2RKKA

Crystal structure of s.cerevisiae vta1 n-terminal domain
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
168
structure length
157
Chain Sequence
SMASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGLHVMNTLIHDQEKAKIYMLNFTMSLYNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of vta1 function in the multivesicular body sorting pathway.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lipid transport
molecule keywords Vacuolar protein sorting-associated protein VTA1
total genus 67
structure length 157
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 2rkkA01
2RKKA 4TXPA 4TXQA 4U7EB 2LUHA 5H7PA 2LXMA 2LXLA 4TXRA
chains in the Genus database with same CATH superfamily
3RJVA 2J4BA 3UM1A 3NZSA 2H6FA 3ABKE 2AXZA 2WQHA 1OT8A 2PQRA 4GCOA 2ZIRA 3VLFA 3HRAA 2QYJA 4ATGA 3KSLA 5FWQA 2AVPA 1L5JA 4B93B 2IOLA 2AJAA 5B1BE 2CHXA 4OAVB 3AU4A 1SA5A 4EZJA 2EQXA 1BU9A 4N3AA 4I1OB 2F0YA 1OCZE 4G24A 1QNFA 3Q7AA 2P9NG 2VQ2A 1WAO1 4ACKA 4BESA 4CYMD 3S7BA 1N4QA 5ARGA 3HHMA 3UI2A 4WNFA 3FU5A 3E30A 2GRPB 1SW6A 4B8CB 2BTDA 5CBOA 3G2TA 3FU6A 4JHJA 3L08A 4BT9A 4F6RD 5FQ4A 4ANUA 2YNQA 3FUNA 4QFVA 3FFLA 4GA1A 1JCQA 1YA0A 1FCHA 4AY6A 3FU3A 5HI7A 4CDNA 1KT0A 3D9HA 4IYPA 3C3RA 1E7UA 1TJCA 2GRRB 1BPOA 4I6EA 3ZKJA 3SGHA 2F8YA 3T8MA 4DX7D 5EKQD 3CV0A 3Q49B 2FEZA 3GZSA 2WXLA 1HH8A 2UY1B 4UI9C 3L16A 3TAXA 2XZTG 4F7AA 4EZLA 3ZRHA 1TNOA 3T5VA 4KXKB 4YVQC 1LD7A 5C2YA 3UT4A 1NA0A 3TWUA 3FUMA 2WXMA 2I2OA 4GYOA 1NI1A 3D9JA 4HLLA 2DZOA 3QAQA 2VGYA 3E33A 3MKRA 1X81A 3DRAA 3CK8A 2X6FA 1FVHA 4AJWA 4C9BB 5FZRA 3CIAA 3D9MA 3GW4A 1UOHA 3CHMA 3CLJA 1FT2A 1E8XA 4TUMA 3AG1E 1N95A 1IQRA 3L17A 3ZHEB 4B94A 1NL4A 4XIFA 4P29A 4GCNA 3PS6A 5JA4D 3LY9A 3OXLA 3AS5A 4J8DA 3OXFA 1TNZA 1MQSA 3ASDA 2MOWA 3ZN3A 3MEKA 3FTXA 4WNEA 5FJYA 3T8KA 2WXIA 1A17A 4JHRA 4TXPA 5D2MC 4CEMA 2H6GA 4H7XA 3ML8A 4RLYA 1DCQA 3LKUA 1HXIA 4G1TA 4BETA 3Q9UC 5E75A 4GTRA 1SA4A 3FULA 3FUKA 4AVXA 2XGSA 4ANVA 3Q75A 3U3WA 3HXBA 4FLHA 3SFZA 4DX5D 5T3RA 5ENOD 3KAEA 3SF4A 1MYOA 3RKVA 2XS8A 3FUJA 4GZCA 3MKQB 4KMOA 4ACLA 1Y6IA 3BU8A 4J8FA 4R7LA 3AAAC 1MX2A 3SD5A 5LX8A 3B7RL 4UI9K 5EYLA 3DSTA 1FVFA 3HVEB 4A3VA 2Q7FA 5FTPA 3FY4A 5D0OD 4HRLA 1Z6TA 3F6QA 2I1JA 5LCWJ 3VLEA 2CG3A 3EJNA 2KCKA 1UN9A 5DIZA 3ZVVA 3NBNB 3LJNA 3QWPA 2X6IA 3AS8A 5JMND 3PRZA 4FULA 3D9NA 3O48A 3U9WA 4RSYA 3D3MA 4HQDA 1LTXA 4K5AB 3TWWA 2KZTB 3TXMA 5LFAA 1U3DA 2L9BA 3G2VA 3GYZA 2V8SE 4PH4B 2R59A 3SO8A 4D10C 1K1AA 3LVRE 4GZ6A 4I1MA 2M63A 4YDWA 1N0RA 4AV7A 3UPVA 2QY7A 1WDYA 4DPRA 1HG2A 4L2YA 5ENPD 3MX3A 4KVOA 4G2VA 2IFUA 3SFXA 1Q2ZA 2OEVA 3L13A 4TUUA 4Z68A 3LS8A 2J09A 2XEVA 3FTVA 4JD2G 4OVVA 3LDZA 3TWQA 3RK6A 3SY2A 4JEHA 2Y4UA 4X8QA 3DXKG 1OWOA 2GW1A 2P58C 3BG0B 3CKBA 1DCEA 3FEXA 2V4HC 5G55A 2BEDA 5FINA 2P9KG 5JJ7A 3APCA 2WXJA 4GMJA 4NACA 2LSVA 3JQ1A 4BSZB 5CEAA 2FI7A 1DVPA 2X38A 2C0LA 3FH5A 1SZAA 4YDYA 5FQ7A 2I1KA 