2RKKA

Crystal structure of s.cerevisiae vta1 n-terminal domain
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
168
structure length
157
Chain Sequence
b'SMASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGLHVMNTLIHDQEKAKIYMLNFTMSLYNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein VTA1
publication title Structural basis of vta1 function in the multivesicular body sorting pathway.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lipid transport
total genus 67
structure length 157
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 2rkkA01
4TXQA 4TXRA 5H7PA 4TXPA 2LXLA 4U7EB 2LUHA 2RKKA 2LXMA
chains in the Genus database with same CATH superfamily
3T5XA 1L5JA 3DXKG 3IEGA 4C9BB 3ZHEA 1HS6A 4LG6A 4O1PA 3FP3A 3UTMA 1OCOE 2XZDG 4C0EA 2EIME 3CV0A 1YA0A 4FLHA 4Y6WA 3U3WA 4L2YA 3ASHA 4NQ0A 3U4TA 3LEWA 3E32A 2VGXB 2FF4A 2XS8A 1QZ2A 3BG0B 3RO2A 2LSUA 3KSQA 3D9JA 2X6FA 5LCWJ 4IRUA 3CHMA 2PQNA 4HVBA 1JCSA 4CDRA 1E8ZA 4GYOA 3ZYMA 5JA4D 1RZ4A 3CSTA 2WPVA 4ME2A 3SD5A 4B89A 2P2CP 4O6FA 4H7YA 5HKPA 4AIFA 2X3MA 4CGWA 3AS5A 5AJDA 5ANLA 1SA4A 3Q7FA 3W9FA 3C5RA 4JHKA 2B0OE 5KCMA 3UT8A 5JHAA 3AS4A 2NYJA 3D9KA 2WQ6A 4WNFA 3CEQA 4PH4B 3HXCA 4AEZC 1H2UA 1N4QA 1H6KA 3NQPA 3MKQA 2KATA 2WXKA 2IF4A 3CK7A 2XPYA 4G26A 1S64A 4A55A 3HHMA 4UI9J 4GYYA 5A23A 2VTBB 3FU5A 3CK9A 3S7FA 4G8LA 1JWGA 3FY4A 1Z5SC 4U7EB 3SI5A 2OCCE 4N3CA 4DI3A 4LERA 2ETCA 5AN8A 3UUXA 1OXJA 4B93B 3WG7E 4ILIA 1QBQA 3L22A 2QYJA 5G04J 1BLXB 3VTYA 1H19A 3TG4A 4AP2A 2QZAA 3SO8A 3HXFA 3CVNA 2LO6A 3OXFA 5JJTA 2I2OA 3VLEA 1RW2A 1Z3XA 2IQCA 3QB2A 3NZUA 5AAOA 4B0ZA 3FTUA 1X81A 2VGEA 2Y69E 4MKTA 4EZJA 2XPZA 4OVVA 4APFA 5CRUA 3C3QA 4PS3A 4IN3B 3C3OA 4HQDA 3EJNA 2RFAA 2XQ0A 3LVRE 3PZ1A 4G25A 5KBAA 4A3TA 3DBSA 2YHCA 2ONDA 3FTWA 1KT0A 3ASFA 1SVXA 5BXOA 3MGBA 5ARFA 3ASNE 2NXPA 1MX6A 5FZRA 