A;  1KQ2 A;  2A3L A;  2RQW A;  2LP5 A;  4M75 C;  2LNH B;  1RAD B;  4QT7 A;  1H3Z A;  5D6Y A;  2Z0W A;  4FYV B;  1GRI A;  2C0I A;  2VC8 A;  1ZBJ A;  3CCE A;  3JCM e;  4HCB A;  2FPE A;  2EYY A;  3OSV A;  1B3Q A;  1QCF A;  2F2W A;  1AEY A;  1DJ7 B;  3UF4 A;  2VGN A;  3JSC A;  1W2B P;  5DY9 A;  4LD6 A;  4DA4 A;  4XTZ A;  5FU6 C;  3EFO A;  2HBW A;  2LQK A;  3MCA B;  2XDB A;  4M75 A;  3CCL Q;  1D1A A;  2XMF A;  1E6G A;  3JCM b;  4GLK A;  1VQ4 T;  3VS4 A;  1NYF A;  3DKM A;  1KQ1 A;  2ZPI B;  1E6H A;  3QBY A;  3QII A;  2CSI A;  2RJD A;  2L3P A;  1G3W A;  1LPL A;  1K0X A;  3OBY A;  3PNW C;  3C0C A;  4LDV A;  2RQV A;  2QTV A;  1RAA B;  4KUL A;  1OZ2 A;  2A0F B;  1MMN A;  1Q7Y R;  4C0G A;  2QI2 A;  4RMO A;  1PHT A;  1D3B B;  3CMA Q;  3QDR B;  4M7D C;  3HPW A;  1Y96 B;  2I2L A;  3RMS A;  3X28 B;  3M0U A;  1SSH A;  1V76 A;  4JRI A;  5GAN 5;  1PSE A;  4LNP A;  5KYN A;  3JCM d;  9ATC B;  4OMO A;  1Q81 U;  2MWO A;  2FZK B;  2JTE A;  3CPW P;  4C8Q A;  2DXT A;  1BK2 A;  1X6G A;  1AZE A;  4X9D A;  4KT0 E;  3EG2 A;  4J6W A;  4C8Q B;  3VS0 A;  1WJR A;  2O2O A;  1TUG B;  2ECZ A;  4M7D A;  1S72 T;  3JCM h;  3I56 Q;  1BI3 A;  4E7L A;  3P8D A;  2KAF A;  1X01 A;  1WHJ A;  2FZG B;  2YXY A;  2WSF E;  2KDS A;  3HRT A;  2O31 A;  2AK5 A;  2P0Q A;  1M90 C;  2DL7 A;  2E6N A;  4J7F A;  4IUP A;  1VQ8 T;  3RUX A;  2LZ6 B;  4RTZ A;  4C92 D;  2ESW A;  1YI2 A;  1JO8 A;  2EYZ A;  3CC2 T;  3ASK A;  1NEB A;  3OYD A;  2DVJ A;  2P0P A;  1LVK A;  5FWB A;  2ZPF B;  3CCJ Q;  2L3R A;  1NG2 A;  4NOY A;  2A37 A;  3G71 Q;  4EMK B;  1JQQ A;  1MGQ A;  4MZP A;  4J7I A;  4BI8 B;  1T3S A;  3EG0 A;  5L23 A;  3QXE B;  4A4H A;  4C92 G;  3X24 B;  1X6O A;  1YHQ Q;  3M54 A;  2LRQ A;  4FCY A;  2DE0 X;  5DLQ E;  4IIO A;  4M78 D;  1G8X A;  1UHC A;  2E4H A;  2OTJ A;  3JB9 J;  4DBF A;  4F7U G;  3N5B B;  2XK0 A;  3LH5 A;  1YJ9 A;  3JCM c;  2EKH A;  3M58 A;  1EX4 A;  2DBM A;  4OB1 B;  2RHU A;  3LWH A;  2I0N A;  2FHD A;  4OB0 B;  3HRU A;  4E2F B;  4R55 A;  3FJ5 A;  1UTI A;  4M78 G;  5GAN 2;  2F2V A;  1MV3 A;  2FEI A;  2RD1 A;  3LW5 E;  4J9F A;  3I35 A;  1D1C A;  1PD1 A;  2RJE A;  2CYZ B;  4EMH A;  3JAM E;  1UGR B;  2LVM A;  1K9A A;  3CPF A;  4XAX B;  1WDX A;  1GL5 A;  2OJ2 A;  1ZUU A;  4OGE A;  5CKE A;  4PJO E;  2P84 A;  1WYX A;  4M7A D;  2O9V A;  3HKS A;  4M77 E;  3VYG A;  4C0F A;  1VQN Q;  1G3S A;  4C92 C;  2A7Y A;  1FYN A;  3H8Z A;  1MUZ A;  1VQK T;  4PJO B;  2FPD A;  3A1P A;  4CC2 A;  5GAO n;  1WHG A;  4JRQ A;  1TU0 B;  3CXC S;  2HD0 A;  2MWP A;  4BY6 C;  4J6Y A;  3PIO A;  3M0R A;  2CP2 A;  4ZN3 A;  4BUG A;  4M7A G;  2EYW A;  1NJI C;  1CSK A;  4RTX A;  1VQP Q;  2AKK A;  4C92 A;  3CMA A;  3EFR A;  1Q86 R;  2JS0 A;  4M4Z A;  2QEX T;  2A28 A;  2KNB B;  4M78 C;  1YJN T;  3CC4 A;  2NWM A;  1QVG P;  3SEM A;  4J9C A;  3CCL T;  4HCK A;  1M1K R;  2BE7 D;  3OA6 A;  1WZO A;  5A0D A;  3QJY A;  2BUD A;  4MDW A;  4F7U B;  1UE9 A;  5IN1 A;  2GF7 A;  1K76 A;  2GFU A;  2QQR A;  1X43 A;  3I56 A;  1RAC B;  1YWP A;  3C4S A;  2DET A;  2VV5 A;  4M78 A;  1KIK A;  1VQ5 T;  3CCS Q;  4KGZ B;  1BI1 A;  2JTM A;  2LQN A;  4RTT A;  2DL3 A;  1OI1 A;  3VYH B;  1H3H A;  1M5Q 1;  4C5I A;  1YIJ T;  1KC8 U;  1RI0 A;  3CCV Q;  2Y4Y A;  4QQG A;  2K7A A;  4ATO A;  3CCJ A;  2DM1 A;  1U1T A;  2DIG A;  3NTH A;  4Z8A A;  4M7A C;  2FVU A;  5KYY A;  1OV3 A;  3CBM A;  4FIB A;  3CPW S;  3OW2 P;  