5ENQD 4AM9A 3UM2A 3ZYLA 2IF4A 3QOUA 4U8VD 5EX3A 3QJZA 4KBQA 1D9SA 3LYAA 1O1SA 3ONKA 4GTMA 4GTQA 1JPLA 1N4RA 1KZOA 5BPPA 4J8SA 4UQYA 4A1SA 3SZ7A 5BXUA 2IQCA 1S63A 3FWVA 4UWFA 4KZ0A 3UKUG 3BEEA 4LNBA 3ULEG 3UM3A 4EECA 2AWIA 3Q4AB 3NOCD 1JWFA 4EPZA 4V3IA 4KZCA 3S2AA 3ESKA 3S7FA 3FH8A 3FTUA 4A55A 1H2VC 3PUKA 4WNGA 1N11A 1MX6A 4G8LA 2KCLA 2WMNA 4EBAA 3U4TA 2PZIA 4Q94A 5FT9A 3CHSA 5CECB 4GMRA 4ANWA 3PZ3A 4WUYA 4BTAA 3ZU7B 3MKQA 4UUCA 3G2WA 2VYIA 3CVYA 2L0TB 2IEJA 2FO7A 4WWNA 4UWKA 4ILIA 3PZ2A 3R7RA 1TN6A 1K1BA 3CHOA 2DBAA 1U2VG 4JPSA 2I9CA 1TEZA 4RG9A 4J0UA 2LUHA 2A5UA 2OCCE 4LERA 1H2UA 3JQ0A 1NFIE 2DCPA 4ATZD 4U8HA 3UT8A 2V5FA 1OWNA 3K9IA 4M3OA 4N2QA 3PZ4A 2PQNA 3LXUX 4TRQA 1TYQG 4DJAA 3UTMA 3IEGA 1KLXA 4AEZC 2P9LG 4WNDA 5D0QD 5CHEE 4QQIA 4GTOA 2HO1A 4NQ0A 3LVQE 5AJDA 4BSXA 3ZEFA 2WXOA 3C98A 1W3BA 1FPPA 1BI7B 1XGWA 4TXRA 4LCTA 3ASOE 2EIME 5EYPF 2LXMA 3BQOA 1BI8B 3Q7FA 3V31A 3TG5A 1HS6A 3MCXA 3HXEA 4HB5A 2KC7A 5G05C 4BFRA 4GPKA 4CRWA 4F1PA 4AIFA 2MRIA 2WQ7A 2HM8A 2J08A 3ZXPA 3ZFWA 3B95A 5AQ7A 5BV1A 4HLEA 2L0IA 3ZHEA 2R05A 4GZDA 4UI9J 4LNUD 2AXUA 5ITZF 3UXGA 1NZNA 4LUNU 4U96D 4J6IA 2R03A 2LXLA 4DX1A 4MS6A 1X5BA 3RU0A 2VJ8A 1K3ZD 3CK7A 2KATA 5A6CA 3ASFA 4BT8A 3KD7A 3ZW3A 1KT1A 3ESLA 3B13A 3JXIA 4RQIA 3CVPA 4H7YA 4HOSA 4F3VA 3SBTB 3HDXA 3W9GA 3CEQA 5D66A 3SBSA 4O1OA 3URZA 1TNUA 3B7TA 3HYMB 3ASHA 3FHEA 2WXRA 2AXVA 5G2NA 5AYWD 2J49A 4CDMA 3CR3A 1N4SA 4XE0A 2H6IA 3UKRG 3R7QA 3FDHA 3PZDA 3TXNA 1IXVA 2KXPC 2PNNA 2XZDG 2ETCA 1MZCA 3MV3B 4KT6B 5AENA 1Z3XA 3JUIA 4CT0A 2YINA 2RD0A 1U3CA 4HXIA 3FTSA 3D9PA 3Q79A 3MGBA 1OWPA 2OOEA 4AOFA 3TGOA 5EDSA 2GROB 4OAUC 1H2TC 3AS4A 3C3OA 5AQ9A 2RFMA 4BTBA 2LO6A 2Y0BG 4C0MA 4HNAD 1MJ0A 3P1UA 2XEHA 4L7TA 2IY0C 3RIBA 4TXQA 4U7EB 4J7WA 3Q78A 2R17C 3OTNA 3QB2A 1AP7A 4N3CA 4K0RA 3HG0D 4TV3A 5AAOA 1TN8A 3EHRA 4U8YD 4IULA 4B89A 3C3QA 4G26A 4GPMA 2CHWA 5H7PA 3PVLA 4DX6D 1QYMA 1IYGA 3CVUA 2P9UG 5AIJA 4URKA 4OYSA 5KCMA 1N52A 3LJ3A 2Y1LE 2KCVA 1IQUA 3G2SA 4I1AA 4XKBA 3X2QE 3JXJA 5CRUA 1WG0A 1SZ9A 3UM0A 2FF4A 3IHYA 3CVWA 1S0PA 5CCLA 2C0MA 3TJPA 3QKYA 2WXGA 2WQ6A 2EILE 3HXDA 5FZSA 4ZFHA 3L9TA 4DI3A 1S64A 3PREA 4ME2A 3JYSA 5J90A 5ENSD 5E76A 3DXMG 1ELWA 2ZISA 1JCSA 3EU5A 1Z3YA 1OWLA 3LY7A 1XNFA 2EIKE 2GGFA 3UT7A 5KJNA 1JCRA 1NA3A 1KPSB 3E4BA 5JHBA 4Q69A 1OUVA 2FBNA 4FC8A 4LG6A 5BXOA 4DUIA 4EBAG 4BX9A 3CQCB 1SVXA 2DWZA 3DWLG 3RRNB 3DSSA 3T9KA 4MLPA 5BW8C 5T8IA 5KBAA 2WXQA 2DVWA 2RKKA 2XQ0A 4G8KA 4CCAA 2F8XK 1N94A 3NQPA 2LAHA 1E7VA 4DK5A 3VLDA 3VTXA 4LEUA 2OV8A 1ELKA 3PNTB 4XI0A 3J5PA 4BWRA 4UQZA 5G04C 4A1GA 5AQAA 4U95D 4AP2A 3NF1A 3IBEA 3CHPA 3FUIA 4DLQA 2RG8A 3EIJA 3U64A 5LP0A 2VSXE 4HRMB 5FZQA 1UW4B 1OY3D 3UINC 3PH0C 4W9RA 2FO1E 4APOA 2KZTA 3L54A 3QK0A 5A23A 5KWDA 3S7JA 3E37A 2WMOA 4GAAA 3KSQA 2XEEA 2PM7A 2J4DA 2FULA 2GRQB 5BT1A 2KBXA 1E90A 4FJZA 3GZ1A 2WXNA 2R5SA 2QZAA 2X6HA 5KNGA 4HRNA 2P9SG 4A63B 