2RG8A 3QKYA 1QYMA 2RKKA 1N0RA 3DSTA 3TXMA 2LXMA 1JCQA 3FUIA 4NACA 3SF4A 1JWFA 5AQ9A 1S70B 1B89A 1MJ0A 5H7PA 3LPZA 1HZ4A 4I17A 4OAUC 3CKCA 2AXVA 5CCMA 4GA2A 1TNBA 2J08A 4GZ5A 2L0IA 4BERA 3MZLB 3L17A 4FHKA 4KVMA 3G2TA 4NIKA 4GCOA 3FTYA 2IO2C 4B8AA 3ZYQA 3S7BA 4DX2A 5G2NA 2EIJE 2H6GA 2J09A 1JUQA 5DBKA 3OXGA 5ENNA 3O48A 4J7WA 2WQ7A 5C2YA 3EHMA 3LYAA 4IULA 4FU3A 4RG6A 5HQ8A 3FDHA 2CFZA 1TR4A 3ABKE 3ZYKA 1ELKA 2BUGA 3D9MA 4M3OA 3V31A 5CBNA 3T9KA 3FH7A 3TAXA 1NA3A 1FPPA 3EIJA 5FT9A 1NA0A 3FEXA 4HNAD 1W3BA 1N95A 4HRLA 2PM6A 4HRMB 4GZCA 4ABNA 3RO3A 4EQFA 2B6CA 2NSZA 2XGOA 2ILRA 3EHRA 4R7LA 3JQ0A 3AG3E 1ZB1A 4UQYA 4U0SA 3AJIA 1KZPA 3LCAA 3B7RL 1Y8MA 3CGHA 2X6IA 3I4RB 1E8YA 3RKVA 3UT7A 3UT4A 4I1MA 4J8DA 4U8VD 1JPLA 4UQXA 4XX5A 4N39A 4B94A 5E76A 4U0UA 5EX3A 2Q7FA 1O1TA 2KM4A 1XNFA 1EPUA 2V5FA 2WM9A 1ZU2A 4F3VA 5BXUA 4RQIA 1N11A 1GW6A 3NBNB 4UWHA 4RLYA 4WUYA 4YDWA 3U64A 4N5QA 5FQ4A 4ZHBA 3FH5A 3C98A 5HI7A 1K8KG 3DPYA 3LXUX 3SBTB 2GRLA 4GMRA 4AV7A 5KWDA 1IYGA 5CEAA 3PUJA 1YYHA 4HB5A 3FH8A 5HS0A 4JL0A 5A6CA 3AU4A 1S0PA 3CVPA 4FJYA 3Q73A 3MKRA 4EPZA 3BEEA 4I6GA 3UIOC 1HF8A 2KZTB 3PUKA 3E37A 5BW8C 3FTXA 1IQUA 3EHNA 4YNDA 5G55A 1YCSB 5CHEE 4GPKA 3IBEA 2IEJA 3E30A 3CVYA 3ZW3A 1K1AA 4U96D 2RD0A 4V3IA 5AARA 2WXQA 3U66A 3CHSA 2WVIA 3PNTB 4XKBA 2DYRE 1Z6TA 3DSVA 1YMPA 4L9PA 4PUCA 5KNGA 3V79K 2J8SD 5EKQD 3ULYA 1IKND 3GYZA 3T8MA 4CT4A 3MEKA 1H6PA 1E8XA 4K5BA 4Q96A 3Q4AB 2WXOA 1NP7A 3HG0D 4WWOA 2ZGDA 3QWVA 1WG0A 3EU5A 1HG5A 4F1PA 5AJLA 2FO1E 4XKCA 1FVFA 4L23A 3TWVA 1MX4A 2XEHA 4GA1A 3KD7A 4BT8A 1HE8A 3Q75A 1NFIE 4HOQA 3Q49B 3SFYA 5LFAA 4BX9A 4LNUD 3UMVA 3ABME 5FQ7A 4LCTA 4K03A 3I4GA 5EILA 1DCQA 3LY8A 1BI8B 5E75A 3IXEA 2GRQB 1PC2A 3KS2A 1IQRA 2YNQA 1TJCA 4UI9C 2R05A 3VTXA 2QY7A 3L9TA 2VGYA 5JMND 2QYUA 4GU5A 4EZLA 3PE4A 3FTSA 5J90A 1WM5A 3LVQE 2Y1LE 2WXMA 2OOEA 