2ZAE A;  4OF1 A;  3PVQ A;  3HP9 A;  1UGQ B;  3G71 A;  2OX7 A;  1FMW A;  4FW2 A;  2E12 A;  3BDL A;  1VQ6 Q;  4PJO F;  4F16 A;  2RI3 A;  3GNF B;  3EG3 A;  1OOT A;  1WXB A;  4M77 F;  1YHQ A;  1Y57 A;  5GMK h;  2JT4 A;  2LJ1 A;  1R77 A;  2O9S A;  4QQD A;  4QQ6 A;  1YJW T;  4M7A A;  5CCA A;  1WIE A;  2FO0 A;  5ECA A;  2CSQ A;  1G3Y A;  2ED1 A;  4C0Z A;  1TWB A;  2BZ8 A;  1YWO A;  2K57 A;  2IVW A;  5KYX A;  1OQK A;  3JCM P;  4Z02 A;  3DLL A;  4F17 A;  2RM4 A;  1WLP B;  1O75 A;  1AD5 A;  2GBQ A;  4FL6 A;  1ARK A;  1TXQ A;  1B34 A;  1PRM C;  1KJW A;  2M9U A;  4PJL A;  1SF9 A;  4IUU A;  1HK9 A;  2EYX A;  1TG0 A;  2PVO B;  1B34 B;  1K73 R;  4GY5 A;  2KMT A;  1N27 A;  2A08 A;  2E3I A;  5GAO q;  2CT3 A;  2P4R A;  1KD1 C;  5FRO A;  2KXD A;  4HT9 A;  4P5N A;  2RK2 A;  1MNE A;  1QCO A;  1QKX A;  2KEA A;  3ER0 A;  3CCE Q;  5GAN j;  1K8A C;  1XTD A;  1NYG A;  1MMD A;  4J9H A;  2LX9 A;  3MEW A;  5GAO p;  1VQO T;  1VQN A;  3EH2 A;  2LCC A;  2PNI A;  8AT1 B;  2DVE A;  4LXC A;  2QGF B;  2XD0 A;  5KYU B;  3SDZ A;  3QYG B;  4KRT A;  3CBO A;  1KQS P;  1UEB A;  3SWN B;  1AHJ B;  2DZ9 A;  3CCR Q;  3THK A;  2CP7 A;  2HEQ A;  3TSW A;  2LJ0 A;  1WHM A;  3DB3 A;  4IUT A;  3EGX A;  1MHN A;  4QVZ A;  3GBQ A;  1VUB A;  4ZGD B;  2YT6 A;  1M2O A;  2P4T A;  1UUE A;  1VQP A;  3EGX B;  1HD3 A;  5C6S A;  3EGU A;  1I07 A;  1Q7Y U;  5I2M A;  2EQI A;  4E47 A;  3ZFJ A;  4OMQ A;  4JLI A;  3RIR A;  4LDY A;  2DZC A;  2GTJ A;  2MOX A;  5FU7 B;  2PVG B;  2EBP A;  1KHC A;  3OMC A;  3L2W A;  1TUC A;  2EJ9 A;  4M75 D;  3I55 T;  4IUV A;  4E7H A;  3WXM B;  2DX1 A;  3L2V A;  2HBP A;  5GAN f;  1XJW B;  5L8R E;  2X51 A;  4JS5 A;  3CME A;  1IGU A;  3CCS A;  1I1J A;  1U5S A;  3EFS A;  3AT1 B;  5GAN g;  2LJ3 A;  3RER A;  1X2Q A;  2LT1 A;  1NBE B;  2VKN A;  1UGP B;  2OTL Q;  1ZBX A;  3TCJ A;  2PVD B;  1BBZ A;  4M75 G;  2SRC A;  4PJM A;  1YP5 A;  3CCV A;  1I8F A;  1IO6 A;  1QVG S;  3OYA A;  2CP6 A;  2AZS A;  1M1G A;  2CGH A;  2V1R A;  3OS0 A;  1K9M C;  2QAS A;  5LJ5 j;  2LDM A;  2XI9 A;  2B86 A;  2YHT A;  1VQ9 T;  1OX9 A;  4IIM A;  4A4E A;  1D1B A;  3MP6 A;  1ZSZ B;  2RH2 A;  3MET A;  5I22 A;  2MIO A;  4JUV A;  3L42 A;  1BI0 A;  2F69 A;  4OGC A;  1N8R R;  2D6F A;  2RHY A;  1Q82 R;  2J6O A;  1RAG B;  4D8K A;  1I5L A;  2CKK A;  2EW3 A;  3CCQ T;  3EHQ A;  2RB6 A;  3VS2 A;  3M4Y A;  2RJF A;  1RI9 A;  3L2U A;  2HKQ B;  3G4S Q;  3D7S B;  1OPK A;  1IGQ A;  2HKN A;  3VRY A;  5IH2 A;  3CXC P;  3OW2 S;  4D8D A;  2DYI A;  3EH1 A;  3J7A F;  1SEM A;  1QWF A;  3RKX A;  2CZ6 B;  5I11 A;  1CKB A;  3CCU T;  2AHJ B;  1WXT A;  3VRZ A;  3QO3 A;  2O88 A;  2WAC A;  3VV0 A;  1BCM A;  2JNG A;  1T0H A;  4II1 A;  2E10 A;  1YFN A;  3CCM A;  2JVV A;  4HVU A;  1C6V X;  1A0N B;  2QDL A;  2JOY A;  1C1A A;  3KXT A;  2ZPE B;  2R57 A;  3F70 A;  3BY7 A;  2E1H A;  5GAN 8;  5GAN 4;  3NMZ C;  5GAN 7;  4NL2 A;  4PJJ A;  1VQL A;  2YRV A;  1YNZ A;  3X26 B;  2K3Y A;  3L2Z A;  2GFA A;  1IZ6 A;  1JJ2 P;  4F14 A;  5LJ5 g;  2DXC A;  3EFO B;  2HNI A;  1G5V A;  2DD5 A;  2KYM A;  2DXU A;  4OP0 A;  4M75 B;  4DBH A;  1PM3 A;  5GJW B;  3CCR A;  1W6X A;  2KR3 A;  2J6F A;  2KT8 A;  4ZGJ B;  4O6J A;  2V8I A;  1SKU B;  3M53 A;  2DBK A;  3CCE T;  3M4G A;  1NZ9 A;  1QVF A;  5FU6 B;  2LT4 A;  4E7I A;  2E6Z A;  1H92 A;  3OYJ A;  1Q86 U;  4WF2 A;  4JPB W;  1ZQ1 A;  1RAI B;  3SD4 A;  3CC4 Q;  1K0S A;  4C8Q E;  