2BF0X 2WB2A 1P5QA 1VDYA 2JEKA 3VTYA 4HORA 3DBSA 3OAWA 3EHQA 1A5EA 5CBNA 2B0OE 3CVVA 1NP7A 2NC9A 2IOSA 3CKCA 2DIWA 4L9PA 2DZNA 3O4ZA 1EYHA 4GZ5A 3HXCA 2KM4A 4JXTA 3ZXSA 2WM9A 2ZU6B 3EUVA 3CQGB 2ZGGA 4JW1A 4HS2A 3SI5A 1QQEA 1N54A 5CEDB 3PE4A 3L82A 4CZ2D 4FHJA 2UWJG 1QBQA 4J8YA 2J07A 4IRUA 4I6GA 3LPZA 1YMPA 5EIBE 3DEOA 5CMWA 3BUAA 5LCWC 1WM5A 3V2XA 1YCSB 2LSUA 3ASGA 1E8ZA 4J8EA 3UX4A 4I6JA 3ML9A 2DYRE 4I17A 5EN5D 3SFYA 4N39A 2IJGX 5G05J 3ONLA 5B1AE 2OVFA 3FUDA 1G3NB 2GRMA 5FQ8A 2CFZA 1HX8A 5T4YA 5B3SE 3TWTA 1SQMA 3ENEA 4CDRA 3UQ3A 3V2OA 1TN7A 3SQVA 3HIZA 4L2LA 3EDTB 4FADA 2ETBA 4GA0A 4JVSA 3AG4E 1H0AA 4NURA 5JJTA 1FT1A 2RFAA 3SHFA 3ULQA 2CG2A 3FU0A 3MV2B 2E0IA 3MYVA 4ANXA 3CSFA 5KNHD 2X3MA 4XEIG 2GRNB 2WXPA 3DSUA 2VSNA 2XPIA 3FUFA 3Q73A 3D9OA 4UQXA 3CK9A 3W9FA 1HFAA 2YHEA 1ELRA 2XHEA 3QWWA 4HOQA 2F37A 4ILHB 4PDXA 3QWVA 5CERB 2PL2A 1BLXB 3LEWA 2EIJE 5EX0A 3I4RB 5AJLA 4FP7A 5LOZA 4RVBA 4UWHA 4F1SA 4N5QA 3I4GA 4F53A 4JEUA 3Q47B 2H6HA 1JUQA 3D9LA 1EPUA 4JB8P 1HF8A 4HOTA 5FIOA 4C48B 4DX2A 1PC2A 1RW2A 1OXJA 3TWRA 1ZB1A 2IU1A 4YVOA 5KJKA 2Y69E 2WXHA 3ZNGA 4LNGA 2YHCA 2WXFA 3ISMC 5BV0A 1BD8A 4JA7A 3L22A 4DLOA 3QC1A 2NSZA 5BUZA 2HYZA 3FTWA 4I2WA 1O1TA 3DSVA 4AXHA 4XX5A 5JHAA 3CVXA 2HR2A 4ZHBA 3FEYA 2YQ8A 3QDNA 1E8YA 4FJYA 4GZ3A 2MHKA 2ONDA 3UIOC 1JWGA 2VGXA 2ZXWE 3APFA 3PEUB 3ZIMA 3P2BA 2VTBA 3QNKA 3JUEA 2VGEA 2MYOA 4B0ZA 1D8EA 3RAUA 1OCRE 1IKND 3CHQA 3EIQC 1H19A 4ABNA 3SNXA 1H6PA 3D9IA 3Q15A 4EZKA 4MKTA 3T5XA 3N71A 2E2EA 4GYWA 4G25A 4HFGA 3RRUA 4B8AA 3IKOB 4G23A 4APFA 4L23A 3CVNA 4DRXE 3PDNA 3G2UA 2EINE 4JZYA 3ZYKA 3ZUVB 4U0UA 3UUXA 3CGHA 1O1RA 2ETAA 1GW6A 2XPZA 1MX4A 3AU5A 2V4LA 2QC9A 4JHKA 5ANRA 4L1BA 1D8DA 4JA9A 1N9AA 3DSWA 1HE8A 4LSZE 4O6FA 4U04A 1H6OA 5KJMA 3APDA 2CFUA 3J5QB 4N5CA 4BEPA 3ZYMA 3OXGA 1E96B 2Y3AA 2IONA 1OCCE 3TL5A 2I6HA 3FH7A 3TWXA 3WXXA 4C0EA 4PS8A 3ABME 1EDUA 5FQ6A 1KZPA 1LF8A 2OEWA 4WAFA 2QFCA 1HG5A 3U66A 1PAQA 2HE0A 3NZUA 5ARFA 1EF1C 1V55E 1IHGA 3LY8A 3R9MA 3KS2A 3MJWA 3HVEA 3NB2A 3PEVB 2C2LA 4N2SA 3AJIA 5CCMA 5KJLA 2ZGDA 1TJFA 4GTPA 4K5CA 4LRZA 4Q96A 3PE3A 5HRYA 2UY1A 3JCKC 1UJJA 2CHZA 1QZ2A 1UJKA 3DEPA 1YYHA 4N3BA 2LNIA 1OWMA 5JJ6A 4PS7A 3ZPJA 4MRUA 4HOUA 2BKKB 4XZ4A 4ILGA 1OCOE 4JL0A 1V54E 4I2ZA 3TWSA 3FUHA 1E8WA 4Y6WA 3Q9NC 5EIDA 3BG1B 2VTBB 4FU3A 4Y6CA 4UWLA 4I43A 5AARA 3UMVA 3ZGQA 4U63A 4GTTA 5EILA 2L6BA 3PZ1A 1ZBPA 2P2CP 3PNLB 5AQBA 1TNYA 2L6JA 3DPDA 2V0PA 3E34A 3QARA 2B6CA 4FHKA 4U0ZA 4G11A 5HKPA 3S7DA 1RZ4A 3LCAA 4YDOA 3I3NA 2GRLA 5BNWA 5CRVA 4YNDA 5AN8A 4PS3A 1HZ4A 4NRHB 4RG6A 2A4ZA 1WY6A 3PUJA 2AW6A 4U0SA 3EHMA 2JLBA 4JC8A 3EHNA 1UG3A 2Y4TA 3DSXA 3WG7E 3CVQA 2R2LA 3I5PA 5J08A 2XGOA 4WWPA 3CVLA 5ENNA 1N4PA 3R9AB 4EQFA 4HBDA 4CGVA 2JABA 4U07A 3FUEA 3AG3E 3E32A 3IHVA 2NYJA 4BX8A 1S70B 3CHRA 2PM6A 4MBGA 2NXPA 4GMLA 4IN3B 2R02A 4GU5A 3ASNE 3KEZA 4XI9A 1DNPA 1Z5SC 2A5EA 4GA2A 3V30A 2X6KA 