2QFCA 2VSNA 4HI9A 2X6JA 3T8KA 2P9KG 4TXRA 5ITZF 4LEUA 2PM7A 2XZTG 4YDOA 2PL2A 1TNUA 4NRHB 4DK5A 5KJLA 4TUMA 4UI9K 3TWXA 4HOUA 4L2LA 5CEDB 5T3RA 4JA9A 4CGVA 1IHBA 5CERB 4ILGA 4K5CA 1OWMA 4GMJA 5KJNA 2P9SG 5LX8A 1BI7B 3HXBA 3UPVA 4G23A 4U8YD 3ZVVA 3NB2A 3QOUA 3TXNA 2J49A 1S63A 3RAUA 3FFLA 3L13A 4GTSA 4Y6CA 1AP7A 3JYSA 1KPSB 3ABLE 2CG3A 3HVEB 1P5QA 3HYMB 3IKOB 4HORA 4FJZA 1BU9A 2WXHA 4UWKA 3JCKC 3FULA 1D8EA 2HM8A 2DWZA 1HX8A 3FU3A 5BV0A 4WWNA 1WY6A 3D3MA 2J07A 5ENPD 5EN5D 4EZKA 3UM3A 3CVWA 4J6IA 3CQCB 4HOTA 2IOSA 1E90A 3Q78A 4HS2A 3UM1A 4JC8A 4G1TA 2WXNA 2ETAA 4XZ4A 5D2MC 4U07A 1UW4B 2A4ZA 5T4YA 2XGMA 4GYWA 3KEAA 3JQ1A 1TYQG 4GTRA 3UINC 2PQRA 5LP0A 1KZOA 1U3DA 4JEHA 3TL5A 2F0YA 2L6JA 2DYSE 3TWSA 2YINA 3FEYA 2AJAA 5EYLA 1N0QA 2WB2A 2VYIA 4DX6D 3Q5MA 4W9RA 1ELRA 4IYPA 3IHVA 3HXDA 5T8IA 1OUVA 3Q79A 4YVQC 2WXGA 4PS7A 3ZKJA 3NF1A 4P29A 3ML9A 2X6KA 1OT8A 4H7XA 3DXMG 3RRNB 2XRYA 4GMLA 4JHJA 2M63A 1JCRA 3HXEA 1UOHA 3B7SA 2Y4TA 4AM9A 2DIWA 2R03A 1LD8A 3CVLA 3FUKA 1DNPA 4XEIG 2UY1B 3CSFA 2VJ8A 5BUZA 2V0PA 1HFAA 4KZ0A 2AWIA 3MJWA 2X6HA 4MBGA 1SZ9A 1TNZA 3SZ7A 2OEVA 4FULA 1O1SA 1TEZA 1N52A 4HLLA 2DZNA 2P9PG 4LNGA 3ZN3A 4DUIA 5KJMA 1FCHA 4OYSA 3ZHEB 2V4HC 5C1DA 3UM0A 4A3VA 4FLBA 4K0RA 4EHMA 2Y3AA 2A5EA 3B7BA 3FU0A 3JUIA 1N4RA 3PNLB 4EBAA 1E8WA 2LUHA 2IONA 3OTNA 4E85A 4LSZE 2WXJA 2I1JA 4JZYA 1EDUA 5FWQA 3RU0A 2GRNB 3UI2A 3AG1E 1ELWA 2FBNA 3RSEG 1LTXA 2GRRB 4WAFA 4PS8A 3KSLA 5BNWA 3O4ZA 4A1GA 2P9IG 2PZIA 2MRIA 4I2ZA 1IXVA 4J8EA 3R9MA 2F8XK 1A5EA 2CG2A 3DSSA 1HH8A 4GPMA 3CK8A 2OVFA 3DSXA 4JXTA 4G11A 3SNXA 5AENA 3ZRHA 5DIZA 3PZ3A 2LSVA 2R5SA 3IV0A 1OCCE 4GTVA 4N2SA 1U2VG 3MKQB 4O1OA 1TNOA 1OY3D 3ULEG 4I2WA 4N3BA 4TXPA 1WDYA 3MYVA 5J08A 4ZFHA 4G2VA 2VSXE 3QNKA 4GTQA 3MV3B 3E33A 3LKUA 3JXIA 3X2QE 5BV1A 4JHRA 1E7UA 2GRPB 5CECB 3QARA 4GZ3A 4JW1A 2FO7A 4WNGA 