3GPL A;  2QA4 Q;  1M1F A;  1VYV A;  4K11 A;  1M1K U;  3P8B B;  5GAN d;  1AWX A;  2X4W A;  3HTR A;  4B9W A;  4RCB A;  1SHG A;  3NHN A;  4NS5 A;  1KQS S;  1G83 A;  2J6K A;  1JB0 E;  2EGC A;  1M2V A;  3U23 A;  1K1Z A;  2NYS A;  4R0K A;  3PMT A;  3MJX A;  2YUP A;  4M7D B;  1X69 A;  2HL3 A;  2EJG A;  2KSS A;  4FYY B;  5LJ3 j;  2OTL A;  2OI3 A;  3V7R A;  2COY A;  1VQM T;  2JMA A;  3M9Q A;  2DFU A;  3H41 A;  2EQU A;  3RDV A;  4L5G A;  3JCM X;  2LQW A;  3RNJ A;  4OMM A;  1B07 A;  1VQ7 Q;  2HSP A;  4XQ3 A;  4BI4 A;  2CT4 A;  3UDC A;  2L8D A;  1N9S A;  3M5A A;  2WSC E;  5D6W A;  3VJP A;  1M4Z A;  3E1S A;  2KRM A;  3MEV A;  2OAU A;  2BIV A;  4ME7 A;  1TUD A;  3P8H A;  4D6W A;  4J8O A;  3HHT B;  1Z9Q A;  2R5A A;  1SHF A;  2J7I A;  1NLO C;  4PK4 A;  2RJC A;  1YCY A;  3FC3 A;  3QWX X;  1YI2 T;  3G4S A;  2L0A A;  5FRN A;  4XU0 A;  3V8J A;  2DL5 A;  3C12 A;  4AG1 C;  1W2B A;  1QVP A;  5LJ3 f;  2DKG A;  1H8K A;  2DYB A;  4E6R A;  1XOV A;  1UG1 A;  1YIT Q;  5LJ3 g;  4DOV A;  2DRM A;  1K73 U;  4C8Q F;  2PUK B;  2RI5 A;  5LJ5 d;  4KUD K;  1GFD A;  1WHL A;  3OS2 A;  2CZ1 B;  4DEY A;  4BE2 A;  1M9S A;  2DTO A;  5HKC A;  2HZY A;  2OTJ T;  3GNG A;  3FDR A;  3CC7 T;  2A36 A;  1YJ9 T;  4M77 C;  1YN8 A;  4LDX A;  1AWJ A;  1J3T A;  4N4H A;  4XTU A;  2D9T A;  3S6W A;  2QGG A;  2XDD A;  3QJ6 A;  2QEX A;  2L2P A;  4AFQ C;  1BB9 A;  2QQA A;  4WTO B;  4XK8 E;  4C92 E;  2HAX A;  3CPW A;  3LLR A;  1PWT A;  3JB9 D;  1X75 C;  5FRM A;  5D7U A;  4BE0 A;  3A8O B;  2VGM A;  2RHZ A;  4FU6 A;  4KGX B;  1HXD A;  3EGD A;  1P92 A;  4JLG A;  3IQL A;  8ATC B;  3M0S A;  5GAO l;  4C92 B;  5CR2 A;  4F7U E;  2E70 A;  1AOJ A;  3EGD B;  4WCI A;  5GAM j;  2QA4 A;  1JJ2 S;  3JCM V;  3HFO A;  3G6E Q;  2IIM A;  4BY6 B;  1QW1 A;  4FSX A;  3A8L B;  1AZG B;  3E9F A;  3SB2 A;  3M56 A;  3JB9 G;  4AT1 B;  3OSS C;  3R6N A;  3TRE A;  2G6F X;  4CC7 A;  2XDP A;  1Y0M A;  2EPD A;  3CME Q;  3MP1 A;  1FMV A;  5KE2 A;  1SSF A;  1D09 B;  3NPF A;  4PJN A;  4M78 B;  1S1N A;  3CMA T;  2KRS A;  1ZHI A;  4PFP A;  3MEU A;  1IRX A;  4YTL A;  5J26 A;  1NM7 A;  1PKT A;  3JCM J;  4R56 A;  1M90 R;  4BI3 A;  4PFO A;  3CC4 T;  4OMF B;  3JCM W;  4QKU A;  4DBR A;  2HQE A;  2RQU A;  2XHC A;  2XU8 A;  4N4I A;  1VQ7 A;  1IRE B;  2BZY A;  1BKB A;  4XTV A;  2LQ8 A;  2BTT A;  3GP8 A;  1KC8 C;  3M55 A;  3CD6 Q;  1QKW A;  5KYY B;  3I56 T;  4LN2 A;  1RAF B;  1JBM A;  2AZV A;  3INZ A;  2K5I A;  5GAM f;  1AT1 B;  3SHW A;  1UJ0 A;  4FT2 A;  3FB9 A;  1N8R U;  1UEC A;  1Q82 U;  2D0N A;  3MEA A;  1TS9 A;  5GAM g;  4M7A B;  1RAH B;  3EAE A;  4F04 B;  1WHK A;  5CO7 A;  4DOW A;  2LC4 A;  4PLI A;  5LJ3 d;  4ORZ A;  4C92 F;  3H9N A;  3CCJ T;  4Y28 E;  4JS4 A;  5I21 A;  5KYX B;  1MV0 B;  4JZ4 A;  4RTW A;  4RG2 A;  1UFF A;  4LE9 A;  3OYK A;  3G71 T;  1FMK A;  3PE0 A;  5GMK i;  4HT8 A;  1KG1 A;  1YIT A;  1VQO A;  2AT1 B;  1WFW A;  5FLX E;  4F7U F;  1N6A A;  3GLX A;  3I5R A;  1YHQ T;  1SPK A;  5DLO A;  2D1X A;  1Q95 G;  1VOM A;  4BD3 A;  1VQ4 Q;  3PVL A;  3ULR B;  3CCM Q;  2DXB A;  5CKH A;  3PGG A;  1GBR A;  2CP0 A;  4ZTJ A;  4BAC A;  1NPR A;  1VQL Q;  1N5Z A;  4M78 F;  3FJP A;  2NUT A;  3J80 E;  1GBQ A;  2AIR B;  4ESR A;  1RUW A;  4AFZ C;  1T0J A;  2RMO A;  7AT1 B;  3RBB B;  1JEG A;  5I2S A;  1PSF A;  2D8J A;  4AG2 C;  2VWF A;  5HK3 A;  1ZX6 A;  2DTI A;  4MDX A;  1SRM A;  3ZBD A;  2RQT A;  4A4F