4CGWA 2XS1A 5HS0A 3FP3A 3MA5A 5ENRD 2IO2C 2XRYA 4I9CA 3C72A 2DYSE 2QYUA 4FLBA 2XCCA 1Y8MA 1TNBA 3ULYA 3GZ2A 2OVBA 3B7BA 4YDEA 1HO8A 1DC2A 4DI4A 2IO3C 3B7SA 5A7DB 5M72A 3C5RA 2BKGA 4XKCA 4E6HA 3FTZA 1B89A 4OVUA 4FA6A 3MZLB 3RO3A 2BUGA 2WVIA 4K03A 3CSTA 1TR4A 2WPVA 4KYOB 3UIPC 4O60A 3HXFA 1ZU2A 4K5BA 4UWGA 2J8SD 4BY6A 2P9IG 5C1DA 4KVMA 1H6KA 2VSOE 3L6AA 5HQ8A 3EU9A 2XPYA 1N0QA 2XCBA 2VSYA 2XGMA 4HI8A 2J9QA 1O5MA 4AY5A 3KEAA 4A3TA 4WWOA 3RRMB 3AG2E 3ZYQA 5IY5E 4HVBA 5ANLA 2VGXB 1LD8A 1AWCB 5ENTD 3TWVA 4GTVA 4GTSA 2ILRA 3RO2A 3IV0A 1K8KG 1PY1A 3NOGD 4GB9A 3RSEG 2XRZA 1IHBA 3FTYA 4E85A 4GYYA 3NAWA 2P9PG 4EHMA 1MHQA 3D9KA 5G04J 3V79K 3DPYA 3ABLE 3Q5MA 2LAIA 1HU3A 4O1PA 4CT4A 3TG4A 3B7UX 4I9EA 1UN8A 1INZA 4M7CA 4NIKA 5DBKA 2WXKA 4HI9A 2XENA 2X6JA 3IXEA 4PUCA 2V5QC 5CMYA 4BERA
chains in the Genus database with same CATH topology
2RKKA 4TXPA 4TXQA 4U7EB 2LUHA 5H7PA 2LXMA 2LXLA 4TXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKK A;  4TXP A;  4TXQ A;  4U7E B;  2LUH A;  5H7P A;  2LXM A;  2LXL A;  4TXR A; 
#chains in the Genus database with same CATH topology
 3RJV A;  2J4B A;  3UM1 A;  3NZS A;  2H6F A;  3ABK E;  2AXZ A;  2WQH A;  1OT8 A;  2PQR A;  4GCO A;  2ZIR A;  3VLF A;  3HRA A;  2QYJ A;  4ATG A;  3KSL A;  5FWQ A;  2AVP A;  1L5J A;  4B93 B;  2IOL A;  2AJA A;  5B1B E;  2CHX A;  4OAV B;  3AU4 A;  1SA5 A;  4EZJ A;  2EQX A;  1BU9 A;  4N3A A;  4I1O B;  2F0Y A;  1OCZ E;  4G24 A;  1QNF A;  3Q7A A;  2P9N G;  2VQ2 A;  1WAO 1;  4ACK A;  4BES A;  4CYM D;  3S7B A;  1N4Q A;  5ARG A;  3HHM A;  3UI2 A;  4WNF A;  3FU5 A;  3E30 A;  2GRP B;  1SW6 A;  4B8C B;  2BTD A;  5CBO A;  3G2T A;  3FU6 A;  4JHJ A;  3L08 A;  4BT9 A;  4F6R D;  5FQ4 A;  4ANU A;  2YNQ A;  3FUN A;  4QFV A;  3FFL A;  4GA1 A;  1JCQ A;  1YA0 A;  1FCH A;  4AY6 A;  3FU3 A;  5HI7 A;  4CDN A;  1KT0 A;  3D9H A;  4IYP A;  3C3R A;  1E7U A;  1TJC A;  2GRR B;  1BPO A;  4I6E A;  3ZKJ A;  3SGH A;  2F8Y A;  3T8M A;  4DX7 D;  5EKQ D;  3CV0 A;  3Q49 B;  2FEZ A;  3GZS A;  2WXL A;  1HH8 A;  2UY1 B;  4UI9 C;  3L16 A;  3TAX A;  2XZT G;  4F7A A;  4EZL A;  3ZRH A;  1TNO A;  3T5V A;  4KXK B;  4YVQ C;  1LD7 A;  5C2Y A;  3UT4 A;  1NA0 A;  3TWU A;  3FUM A;  2WXM A;  2I2O A;  4GYO A;  1NI1 A;  3D9J A;  4HLL A;  2DZO A;  3QAQ A;  2VGY A;  3E33 A;  3MKR A;  1X81 A;  3DRA A;  3CK8 A;  2X6F A;  1FVH A;  4AJW A;  4C9B B;  5FZR A;  3CIA A;  3D9M A;  3GW4 A;  1UOH A;  3CHM A;  3CLJ A;  1FT2 A;  1E8X A;  4TUM A;  3AG1 E;  1N95 A;  1IQR A;  3L17 A;  3ZHE B;  4B94 A;  1NL4 A;  4XIF A;  4P29 A;  4GCN A;  3PS6 A;  5JA4 D;  3LY9 A;  3OXL A;  3AS5 A;  4J8D A;  3OXF A;  1TNZ A;  1MQS A;  3ASD A;  2MOW A;  3ZN3 A;  3MEK A;  3FTX A;  4WNE A;  5FJY A;  3T8K A;  2WXI A;  1A17 A;  4JHR A;  4TXP A;  5D2M C;  4CEM A;  2H6G A;  4H7X A;  3ML8 A;  4RLY A;  1DCQ A;  3LKU A;  1HXI A;  4G1T A;  4BET A;  3Q9U C;  