4BTBA 2J4DA 1V54E 3VLFA 3Q47B 4KT6B 1ZBPA 3I5PA 3AS8A 4KXKB 5CMYA 3CVUA 4XE0A 4GZDA 3N71A 3EDTB 2F37A 4NURA 4RG9A 4U95D 4I43A 2OV8A 2XPIA 5D0OD 3KAEA 2WXRA 3RRUA 1O1RA 5EIBE 3FHEA 2C0MA 4BEPA 3V2XA 4KBQA 2ETBA 4U04A 3LDZA 3CHQA 1TN6A 3FUDA 3JUEA 2WMOA 3QWWA 3CLJA 4J8YA 3P2BA 2HO1A 2JABA 3ZFWA 4N2QA 4CYMD 4M7CA 2VGXA 4FADA 2DBAA 3MCXA 2IOLA 3SFZA 4DI4A 4HOSA 2R02A 3UKUG 2H6HA 2GGFA 5AYWD 3TG5A 3HVEA 4CDNA 4TRQA 3UQ3A 3UXGA 5HRYA 3D9NA 2WXLA 4BWRA 3L54A 4GAAA 1AWCB 4OAVB 2L6BA 3MX3A 3E4BA 4DX5D 2OVBA 2R2LA 4CZ2D 3MV2B 2V8SE 5LCWC 3U9WA 3UKRG 3RIBA 3IHYA 4RSYA 4I1OB 5ENSD 2DZOA 2I9CA 2MHKA 1PY1A 3CHPA 3D9HA 3FUJA 4OVUA 2C2LA 3B95A 3T5VA 2VSOE 3FWVA 3ZU7B 2XENA 2VTBA 3TWRA 4YDYA 1DC2A 4UWGA 2BKKB 2WXPA 4I9EA 5M72A 2PNNA 4UQZA 2Y0BG 2R59A 4Q69A 2HYZA 5G05J 1HG2A 3PH0C 4I6EA 4KYOB 4HRNA 3UM2A 4BTAA 3SGHA 2GW1A 4JB8P 5ANRA 4J0UA 3CVXA 5KNHD 1EF1C 4F6RD 3URZA 3AG2E 2UY1A 4ANVA 3GZSA 3ZYLA 4FA6A 4BFRA 1U3CA 4AOFA 3L82A 3DSWA 2HE0A 4DPRA 2WXIA 4L7TA 3APDA 1BPOA 1K3ZD 5G04C 4UWLA 4BETA 3BQOA 3J5PA 4HXIA 2HR2A 2CHWA 1MQSA 5BPPA 3TJPA 1FVHA 4KMOA 2CHZA 4ILHB 2QC9A 5FZQA 1SZAA 1OWLA 3NZSA 3BUAA 3QAQA 4I9CA 3ONKA 3CHOA 3APCA 4QQIA 4BSXA 4UUCA 3ASGA 4GA0A 3D9IA 2XS1A 2I6HA 1MHQA 2XRZA 3ASOE 3HDXA 1E96B 4AY5A 4XIFA 4PDXA 3TWUA 3R7QA 1OWNA 1TN7A 4GZ6A 2WXFA 1OCRE 1SW6A 3ISMC 2H6IA 3TWQA 1H6OA 3NOGD 1SA5A 3EU9A 3LY7A 2FULA 4ATGA 2P9UG 1TJFA 2EQXA 3D9OA 2H6FA 1N54A 1H2VC 3ENEA 2V5QC 3FUEA 5ENOD 4JVSA 3FUHA 3APFA 1FT2A 2JEKA 3W9GA 2UWJG 3VLDA 5EIDA 2J9QA 3DRAA 3G2VA 1INZA 2BEDA 4HLEA 4BX8A 3L16A 3PEUB 3GZ1A 3QDNA 5A7DB 3V30A 4JA7A 3OAWA 4ACLA 3ZXPA 2XCCA 3GW4A 2LXLA 1TN8A 1OWOA 1EYHA 4G24A 4LUNU 4XI9A 3ZIMA 4WWPA 2CHXA 4JPSA 1XGWA 3ZNGA 3DWLG 4K5AB 2WQHA 3ZGQA 4ANXA 2FI7A 5JHBA 2BKGA 1MYOA 3S2AA 3FU6A 3BG1B 1H0AA 3FTZA 2OEWA 2EINE 4YVOA 4FC8A 1OCZE 5AQ7A 