A;  3X20 B;  3BE3 A;  2K2M A;  4QVC A;  2ZCF B;  3OYB A;  2HMA A;  4XTX A;  1X27 A;  1JRI A;  2FRW A;  2KYB A;  3UA7 A;  4MML A;  1WJS A;  2QG9 B;  2EQJ A;  4MZM A;  2NLU A;  3C94 A;  3OS5 A;  4XTY A;  2CZ7 B;  3A98 A;  1NJI R;  3PFS A;  3I55 A;  3UWN A;  1I4K 1;  1XQH A;  4KH0 B;  5KYW A;  2GCX A;  2EKO A;  1VQN T;  4CC4 B;  1S72 Q;  3H0I A;  3WVE B;  1X2K A;  1Q7Y C;  4J9D A;  3G6E A;  1KFZ A;  3URG A;  5CAI A;  5GAM e;  4M7A F;  4EPC A;  5IXB A;  3QDF A;  2HQX A;  3MPU B;  5AYF A;  2MYS A;  3O5Z A;  2C06 A;  2VXE A;  2XIC A;  1JXO A;  2VXF A;  2RA2 A;  4QVD A;  2K4Y A;  2CZ0 B;  2O01 E;  2SEM A;  1VQ8 Q;  3V7C A;  4KH1 B;  2L89 A;  3CC2 Q;  1EZZ B;  5AT1 B;  2RQR A;  1VQP T;  1QVF P;  2MI6 A;  3RKY A;  4DBQ A;  2RF0 A;  3OW2 A;  2XG8 D;  4HVV A;  1ZLM A;  2M0Y A;  2DTH A;  3H6Z A;  4EDU A;  3JCM g;  2DD4 A;  2ROT A;  2VUB A;  1RAE B;  3OB9 A;  3OQ5 A;  2K2V A;  2NUP A;  3OS1 A;  3A8M B;  3OBW A;  3S3N A;  4ZGE B;  1G3T A;  1OPL A;  1UDL A;  2OAW A;  4X34 A;  2NUP B;  1M3B A;  1TH7 A;  4RTU A;  3CD6 A;  2ZPH B;  4N0A C;  2FPF A;  4C0D C;  1VYU A;  2GGR A;  2QK0 A;  2Y90 A;  3UT1 A;  1EIF A;  4JZ3 A;  3CME T;  5GAM d;  3CCS T;  4HCZ A;  3LH0 A;  3GIB A;  2DRK A;  2IG0 A;  4E7K A;  3E19 A;  2DK3 A;  4Q5W A;  2M02 A;  5D6X A;  5IT9 E;  3LGL A;  3BDU A;  2EAY A;  5FWC A;  4RTY A;  3CCV T;  1LNX A;  1EFN A;  4A4G A;  1QP3 A;  4ZNX A;  2C0O A;  2KXC A;  3Q1J A;  2E5K A;  5A2Q E;  2DIQ A;  2HCK A;  2DA9 A;  4ZN1 A;  2P0K A;  2ROL A;  5GMK l;  2QTX A;  1G2B A;  1LCK A;  1V1C A;  1VQ6 T;  3GF5 A;  1CKA A;  3BFM A;  2X9H A;  1VQ4 A;  1KD1 R;  2KK4 A;  2V8K A;  3L1A A;  3ZL7 C;  3VS5 A;  1VQK Q;  3CQT A;  4OMP A;  3OYE A;  2F5T X;  2CP5 A;  5LJ5 f;  1K8A R;  5GAN e;  2KE9 A;  4M75 E;  3LGF A;  2H3E B;  1H64 1;  1QCN A;  2K6D A;  2L3Q A;  3M0Q A;  1PRL C;  4JJC A;  2EFI A;  2F1L A;  5A0L A;  1PD0 A;  4XU1 A;  5FW9 A;  1MND A;  2M51 A;  2VYT A;  1ZUK A;  4HVW A;  4E7S A;  4J6X A;  2E41 A;  1PKS A;  3OYN A;  2V1Q A;  1NLP C;  3S3O A;  3OYL A;  4L59 A;  3SFM A;  3G7Z A;  4RTV A;  2QEX Q;  2V26 A;  1WNL A;  2MCN A;  3PT9 A;  3L2Q A;  1YJN Q;  5KH6 A;  1D0X A;  3RR6 A;  3LX7 A;  2QYZ A;  2ED0 A;  2BKD N;  2VVK A;  3CCM T;  2X4Y A;  4E7Z A;  2ZPG B;  3HSB A;  1WHH A;  4V2S A;  1RAB B;  2LCS A;  2K3B A;  1VQL T;  1F1B B;  2M0O A;  1V29 B;  1S72 A;  3VUZ A;  1HJD A;  1JXM A;  1LOJ A;  3HFN A;  1BI2 A;  1D3B A;  4C8Q C;  4DEX A;  1XNI A;  2GQV A;  4C5G A;  2ZPB B;  1M8M A;  1VQ5 Q;  1U06 A;  5GMK j;  1Y96 A;  2GNC A;  1Q86 C;  4PLL A;  4RCC A;  3CCR T;  1U3O A;  2YRD A;  2K5F A;  1K4U S;  4M7D E;  2H8H A;  4CC3 A;  1Q81 C;  4OB2 B;  1VQM A;  3A8H B;  1VQ8 A;  5GAO m;  1M1K C;  1WI7 A;  2KY9 A;  3CC2 A;  5HY6 A;  1WA7 A;  1YIJ Q;  1VIF A;  1SRL A;  1M2V B;  2DMO A;  4FW1 A;  5GAN h;  4BB7 A;  1KSW A;  1MMA A;  4PJO D;  3TQ7 P;  3ME9 A;  2K3X A;  1O9S A;  3X25 B;  2DL4 A;  4UC4 A;  4M77 D;  2NUZ A;  4GBQ A;  4VUB A;  1ABO A;  2DF6 A;  2LMJ A;  3NTK A;  2R5M A;  1M90 U;  2JN0 A;  4EMK C;  1AWW A;  2W10 A;  1RLP C;  5GAN 3;  1BU1 A;  3E2U A;  2FZC B;  2YWW A;  3BW1 A;  1K9M R;  5LJ5 e;  2FB7 A;  1YJW Q;  3CBP A;  2X4X A;  4PJO G;  1WXU A;  2YLC A;  3EG1 A;  4M75 F;  4M77 G;  1Z9Z A;  2KVQ G;  3QSU A;  3C95 A;  1BIB A;  2KQW A;  3NTI A;  1ACM B;  1UGV A;  4BE1 A;  4OMN A;  4EMK A;  4XU2 A;  1QVF S;  4PNO A;  