5E75 A;  4GTR A;  1SA4 A;  3FUL A;  3FUK A;  4AVX A;  2XGS A;  4ANV A;  3Q75 A;  3U3W A;  3HXB A;  4FLH A;  3SFZ A;  4DX5 D;  5T3R A;  5ENO D;  3KAE A;  3SF4 A;  1MYO A;  3RKV A;  2XS8 A;  3FUJ A;  4GZC A;  3MKQ B;  4KMO A;  4ACL A;  1Y6I A;  3BU8 A;  4J8F A;  4R7L A;  3AAA C;  1MX2 A;  3SD5 A;  5LX8 A;  3B7R L;  4UI9 K;  5EYL A;  3DST A;  1FVF A;  3HVE B;  4A3V A;  2Q7F A;  5FTP A;  3FY4 A;  5D0O D;  4HRL A;  1Z6T A;  3F6Q A;  2I1J A;  5LCW J;  3VLE A;  2CG3 A;  3EJN A;  2KCK A;  1UN9 A;  5DIZ A;  3ZVV A;  3NBN B;  3LJN A;  3QWP A;  2X6I A;  3AS8 A;  5JMN D;  3PRZ A;  4FUL A;  3D9N A;  3O48 A;  3U9W A;  4RSY A;  3D3M A;  4HQD A;  1LTX A;  4K5A B;  3TWW A;  2KZT B;  3TXM A;  5LFA A;  1U3D A;  2L9B A;  3G2V A;  3GYZ A;  2V8S E;  4PH4 B;  2R59 A;  3SO8 A;  4D10 C;  1K1A A;  3LVR E;  4GZ6 A;  4I1M A;  2M63 A;  4YDW A;  1N0R A;  4AV7 A;  3UPV A;  2QY7 A;  1WDY A;  4DPR A;  1HG2 A;  4L2Y A;  5ENP D;  3MX3 A;  4KVO A;  4G2V A;  2IFU A;  3SFX A;  1Q2Z A;  2OEV A;  3L13 A;  4TUU A;  4Z68 A;  3LS8 A;  2J09 A;  2XEV A;  3FTV A;  4JD2 G;  4OVV A;  3LDZ A;  3TWQ A;  3RK6 A;  3SY2 A;  4JEH A;  2Y4U A;  4X8Q A;  3DXK G;  1OWO A;  2GW1 A;  2P58 C;  3BG0 B;  3CKB A;  1DCE A;  3FEX A;  2V4H C;  5G55 A;  2BED A;  5FIN A;  2P9K G;  5JJ7 A;  3APC A;  2WXJ A;  4GMJ A;  4NAC A;  2LSV A;  3JQ1 A;  4BSZ B;  5CEA A;  2FI7 A;  1DVP A;  2X38 A;  2C0L A;  3FH5 A;  1SZA A;  4YDY A;  5FQ7 A;  2I1K A;  5ENQ D;  4AM9 A;  3UM2 A;  3ZYL A;  2IF4 A;  3QOU A;  4U8V D;  5EX3 A;  3QJZ A;  4KBQ A;  1D9S A;  3LYA A;  1O1S A;  3ONK A;  4GTM A;  4GTQ A;  1JPL A;  1N4R A;  1KZO A;  5BPP A;  4J8S A;  4UQY A;  4A1S A;  3SZ7 A;  5BXU A;  2IQC A;  1S63 A;  3FWV A;  4UWF A;  4KZ0 A;  3UKU G;  3BEE A;  4LNB A;  3ULE G;  3UM3 A;  4EEC A;  2AWI A;  3Q4A B;  3NOC D;  1JWF A;  4EPZ A;  4V3I A;  4KZC A;  3S2A A;  3ESK A;  3S7F A;  3FH8 A;  3FTU A;  4A55 A;  1H2V C;  3PUK A;  4WNG A;  1N11 A;  1MX6 A;  4G8L A;  2KCL A;  2WMN A;  4EBA A;  3U4T A;  2PZI A;  4Q94 A;  5FT9 A;  3CHS A;  5CEC B;  4GMR A;  4ANW A;  3PZ3 A;  4WUY A;  4BTA A;  3ZU7 B;  3MKQ A;  4UUC A;  3G2W A;  2VYI A;  3CVY A;  2L0T B;  2IEJ A;  2FO7 A;  4WWN A;  4UWK A;  4ILI A;  3PZ2 A;  3R7R A;  1TN6 A;  1K1B A;  3CHO A;  2DBA A;  1U2V G;  4JPS A;  2I9C A;  1TEZ A;  4RG9 A;  4J0U A;  2LUH A;  2A5U A;  2OCC E;  4LER A;  1H2U A;  3JQ0 A;  1NFI E;  2DCP A;  4ATZ D;  4U8H A;  3UT8 A;  2V5F A;  1OWN A;  3K9I A;  4M3O A;  4N2Q A;  3PZ4 A;  2PQN A;  3LXU X;  4TRQ A;  1TYQ G;  4DJA A;  3UTM A;  3IEG A;  1KLX A;  4AEZ C;  2P9L G;  4WND A;  5D0Q D;  5CHE E;  4QQI A;  4GTO A;  2HO1 A;  4NQ0 A;  3LVQ E;  5AJD A;  4BSX A;  3ZEF A;  2WXO A;  3C98 A;  1W3B A;  1FPP A;  1BI7 B;  1XGW A;  4TXR A;  4LCT A;  3ASO E;  2EIM E;  5EYP F;  2LXM A;  3BQO A;  1BI8 B;  3Q7F A;  3V31 A;  3TG5 A;  1HS6 A;  3MCX A;  3HXE A;  