2ZXWE 3RRMB 4U0ZA 1QQEA 5FIOA 3PEVB 4JEUA 4DLQA 4TV3A 3UX4A 3DEOA 1NL4A 3LY9A 3MA5A 3Q9UC 3CVVA 1N4PA 2IU1A 4LNBA 1NZNA 3ONLA 1LF8A 3ZXSA 1KT1A 2YQ8A 4ANUA 4UWFA 1HU3A 1Q2ZA 5B1AE 4N3AA 3NAWA 3S7DA 5ENTD 3TWWA 4AJWA 1A17A 3D9LA 4Q94A 4MS6A 2KZTA 1V55E 3RJVA 3LJNA 2IO3C 1UJKA 4A1SA 1WAO1 1Z3YA 2AXUA 5CBOA 4AY6A 2C0LA 5ENRD 2P9LG 3C72A 3CQGB 4GTOA 1HXIA 1HO8A 5CRVA 3V2OA 2LNIA 5JJ6A 5B3SE 3PZ4A 5AQBA 4N5CA 1MX2A 3GZ2A 3EUVA 3AAAC 1H2TC 3R7RA 3ZUVB 4I6JA 3Q7AA 4BT9A 2KCLA 5ENQD 3SBSA 5KJKA 4CEMA 3QJZA 3SQVA 4C0MA 3DSUA 4MLPA 1N4SA 2NC9A 4XI0A 4DX1A 4AVXA 4GTTA 4C48B 2GRMA 1D8DA 2ZGGA 4ACKA 2XHEA 5ARGA 3CHRA 4WNEA 3KEZA 3LJ3A 4KVOA 2IJGX 4U63A 3TGOA 1O5MA 2A5UA 4L1BA 4CCAA 5AIJA 2KBXA 1UG3A 1UJJA 3UIPC 2ZISA 4F1SA 4D10C 4DX7D 3SHFA 4F53A 5D66A 4J8SA 4E6HA 2KCVA 3G2WA 3FUFA 1NI1A 3PZDA 2EIKE 2YHEA 1N94A 2AW6A 5CCLA 3HRAA 3SFXA 3B13A 4BY6A 3ESKA 4F7AA 2JLBA 2E0IA 3FUNA 5AQAA 3AU5A 4B8CB 1D9SA 2Y4UA 3NOCD 1LD7A 5BT1A 5FINA 3L6AA 4WNDA 2XEEA 1Y6IA 3J5QB 5G05C 4EBAG 2AVPA 3PVLA 3PE3A 4O60A 1G3NB 5D0QD 2MYOA 2EILE 4RVBA 1TNYA 3P1UA 4G8KA 2LAHA 4LRZA 2BF0X 4GTPA 1MZCA 2MOWA 3CIAA 2V4LA 3QK0A 2AXZA 4Z68A 4JD2G 4BSZB 2CFUA 2VSYA 3I3NA 4GCNA 4GTMA 5EYPF 4FP7A 3FTVA 2DCPA 5B1BE 2F8YA 3ZEFA 1DCEA 5FZSA 3HIZA 4J8FA 3BU8A 2IY0C 4MRUA 5FTPA 3L08A 2P58C 4CDMA 1UN8A 2XGSA 4APOA 4BESA 3CKBA 2R17C 3AG4E 3QWPA 1QNFA 3B7UX 3OXLA 3E34A 3TWTA 3ESLA 1UN9A 3S7JA 5EDSA 3R9AB 2ZU6B 2DVWA 3PRZA 4HBDA 4ATZD 3G2SA 3PDNA 5FQ8A 5EX0A 3Q15A 4FHJA 4I1AA 3EHQA 5FQ6A 1X5BA 2E2EA 3F6QA 3JXJA 3LS8A 1K1BA 2LAIA 2KCKA 3B7TA 2FEZA 4KZCA 4ANWA 3ULQA 2P9NG 1FT1A 5FJYA 2GROB 1IHGA 2BTDA 2KXPC 3PS6A 3CR3A 2I1KA 4URKA 4AXHA 3SY2A 3DPDA 3PZ2A 2ZIRA 2RFMA 3FUMA 1KLXA 2XCBA 3Q9NC 5IY5E 3G2UA 1VDYA 4U8HA 3ML8A 3PREA 4HI8A 3QC1A 5LOZA 4DRXE 2KC7A 3WXXA 4X8QA 3ASDA 5JJ7A 3DEPA 3K9IA 4HFGA 4YDEA 4CRWA 2X38A 3CVQA 2J4BA 4DJAA 4DLOA 1N9AA 5CMWA 4EECA 3EIQC 1E7VA 1SQMA 4GB9A 1PAQA 1OWPA 2L9BA 2L0TB 3C3RA 3ZPJA 2WMNA 3D9PA 4CT0A 4QFVA 2VQ2A 2XEVA 4TXQA 2IFUA 1DVPA 4TUUA 4A63B 1BD8A 3RK6A