2OTL T;  1M30 A;  3CXC A;  3PMI A;  1KHI A;  2DEQ A;  2KRO A;  4IKF A;  5A0G A;  4OML A;  2EYQ A;  3OYY A;  2COZ A;  5GJV B;  5GAO r;  2KT1 A;  1D0Z A;  1WGS A;  2RO0 A;  2EVR A;  4A53 A;  1HSQ A;  4X9C A;  2K79 A;  3UA6 A;  3DLM A;  2HQH A;  2QAZ A;  3VS3 A;  1OX8 A;  1QP2 A;  2EGA A;  2RNA A;  2EJF A;  3KFV A;  2ZGW A;  2MAM A;  4AFU C;  3KUF A;  3CC7 A;  4HKE A;  3L2R A;  4N4G A;  4LDW A;  6AT1 B;  1JJ2 A;  3T9N A;  1VQO Q;  2CRE A;  2J05 A;  1KK7 A;  2JZ2 A;  3VKI A;  3QKJ A;  3QPH A;  2HL5 C;  1QWE A;  3ZEH A;  1VQK A;  1UGS B;  1OYX A;  4J5Y A;  4GLM A;  2QDY B;  2X4J A;  5C0M A;  2F5K A;  3OYH A;  3S3M A;  1OU8 A;  4M7D F;  1K73 C;  2YUN A;  2FG0 A;  4J9I A;  4PJO C;  3VU3 C;  4J83 A;  4KUI A;  3VUB A;  1TTH B;  3VS1 A;  3G4S T;  1R0C B;  2PUO B;  1GFC A;  5LJ5 h;  1BCO A;  4JRP A;  1VIE A;  2PQW A;  1TOV A;  1QLY A;  3VS7 A;  5GAN 6;  2YUQ A;  1YJN A;  4J9G A;  2D8H A;  4HA8 A;  3JRZ A;  4LUE A;  3CCL A;  3OMG A;  3MHX A;  4PJO A;  1QMC A;  4MMK A;  4FM4 B;  2CP3 A;  4M77 A;  4NL3 A;  3GOX A;  3TSZ A;  5KCH A;  3A5Z B;  3JV3 A;  3R6O A;  2QQS A;  1IHV A;  2DO3 A;  4M77 B;  3I55 Q;  1NJI U;  2H3J A;  1YBY A;  4LD9 K;  4ELY C;  2EIF A;  2CUB A;  3JB9 H;  1Y71 A;  1GXI E;  1VQ5 A;  1M8V A;  2EQM A;  5CVI A;  5CK9 A;  2Y4X A;  4XU3 A;  2F2X A;  2DNU A;  2FYK A;  2LNV A;  5GMK e;  2DIL A;  1W2B S;  2WSE E;  1Q81 R;  2JMC A;  2KGT A;  4M78 E;  2RK1 A;  1ABQ A;  1MMG A;  2VB6 A;  1YIJ A;  4F7U A;  2YUO A;  2RHI A;  3QZ5 B;  1LJO A;  1M27 C;  2KRN A;  2RPN A;  2EQK A;  4Z89 A;  3TU4 K;  2M16 A;  2E64 A;  5LJ3 e;  5CIU A;  2DEU A;  3NGP A;  1VQ9 Q;  2FL7 A;  2C0T A;  4ELZ C;  5M9O A;  3QYH B;  3HL8 A;  2QA4 T;  2K9G A;  2BE9 B;  4ZTF A;  4IUQ A;  1ZA2 B;  2COW A;  1M3A A;  1YJW A;  2GTO A;  2L3S A;  1Y07 A;  3LYI A;  3WVD B;  3EG9 A;  3CCQ Q;  3REA B;  1IXD A;  1BIA A;  2JXB A;  4OVA A;  2CH4 W;  5KE3 A;  3EG9 B;  3JCM Q;  2LTO A;  1UHF A;  4JJD A;  3UAT A;  4M7A E;  2YDL A;  4FYX B;  2E3H A;  5IHN A;  4FYW B;  2RI2 A;  3QWY A;  4IUR A;  5KCO A;  2LCL A;  2YLB A;  1E7O A;  2BZX A;  3OYG A;  3CCU Q;  2MPX C;  2QQ9 A;  4AMC A;  2PTK A;  3M59 A;  1VQ7 T;  3OYI A;  1N8R C;  1GCQ C;  1JU5 C;  1Q82 C;  3M0T A;  2JM9 A;  2JS2 A;  1C0M A;  4O5V A;  2PU9 B;  2IPO B;  2KBT A;  5CKD A;  1HYO A;  3VS6 A;  2VAS A;  2CDT A;  2CUD A;  2XKO C;  5EG2 A;  4FT4 A;  4JRK A;  3M0P A;  2M1H A;  5HCK A;  5LJ3 h;  2D0Q B;  3G1J A;  4EMG A;  1GCQ A;  2R58 A;  4J9E A;  2JW4 A;  1KD1 U;  2ZZD A;  3EHR A;  3UPU A;  4C5H A;  2DJQ A;  2DER A;  3E9G A;  5GMK m;  1TSF A;  1OU9 A;  2JUF A;  2JJ9 A;  3OYF A;  1WQW A;  3QG1 A;  3OY9 A;  3J81 E;  3OYM A;  2ATC B;  1M3C A;  3SWN C;  1K8A U;  3OYC A;  4KGV B;  5J3B A;  4RG8 A;  4Y92 A;  3QUI A;  1IB8 A;  2NUT B;  1N9R A;  4JJN K;  1FXX A;  2DPP B;  2ABL A;  4AFS C;  3RMQ A;  1YIT T;  1QVG A;  1NE8 A;  5KYU A;  4A4K A;  2QXF A;  1VA7 A;  5EC7 A;  3SWN A;  1RLQ C;  5CKF A;  2HDA A;  3V8K A;  4ANJ A;  3JB9 I;  3AHU A;  3M57 A;  3O8V A;  4L6V 5;  4JJB A;  4EIK A;  5FU7 C;  4C5E A;  4DQ2 A;  4A63 B;  2E65 A;  5CKB A;  4Z88 A;  1Y7X A;  1GCP A; 
#chains in the Genus database with same CATH homology