4HB5 A;  2KC7 A;  5G05 C;  4BFR A;  4GPK A;  4CRW A;  4F1P A;  4AIF A;  2MRI A;  2WQ7 A;  2HM8 A;  2J08 A;  3ZXP A;  3ZFW A;  3B95 A;  5AQ7 A;  5BV1 A;  4HLE A;  2L0I A;  3ZHE A;  2R05 A;  4GZD A;  4UI9 J;  4LNU D;  2AXU A;  5ITZ F;  3UXG A;  1NZN A;  4LUN U;  4U96 D;  4J6I A;  2R03 A;  2LXL A;  4DX1 A;  4MS6 A;  1X5B A;  3RU0 A;  2VJ8 A;  1K3Z D;  3CK7 A;  2KAT A;  5A6C A;  3ASF A;  4BT8 A;  3KD7 A;  3ZW3 A;  1KT1 A;  3ESL A;  3B13 A;  3JXI A;  4RQI A;  3CVP A;  4H7Y A;  4HOS A;  4F3V A;  3SBT B;  3HDX A;  3W9G A;  3CEQ A;  5D66 A;  3SBS A;  4O1O A;  3URZ A;  1TNU A;  3B7T A;  3HYM B;  3ASH A;  3FHE A;  2WXR A;  2AXV A;  5G2N A;  5AYW D;  2J49 A;  4CDM A;  3CR3 A;  1N4S A;  4XE0 A;  2H6I A;  3UKR G;  3R7Q A;  3FDH A;  3PZD A;  3TXN A;  1IXV A;  2KXP C;  2PNN A;  2XZD G;  2ETC A;  1MZC A;  3MV3 B;  4KT6 B;  5AEN A;  1Z3X A;  3JUI A;  4CT0 A;  2YIN A;  2RD0 A;  1U3C A;  4HXI A;  3FTS A;  3D9P A;  3Q79 A;  3MGB A;  1OWP A;  2OOE A;  4AOF A;  3TGO A;  5EDS A;  2GRO B;  4OAU C;  1H2T C;  3AS4 A;  3C3O A;  5AQ9 A;  2RFM A;  4BTB A;  2LO6 A;  2Y0B G;  4C0M A;  4HNA D;  1MJ0 A;  3P1U A;  2XEH A;  4L7T A;  2IY0 C;  3RIB A;  4TXQ A;  4U7E B;  4J7W A;  3Q78 A;  2R17 C;  3OTN A;  3QB2 A;  1AP7 A;  4N3C A;  4K0R A;  3HG0 D;  4TV3 A;  5AAO A;  1TN8 A;  3EHR A;  4U8Y D;  4IUL A;  4B89 A;  3C3Q A;  4G26 A;  4GPM A;  2CHW A;  5H7P A;  3PVL A;  4DX6 D;  1QYM A;  1IYG A;  3CVU A;  2P9U G;  5AIJ A;  4URK A;  4OYS A;  5KCM A;  1N52 A;  3LJ3 A;  2Y1L E;  2KCV A;  1IQU A;  3G2S A;  4I1A A;  4XKB A;  3X2Q E;  3JXJ A;  5CRU A;  1WG0 A;  1SZ9 A;  3UM0 A;  2FF4 A;  3IHY A;  3CVW A;  1S0P A;  5CCL A;  2C0M A;  3TJP A;  3QKY A;  2WXG A;  2WQ6 A;  2EIL E;  3HXD A;  5FZS A;  4ZFH A;  3L9T A;  4DI3 A;  1S64 A;  3PRE A;  4ME2 A;  3JYS A;  5J90 A;  5ENS D;  5E76 A;  3DXM G;  1ELW A;  2ZIS A;  1JCS A;  3EU5 A;  1Z3Y A;  1OWL A;  3LY7 A;  1XNF A;  2EIK E;  2GGF A;  3UT7 A;  5KJN A;  1JCR A;  1NA3 A;  1KPS B;  3E4B A;  5JHB A;  4Q69 A;  1OUV A;  2FBN A;  4FC8 A;  4LG6 A;  5BXO A;  4DUI A;  4EBA G;  4BX9 A;  3CQC B;  1SVX A;  2DWZ A;  3DWL G;  3RRN B;  3DSS A;  3T9K A;  4MLP A;  5BW8 C;  5T8I A;  5KBA A;  2WXQ A;  2DVW A;  2RKK A;  2XQ0 A;  4G8K A;  4CCA A;  2F8X K;  1N94 A;  3NQP A;  2LAH A;  1E7V A;  4DK5 A;  3VLD A;  3VTX A;  4LEU A;  2OV8 A;  1ELK A;  3PNT B;  4XI0 A;  3J5P A;  4BWR A;  4UQZ A;  5G04 C;  4A1G A;  5AQA A;  4U95 D;  4AP2 A;  3NF1 A;  3IBE A;  3CHP A;  3FUI A;  4DLQ A;  2RG8 A;  3EIJ A;  3U64 A;  5LP0 A;  2VSX E;  4HRM B;  5FZQ A;  1UW4 B;  1OY3 D;  3UIN C;  3PH0 C;  4W9R A;  2FO1 E;  4APO A;  2KZT A;  3L54 A;  3QK0 A;  5A23 A;  5KWD A;  3S7J A;  3E37 A;  2WMO A;  4GAA A;  3KSQ A;  2XEE A;  2PM7 A;  2J4D A;  2FUL A;  2GRQ B;  5BT1 A;  2KBX A;  1E90 A;  4FJZ A;  3GZ1 A;  2WXN A;  2R5S A;  2QZA A;  2X6H A;  5KNG A;  4HRN A;  