chains in the Genus database with same CATH topology
4TXQA 4TXRA 5H7PA 4TXPA 2LXLA 4U7EB 2LUHA 2RKKA 2LXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TXQ A;  4TXR A;  5H7P A;  4TXP A;  2LXL A;  4U7E B;  2LUH A;  2RKK A;  2LXM A; 
#chains in the Genus database with same CATH topology
 3T5X A;  1L5J A;  3DXK G;  3IEG A;  4C9B B;  3ZHE A;  1HS6 A;  4LG6 A;  4O1P A;  3FP3 A;  3UTM A;  1OCO E;  2XZD G;  4C0E A;  2EIM E;  3CV0 A;  1YA0 A;  4FLH A;  4Y6W A;  3U3W A;  4L2Y A;  3ASH A;  4NQ0 A;  3U4T A;  3LEW A;  3E32 A;  2VGX B;  2FF4 A;  2XS8 A;  1QZ2 A;  3BG0 B;  3RO2 A;  2LSU A;  3KSQ A;  3D9J A;  2X6F A;  5LCW J;  4IRU A;  3CHM A;  2PQN A;  4HVB A;  1JCS A;  4CDR A;  1E8Z A;  4GYO A;  3ZYM A;  5JA4 D;  1RZ4 A;  3CST A;  2WPV A;  4ME2 A;  3SD5 A;  4B89 A;  2P2C P;  4O6F A;  4H7Y A;  5HKP A;  4AIF A;  2X3M A;  4CGW A;  3AS5 A;  5AJD A;  5ANL A;  1SA4 A;  3Q7F A;  3W9F A;  3C5R A;  4JHK A;  2B0O E;  5KCM A;  3UT8 A;  5JHA A;  3AS4 A;  2NYJ A;  3D9K A;  2WQ6 A;  4WNF A;  3CEQ A;  4PH4 B;  3HXC A;  4AEZ C;  1H2U A;  1N4Q A;  1H6K A;  3NQP A;  3MKQ A;  2KAT A;  2WXK A;  2IF4 A;  3CK7 A;  2XPY A;  4G26 A;  1S64 A;  4A55 A;  3HHM A;  4UI9 J;  4GYY A;  5A23 A;  2VTB B;  3FU5 A;  3CK9 A;  3S7F A;  4G8L A;  1JWG A;  3FY4 A;  1Z5S C;  4U7E B;  3SI5 A;  2OCC E;  4N3C A;  4DI3 A;  4LER A;  2ETC A;  5AN8 A;  3UUX A;  1OXJ A;  4B93 B;  3WG7 E;  4ILI A;  1QBQ A;  3L22 A;  2QYJ A;  5G04 J;  1BLX B;  3VTY A;  1H19 A;  3TG4 A;  4AP2 A;  2QZA A;  3SO8 A;  3HXF A;  3CVN A;  2LO6 A;  3OXF A;  5JJT A;  2I2O A;  3VLE A;  1RW2 A;  1Z3X A;  2IQC A;  3QB2 A;  3NZU A;  