 3HHT B;  2F5T X;  4E7J A;  5LJ5 f;  1VQ5 T;  5GAN e;  3V8L A;  3RES A;  2R5A A;  1BI1 A;  2K5L A;  4M75 E;  4XTW A;  3LGF A;  2JTM A;  5HK0 A;  2B8A A;  1H64 1;  4QW2 A;  5DM7 R;  2RJC A;  2EFI A;  3RKW A;  1OI1 A;  1YCY A;  3FC3 A;  1YI2 T;  5A0L A;  3G4S A;  4XU1 A;  3VYH B;  2MF2 A;  1M5Q 1;  2VYT A;  5FRN A;  4XU0 A;  4C5I A;  3V8J A;  1YIJ T;  3QZ9 B;  1KC8 U;  1RI0 A;  4J6X A;  2E41 A;  3QHS A;  2Y4Y A;  3C12 A;  3OYN A;  4QQG A;  4ATO A;  3S3O A;  1U8R A;  3OYL A;  4L59 A;  3SFM A;  5CQY A;  3CCJ A;  1U1T A;  2DIG A;  2JTF A;  1QVP A;  3G7Z A;  3NTH A;  1W2B A;  2FVU A;  4M7A C;  1WNL A;  3CBM A;  3PT9 A;  5LJ3 f;  2DKG A;  2E5Q A;  4FIB A;  3L2Q A;  3CPW S;  5KH6 A;  4HCC A;  1NPP A;  3LX7 A;  4OF1 A;  1WQ7 A;  2L5Q A;  3HP9 A;  1UGQ B;  3G71 A;  2G3R A;  3JCM f;  1XOV A;  2BKD N;  3TEE A;  3LWI A;  4Y91 A;  5LJ3 g;  2E12 A;  3DB4 A;  3FIF A;  3FRN A;  4JDS A;  2X4Y A;  3BDL A;  4A54 A;  4DOV A;  3CCM T;  4PJO F;  1K73 U;  2RI3 A;  4RKU E;  2PUK B;  3GNF B;  4C8Q F;  2ZPG B;  2RI5 A;  5LJ5 d;  2X35 A;  4KUD K;  3HSB A;  4V2S A;  4M77 F;  1YHQ A;  3JB9 F;  4PL6 A;  3OS2 A;  2CZ1 B;  5IAY A;  5GMK h;  4CI0 C;  1VQL T;  2O4X A;  2M0O A;  4BE2 A;  1V29 B;  1S72 A;  3VUZ A;  1M9S A;  1LOJ A;  2DTO A;  4QQD A;  3HFN A;  4QQ6 A;  5HKC A;  3G6E T;  1YJW T;  4M7A A;  2OTJ T;  3GNG A;  3FDR A;  3CC7 T;  4PKC C;  1BI2 A;  1D3B A;  4KBM B;  4C8Q C;  1I81 A;  5CCA A;  1XNI A;  2GQV A;  2O4X B;  1YJ9 T;  4C5G A;  2ZPB B;  3V7S A;  4C0Z A;  1G3Y A;  4M77 C;  5J39 A;  3CCQ A;  5GMK j;  1Y96 A;  4LDX A;  2DAQ A;  2K57 A;  1Q86 C;  4PLL A;  4MZT A;  2IVW A;  4N4H A;  4RCC A;  1K9M U;  3JCM P;  4Z02 A;  4BDY A;  3CCR T;  4BDZ A;  1WPY A;  4XTU A;  2K5F A;  2MMP A;  3DLL A;  2D9T A;  2RM4 A;  4M7D E;  1OZ3 A;  1Q81 C;  1O75 A;  4OB2 B;  1VQM A;  3S6W A;  3A8H B;  3NFC A;  1VQ8 A;  4FL6 A;  2XDD A;  5GAO m;  3QJ6 A;  1M1K C;  2QEX A;  1FX7 A;  2KY9 A;  1B34 A;  3CC2 A;  5HY6 A;  3KBG A;  2M9U A;  4OB3 B;  1VIF A;  1HK9 A;  4IUU A;  2QQA A;  2XID A;  4XK8 E;  2PVO B;  1B34 B;  2QQB A;  3CEY A;  4GY5 A;  5GAN h;  2KMT A;  3HRS A;  4BB7 A;  1N27 A;  4C92 E;  1U1S A;  3A8G B;  1VQ6 A;  2HAX A;  1BYM A;  4PJO D;  3CPW A;  3ME9 A;  4N0A A;  4C8Q D;  3CCU A;  5GAO q;  2K3X A;  1KD1 C;  1O9S A;  4LDU A;  5FRO A;  3X25 B;  3LLR A;  4UC4 A;  4P5N A;  2RK2 A;  4HT9 A;  4M77 D;  3JB9 D;  5GAM h;  1X75 C;  4VUB A;  5FRM A;  4BE0 A;  3A8O B;  3ER0 A;  2VGM A;  2RHZ A;  4FU6 A;  3NTK A;  1HXD A;  2R5M A;  4C0D B;  1P92 A;  4JLG A;  5LL6 S;  5GAN j;  2CS7 A;  5GAO l;  4C92 B;  1XTD A;  5CR2 A;  1K8A C;  1M90 U;  4F7U E;  2JN0 A;  4M7D D;  5CQX A;  4EMK C;  2E70 A;  2LX9 A;  3MEW A;  5GAN 3;  3PTA A;  4TVR A;  2DJZ A;  2QA4 A;  5GAM j;  1JJ2 S;  4B9X A;  3CD6 T;  5GAO p;  1VQO T;  3BW1 A;  3JCM V;  1VQN A;  2RHX A;  3HFO A;  2V8J A;  2LCC A;  5LJ5 e;  2FB7 A;  3FLG A;  2EWN A;  4BY6 B;  1QW1 A;  4FSX A;  3CBP A;  2X4X A;  3MP8 A;  1WJQ A;  4PJO G;  4C8Q G;  2DVE A;  3A8L B;  1R8O B;  3E9F A;  3SB2 A;  2XD0 A;  3M56 A;  3MO8 A;  2YLC A;  3QYG B;  4M75 F;  4M77 G;  3SDZ A;  2KVQ G;  3CBO A;  1RL2 A;  1UEB A;  3SWN B;  3JB9 G;  3QSU A;  3C95 A;  1AHJ B;  1BIB A;  1W4S A;  2KQW A;  3OSS C;  4CRI A;  2DZ9 A;  1FWZ A;  3TRE A;  3PIP A;  1UB4 A;  1KQS A;  2XDP A;  3NTI A;  4M7D G;  3FEO A;  4BE1 A;  4EMK A;  3DB3 A;  4IUT A;  4XU2 A;  1MHN A;  3MP1 A;  4QVZ A;  4PNO A;  2OTL T;  1KQ2 A;  1VUB A;  4ZGD B;  5KE2 A;  1QVF S;  2A3L A;  3CXC A;  1KHI A;  2DEQ A;  1SSF A;  3PMI A;  4IKF A;  5A0G A;  2EYQ A;  