2P9S G;  4A63 B;  2BF0 X;  2WB2 A;  1P5Q A;  1VDY A;  2JEK A;  3VTY A;  4HOR A;  3DBS A;  3OAW A;  3EHQ A;  1A5E A;  5CBN A;  2B0O E;  3CVV A;  1NP7 A;  2NC9 A;  2IOS A;  3CKC A;  2DIW A;  4L9P A;  2DZN A;  3O4Z A;  1EYH A;  4GZ5 A;  3HXC A;  2KM4 A;  4JXT A;  3ZXS A;  2WM9 A;  2ZU6 B;  3EUV A;  3CQG B;  2ZGG A;  4JW1 A;  4HS2 A;  3SI5 A;  1QQE A;  1N54 A;  5CED B;  3PE4 A;  3L82 A;  4CZ2 D;  4FHJ A;  2UWJ G;  1QBQ A;  4J8Y A;  2J07 A;  4IRU A;  4I6G A;  3LPZ A;  1YMP A;  5EIB E;  3DEO A;  5CMW A;  3BUA A;  5LCW C;  1WM5 A;  3V2X A;  1YCS B;  2LSU A;  3ASG A;  1E8Z A;  4J8E A;  3UX4 A;  4I6J A;  3ML9 A;  2DYR E;  4I17 A;  5EN5 D;  3SFY A;  4N39 A;  2IJG X;  5G05 J;  3ONL A;  5B1A E;  2OVF A;  3FUD A;  1G3N B;  2GRM A;  5FQ8 A;  2CFZ A;  1HX8 A;  5T4Y A;  5B3S E;  3TWT A;  1SQM A;  3ENE A;  4CDR A;  3UQ3 A;  3V2O A;  1TN7 A;  3SQV A;  3HIZ A;  4L2L A;  3EDT B;  4FAD A;  2ETB A;  4GA0 A;  4JVS A;  3AG4 E;  1H0A A;  4NUR A;  5JJT A;  1FT1 A;  2RFA A;  3SHF A;  3ULQ A;  2CG2 A;  3FU0 A;  3MV2 B;  2E0I A;  3MYV A;  4ANX A;  3CSF A;  5KNH D;  2X3M A;  4XEI G;  2GRN B;  2WXP A;  3DSU A;  2VSN A;  2XPI A;  3FUF A;  3Q73 A;  3D9O A;  4UQX A;  3CK9 A;  3W9F A;  1HFA A;  2YHE A;  1ELR A;  2XHE A;  3QWW A;  4HOQ A;  2F37 A;  4ILH B;  4PDX A;  3QWV A;  5CER B;  2PL2 A;  1BLX B;  3LEW A;  2EIJ E;  5EX0 A;  3I4R B;  5AJL A;  4FP7 A;  5LOZ A;  4RVB A;  4UWH A;  4F1S A;  4N5Q A;  3I4G A;  4F53 A;  4JEU A;  3Q47 B;  2H6H A;  1JUQ A;  3D9L A;  1EPU A;  4JB8 P;  1HF8 A;  4HOT A;  5FIO A;  4C48 B;  4DX2 A;  1PC2 A;  1RW2 A;  1OXJ A;  3TWR A;  1ZB1 A;  2IU1 A;  4YVO A;  5KJK A;  2Y69 E;  2WXH A;  3ZNG A;  4LNG A;  2YHC A;  2WXF A;  3ISM C;  5BV0 A;  1BD8 A;  4JA7 A;  3L22 A;  4DLO A;  3QC1 A;  2NSZ A;  5BUZ A;  2HYZ A;  3FTW A;  4I2W A;  1O1T A;  3DSV A;  4AXH A;  4XX5 A;  5JHA A;  3CVX A;  2HR2 A;  4ZHB A;  3FEY A;  2YQ8 A;  3QDN A;  1E8Y A;  4FJY A;  4GZ3 A;  2MHK A;  2OND A;  3UIO C;  1JWG A;  2VGX A;  2ZXW E;  3APF A;  3PEU B;  3ZIM A;  3P2B A;  2VTB A;  3QNK A;  3JUE A;  2VGE A;  2MYO A;  4B0Z A;  1D8E A;  3RAU A;  1OCR E;  1IKN D;  3CHQ A;  3EIQ C;  1H19 A;  4ABN A;  3SNX A;  1H6P A;  3D9I A;  3Q15 A;  4EZK A;  4MKT A;  3T5X A;  3N71 A;  2E2E A;  4GYW A;  4G25 A;  4HFG A;  3RRU A;  4B8A A;  3IKO B;  4G23 A;  4APF A;  4L23 A;  3CVN A;  4DRX E;  3PDN A;  3G2U A;  2EIN E;  4JZY A;  3ZYK A;  3ZUV B;  4U0U A;  3UUX A;  3CGH A;  1O1R A;  2ETA A;  1GW6 A;  2XPZ A;  1MX4 A;  3AU5 A;  2V4L A;  2QC9 A;  4JHK A;  5ANR A;  4L1B A;  1D8D A;  4JA9 A;  1N9A A;  3DSW A;  1HE8 A;  4LSZ E;  4O6F A;  4U04 A;  1H6O A;  5KJM A;  3APD A;  2CFU A;  3J5Q B;  4N5C A;  4BEP A;  3ZYM A;  3OXG A;  1E96 B;  2Y3A A;  2ION A;  1OCC E;  3TL5 A;  2I6H A;  3FH7 A;  3TWX A;  3WXX A;  4C0E A;  4PS8 A;  3ABM E;  1EDU A;  5FQ6 A;  1KZP A;  1LF8 A;  2OEW