2P4T A;  4M75 C;  3OYY A;  5GAO r;  4M78 B;  1VQP A;  3CMA T;  1H3Z A;  1ZHI A;  1WGS A;  5D6Y A;  3MEU A;  2RO0 A;  5C6S A;  4YTL A;  4A53 A;  5J26 A;  2VC8 A;  3JCM J;  3CCE A;  4R56 A;  4BI3 A;  3JCM e;  1Q7Y U;  5I2M A;  4X9C A;  4HCB A;  3CC4 T;  4OMF B;  3OSV A;  3JCM W;  4E47 A;  3DLM A;  1DJ7 B;  3ZFJ A;  2HQE A;  2VGN A;  2XHC A;  2XU8 A;  3JSC A;  4JLI A;  4N4I A;  5DY9 A;  1VQ7 A;  4LD6 A;  3RIR A;  4LDY A;  4DA4 A;  1QP2 A;  4XTZ A;  5FU6 C;  1IRE B;  2DZC A;  1BKB A;  2EJF A;  4XTV A;  2LQK A;  2ZGW A;  3MCA B;  2LQ8 A;  5FU7 B;  2XDB A;  2MAM A;  2PVG B;  3KUF A;  4M75 A;  3CC7 A;  4HKE A;  3GP8 A;  1KHC A;  3L2R A;  3OMC A;  3JCM b;  3M55 A;  4N4G A;  4GLK A;  4LDW A;  3L2W A;  2EJ9 A;  1VQ4 T;  3T9N A;  1JJ2 A;  4M75 D;  3I55 T;  3DKM A;  4IUV A;  3I56 T;  4E7H A;  1KQ1 A;  2ZPI B;  2JZ2 A;  3VKI A;  3WXM B;  3L2V A;  3QBY A;  3QKJ A;  3QPH A;  2HBP A;  3QII A;  5GAN f;  5L8R E;  3ZEH A;  1VQK A;  4JS5 A;  2RJD A;  3CME A;  1UGS B;  1JBM A;  1G3W A;  1OYX A;  4J5Y A;  3CCS A;  3INZ A;  2QDY B;  2X4J A;  5C0M A;  2F5K A;  3OBY A;  3OYH A;  3EFS A;  3PNW C;  2K5I A;  4LDV A;  5GAM f;  5GAN g;  3S3M A;  4M7D F;  1K73 C;  3RER A;  4FT2 A;  3FB9 A;  2LT1 A;  1N8R U;  4PJO C;  3VU3 C;  4J83 A;  4KUL A;  4KUI A;  1Q82 U;  3VUB A;  1OZ2 A;  3MEA A;  4C0G A;  1UGP B;  2QI2 A;  4RMO A;  1ZBX A;  3TCJ A;  5GAM g;  3G4S T;  4M7A B;  3EAE A;  2PUO B;  2PVD B;  5CO7 A;  5LJ5 h;  1D3B B;  4M75 G;  4DOW A;  4JRP A;  2LC4 A;  1VIE A;  3QDR B;  2PQW A;  4M7D C;  3HPW A;  4PLI A;  3CCV A;  1I8F A;  1Y96 B;  1QVG S;  5LJ3 d;  3CCJ T;  2I2L A;  4C92 F;  3RMS A;  3OYA A;  4Y28 E;  3X28 B;  4JS4 A;  5I21 A;  5GAN 6;  4RG2 A;  1M1G A;  2CGH A;  4JRI A;  1PSE A;  3JCM d;  5GAN 5;  3OS0 A;  1YJN A;  1K9M C;  5LJ5 j;  1Q81 U;  3OYK A;  4HA8 A;  2LDM A;  3G71 T;  2MWO A;  2XI9 A;  3JRZ A;  3CCL A;  3OMG A;  2YHT A;  3MHX A;  5GMK i;  4HT8 A;  4C8Q A;  1YIT A;  4MMK A;  1VQO A;  4PJO A;  1KG1 A;  1VQ9 T;  4A4E A;  2DXT A;  4FM4 B;  5FLX E;  4F7U F;  4M77 A;  3MP6 A;  1N6A A;  3GLX A;  4X9D A;  2RH2 A;  4KT0 E;  3MET A;  4NL3 A;  3GOX A;  1YHQ T;  5DLO A;  5KCH A;  4J6W A;  4C8Q B;  3A5Z B;  3R6O A;  1WJR A;  4BD3 A;  4JUV A;  2QQS A;  3L42 A;  4M7D A;  1BI0 A;  2DO3 A;  4M77 B;  2F69 A;  1S72 T;  1NJI U;  3JCM h;  2H3J A;  1YBY A;  4OGC A;  4LD9 K;  4ELY C;  2DXB A;  2D6F A;  1BI3 A;  2EIF A;  2RHY A;  4E7L A;  3P8D A;  2KAF A;  1X01 A;  5CKH A;  3PGG A;  1KC8 C;  1I5L A;  3JB9 H;  1Y71 A;  2KDS A;  2WSF E;  2CKK A;  3HRT A;  3CCQ T;  4BAC A;  1NPR A;  4ZTJ A;  1VQ5 A;  4M78 F;  1GXI E;  1M8V A;  2EQM A;  3FJP A;  3J80 E;  5CVI A;  5CK9 A;  2P0Q A;  2RB6 A;  2Y4X A;  4XU3 A;  3M4Y A;  1M90 C;  2RJF A;  2FYK A;  1VQ9 A;  2E6N A;  4J7F A;  3L2U A;  2LNV A;  4IUP A;  3RUX A;  5I2S A;  5GMK e;  1PSF A;  1VQ8 T;  4C92 D;  1W2B S;  2WSE E;  1YI2 A;  3CC2 T;  3ASK A;  5HK3 A;  3OYD A;  4M78 E;  2RK1 A;  2DTI A;  4MDX A;  2P0P A;  3ZBD A;  4A4F A;  1YIJ A;  3X20 B;  4F7U A;  3OW2 S;  4QVC A;  2RHI A;  1LJO A;  2ZCF B;  2L3R A;  2ZPF B;  3QZ5 B;  3OYB A;  4XTX A;  3J7A F;  1JRI A;  3RKX A;  2CZ6 B;  4MML A;  3CCU T;  1WJS A;  2AHJ B;  4NOY A;  2EQK A;  2EQJ A;  3QO3 A;  2WAC A;  3TU4 K;  4MZM A;  3VV0 A;  4EMK B;  2NLU A;  3C94 A;  3OS5 A;  2JNG A;  2E64 A;  2M16 A;  1MGQ A;  2CZ7 B;  4MZP A;  4XTY A;  5LJ3 e;  