A;  4WAF A;  2QFC A;  1HG5 A;  3U66 A;  1PAQ A;  2HE0 A;  3NZU A;  5ARF A;  1EF1 C;  1V55 E;  1IHG A;  3LY8 A;  3R9M A;  3KS2 A;  3MJW A;  3HVE A;  3NB2 A;  3PEV B;  2C2L A;  4N2S A;  3AJI A;  5CCM A;  5KJL A;  2ZGD A;  1TJF A;  4GTP A;  4K5C A;  4LRZ A;  4Q96 A;  3PE3 A;  5HRY A;  2UY1 A;  3JCK C;  1UJJ A;  2CHZ A;  1QZ2 A;  1UJK A;  3DEP A;  1YYH A;  4N3B A;  2LNI A;  1OWM A;  5JJ6 A;  4PS7 A;  3ZPJ A;  4MRU A;  4HOU A;  2BKK B;  4XZ4 A;  4ILG A;  1OCO E;  4JL0 A;  1V54 E;  4I2Z A;  3TWS A;  3FUH A;  1E8W A;  4Y6W A;  3Q9N C;  5EID A;  3BG1 B;  2VTB B;  4FU3 A;  4Y6C A;  4UWL A;  4I43 A;  5AAR A;  3UMV A;  3ZGQ A;  4U63 A;  4GTT A;  5EIL A;  2L6B A;  3PZ1 A;  1ZBP A;  2P2C P;  3PNL B;  5AQB A;  1TNY A;  2L6J A;  3DPD A;  2V0P A;  3E34 A;  3QAR A;  2B6C A;  4FHK A;  4U0Z A;  4G11 A;  5HKP A;  3S7D A;  1RZ4 A;  3LCA A;  4YDO A;  3I3N A;  2GRL A;  5BNW A;  5CRV A;  4YND A;  5AN8 A;  4PS3 A;  1HZ4 A;  4NRH B;  4RG6 A;  2A4Z A;  1WY6 A;  3PUJ A;  2AW6 A;  4U0S A;  3EHM A;  2JLB A;  4JC8 A;  3EHN A;  1UG3 A;  2Y4T A;  3DSX A;  3WG7 E;  3CVQ A;  2R2L A;  3I5P A;  5J08 A;  2XGO A;  4WWP A;  3CVL A;  5ENN A;  1N4P A;  3R9A B;  4EQF A;  4HBD A;  4CGV A;  2JAB A;  4U07 A;  3FUE A;  3AG3 E;  3E32 A;  3IHV A;  2NYJ A;  4BX8 A;  1S70 B;  3CHR A;  2PM6 A;  4MBG A;  2NXP A;  4GML A;  4IN3 B;  2R02 A;  4GU5 A;  3ASN E;  3KEZ A;  4XI9 A;  1DNP A;  1Z5S C;  2A5E A;  4GA2 A;  3V30 A;  2X6K A;  4CGW A;  2XS1 A;  5HS0 A;  3FP3 A;  3MA5 A;  5ENR D;  2IO2 C;  2XRY A;  4I9C A;  3C72 A;  2DYS E;  2QYU A;  4FLB A;  2XCC A;  1Y8M A;  1TNB A;  3ULY A;  3GZ2 A;  2OVB A;  3B7B A;  4YDE A;  1HO8 A;  1DC2 A;  4DI4 A;  2IO3 C;  3B7S A;  5A7D B;  5M72 A;  3C5R A;  2BKG A;  4XKC A;  4E6H A;  3FTZ A;  1B89 A;  4OVU A;  4FA6 A;  3MZL B;  3RO3 A;  2BUG A;  2WVI A;  4K03 A;  3CST A;  1TR4 A;  2WPV A;  4KYO B;  3UIP C;  4O60 A;  3HXF A;  1ZU2 A;  4K5B A;  4UWG A;  2J8S D;  4BY6 A;  2P9I G;  5C1D A;  4KVM A;  1H6K A;  2VSO E;  3L6A A;  5HQ8 A;  3EU9 A;  2XPY A;  1N0Q A;  2XCB A;  2VSY A;  2XGM A;  4HI8 A;  2J9Q A;  1O5M A;  4AY5 A;  3KEA A;  4A3T A;  4WWO A;  3RRM B;  3AG2 E;  3ZYQ A;  5IY5 E;  4HVB A;  5ANL A;  2VGX B;  1LD8 A;  1AWC B;  5ENT D;  3TWV A;  4GTV A;  4GTS A;  2ILR A;  3RO2 A;  3IV0 A;  1K8K G;  1PY1 A;  3NOG D;  4GB9 A;  3RSE G;  2XRZ A;  1IHB A;  3FTY A;  4E85 A;  4GYY A;  3NAW A;  2P9P G;  4EHM A;  1MHQ A;  3D9K A;  5G04 J;  3V79 K;  3DPY A;  3ABL E;  3Q5M A;  2LAI A;  1HU3 A;  4O1P A;  4CT4 A;  3TG4 A;  3B7U X;  4I9E A;  1UN8 A;  1INZ A;  4M7C A;  4NIK A;  5DBK A;  2WXK A;  4HI9 A;  2XEN A;  2X6J A;  3IXE A;  4PUC A;  2V5Q C;  5CMY A;  4BER A; 
#chains in the Genus database with same CATH homology
 2RKK A;  4TXP A;  4TXQ A;  4U7E B;  2LUH A;  5H7P A;  2LXM A;  2LXL A;  4TXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...