4J7I A;  5CIU A;  4II1 A;  4BI8 B;  3PFS A;  3I55 A;  2E10 A;  3UWN A;  2FL7 A;  3CCM A;  3QXE B;  2JVV A;  1I4K 1;  1XQH A;  4A4H A;  4C92 G;  4ELZ C;  5M9O A;  2JOY A;  3QYH B;  3X24 B;  3KXT A;  1X6O A;  2ZPE B;  2R57 A;  3F70 A;  2LRQ A;  3BY7 A;  2E1H A;  3M54 A;  5GAN 8;  2GCX A;  3HL8 A;  5GAN 4;  2QA4 T;  4ZTF A;  4IUQ A;  2EKO A;  5DLQ E;  5GAN 7;  4NL2 A;  1VQN T;  1VQL A;  2YRV A;  4M78 D;  3WVE B;  3X26 B;  1Q7Y C;  2K3Y A;  3G6E A;  1YJW A;  3L2Z A;  1Y07 A;  1IZ6 A;  2GFA A;  2OTJ A;  3JB9 J;  3URG A;  5CAI A;  4F7U G;  3N5B B;  5LJ5 g;  5GAM e;  2XK0 A;  3LYI A;  2DXC A;  1YJ9 A;  4M7A F;  4EPC A;  2HNI A;  3WVD B;  1G5V A;  2DD5 A;  2DXU A;  3JCM c;  3M58 A;  2HQX A;  4OP0 A;  1BIA A;  4M75 B;  4OB1 B;  5AYF A;  2C06 A;  2RHU A;  3CCR A;  2VXE A;  4OVA A;  2XIC A;  5KE3 A;  3LWH A;  2VXF A;  2RA2 A;  4QVD A;  2K4Y A;  2CZ0 B;  2LTO A;  2O01 E;  3JCM Q;  2FHD A;  3V7C A;  2L89 A;  4M7A E;  4OB0 B;  3HRU A;  4ZGJ B;  4O6J A;  4R55 A;  2RI2 A;  4IUR A;  2V8I A;  1VQP T;  4M78 G;  5KCO A;  5GAN 2;  2LCL A;  2YLB A;  2MI6 A;  3RKY A;  3OW2 A;  2XG8 D;  3M53 A;  2RD1 A;  3CCE T;  3M4G A;  1NZ9 A;  1QVF A;  3LW5 E;  5FU6 B;  2DTH A;  2LT4 A;  4E7I A;  3H6Z A;  3OYG A;  2QQ9 A;  2RJE A;  4EDU A;  2CYZ B;  2E6Z A;  3JCM g;  4EMH A;  2DD4 A;  3JAM E;  3M59 A;  1UGR B;  1VQ7 T;  3OYI A;  2VUB A;  1N8R C;  2LVM A;  1Q82 C;  3CPF A;  3OB9 A;  3OQ5 A;  3OYJ A;  4XAX B;  2K2V A;  3OS1 A;  1Q86 U;  3A8M B;  4WF2 A;  3OBW A;  3S3N A;  1ZQ1 A;  4ZGE B;  3SD4 A;  1G3T A;  4OGE A;  4O5V A;  5CKE A;  4PJO E;  2PU9 B;  4C8Q E;  3GPL A;  5CKD A;  4X34 A;  4M7A D;  1TH7 A;  3HKS A;  1M1F A;  4M77 E;  3VYG A;  4C0F A;  1M1K U;  3P8B B;  2ZPH B;  4N0A C;  3CD6 A;  1G3S A;  2XKO C;  5EG2 A;  4FT4 A;  4C0D C;  5GAN d;  2X4W A;  4C92 C;  2A7Y A;  4B9W A;  4RCB A;  4JRK A;  3H8Z A;  2Y90 A;  4NS5 A;  1KQS S;  3UT1 A;  2M1H A;  1VQK T;  1EIF A;  4PJO B;  5LJ3 h;  3CME T;  2D0Q B;  1JB0 E;  5GAM d;  4EMG A;  4HCZ A;  5GAO n;  3LH0 A;  3CCS T;  4JRQ A;  3GIB A;  3CXC S;  2R58 A;  2IG0 A;  4E7K A;  1KD1 U;  2ZZD A;  3UPU A;  2HD0 A;  2MWP A;  4BY6 C;  4C5H A;  4J6Y A;  3E9G A;  3E19 A;  3PMT A;  5GMK m;  2DK3 A;  2JUF A;  4Q5W A;  3PIO A;  1WQW A;  3QG1 A;  2EJG A;  2KSS A;  3OY9 A;  5LJ3 j;  3OYF A;  4M7D B;  3J81 E;  5D6X A;  4ZN3 A;  4BUG A;  3OYM A;  3SWN C;  2OTL A;  5IT9 E;  4M7A G;  1K8A U;  3V7R A;  3OYC A;  3LGL A;  3BDU A;  1NJI C;  2EAY A;  5J3B A;  4C92 A;  4RG8 A;  3CMA A;  3EFR A;  3QUI A;  3CCV T;  1LNX A;  1VQM T;  4A4G A;  1QP3 A;  1N9R A;  3M9Q A;  2QEX T;  2EQU A;  4JJN K;  3Q1J A;  4L5G A;  4M78 C;  3JCM X;  1YJN T;  3CC4 A;  5A2Q E;  2DIQ A;  4ZN1 A;  1FXX A;  3CCL T;  2DPP B;  2P0K A;  3OA6 A;  1YIT T;  3RMQ A;  4XQ3 A;  2QTX A;  5GMK l;  4BI4 A;  1NE8 A;  1QVG A;  3UDC A;  2L8D A;  1N9S A;  4A4K A;  1VQ6 T;  5A0D A;  2QXF A;  3M5A A;  2WSC E;  3QJY A;  3SWN A;  5D6W A;  2BUD A;  3GF5 A;  4MDW A;  4F7U B;  5CKF A;  3VJP A;  1M4Z A;  3BFM A;  3E1S A;  3V8K A;  3JB9 I;  3AHU A;  5IN1 A;  2GF7 A;  1VQ4 A;  3MEV A;  2OAU A;  3M57 A;  2GFU A;  2KK4 A;  3O8V A;  4L6V 5;  2BIV A;  2QQR A;  3I56 A;  2V8K A;  4ME7 A;  3L1A A;  3C4S A;  5FU7 C;  2VV5 A;  4C5E A;  3P8H A;  4D6W A;  4DQ2 A;  4J8O A;  2E65 A;  4M78 A;  5CKB A;  1Y7X A;  3OYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...