5AAO A;  4B0Z A;  3FTU A;  1X81 A;  2VGE A;  2Y69 E;  4MKT A;  4EZJ A;  2XPZ A;  4OVV A;  4APF A;  5CRU A;  3C3Q A;  4PS3 A;  4IN3 B;  3C3O A;  4HQD A;  3EJN A;  2RFA A;  2XQ0 A;  3LVR E;  3PZ1 A;  4G25 A;  5KBA A;  4A3T A;  3DBS A;  2YHC A;  2OND A;  3FTW A;  1KT0 A;  3ASF A;  1SVX A;  5BXO A;  3MGB A;  5ARF A;  3ASN E;  2NXP A;  1MX6 A;  5FZR A;  2RG8 A;  3QKY A;  1QYM A;  2RKK A;  1N0R A;  3DST A;  3TXM A;  2LXM A;  1JCQ A;  3FUI A;  4NAC A;  3SF4 A;  1JWF A;  5AQ9 A;  1S70 B;  1B89 A;  1MJ0 A;  5H7P A;  3LPZ A;  1HZ4 A;  4I17 A;  4OAU C;  3CKC A;  2AXV A;  5CCM A;  4GA2 A;  1TNB A;  2J08 A;  4GZ5 A;  2L0I A;  4BER A;  3MZL B;  3L17 A;  4FHK A;  4KVM A;  3G2T A;  4NIK A;  4GCO A;  3FTY A;  2IO2 C;  4B8A A;  3ZYQ A;  3S7B A;  4DX2 A;  5G2N A;  2EIJ E;  2H6G A;  2J09 A;  1JUQ A;  5DBK A;  3OXG A;  5ENN A;  3O48 A;  4J7W A;  2WQ7 A;  5C2Y A;  3EHM A;  3LYA A;  4IUL A;  4FU3 A;  4RG6 A;  5HQ8 A;  3FDH A;  2CFZ A;  1TR4 A;  3ABK E;  3ZYK A;  1ELK A;  2BUG A;  3D9M A;  4M3O A;  3V31 A;  5CBN A;  3T9K A;  3FH7 A;  3TAX A;  1NA3 A;  1FPP A;  3EIJ A;  5FT9 A;  1NA0 A;  3FEX A;  4HNA D;  1W3B A;  1N95 A;  4HRL A;  2PM6 A;  4HRM B;  4GZC A;  4ABN A;  3RO3 A;  4EQF A;  2B6C A;  2NSZ A;  2XGO A;  2ILR A;  3EHR A;  4R7L A;  3JQ0 A;  3AG3 E;  1ZB1 A;  4UQY A;  4U0S A;  3AJI A;  1KZP A;  3LCA A;  3B7R L;  1Y8M A;  3CGH A;  2X6I A;  3I4R B;  1E8Y A;  3RKV A;  3UT7 A;  3UT4 A;  4I1M A;  4J8D A;  4U8V D;  1JPL A;  4UQX A;  4XX5 A;  4N39 A;  4B94 A;  5E76 A;  4U0U A;  5EX3 A;  2Q7F A;  1O1T A;  2KM4 A;  1XNF A;  1EPU A;  2V5F A;  2WM9 A;  1ZU2 A;  4F3V A;  5BXU A;  4RQI A;  1N11 A;  1GW6 A;  3NBN B;  4UWH A;  4RLY A;  4WUY A;  4YDW A;  3U64 A;  4N5Q A;  5FQ4 A;  4ZHB A;  3FH5 A;  3C98 A;  5HI7 A;  1K8K G;  3DPY A;  3LXU X;  3SBT B;  2GRL A;  4GMR A;  4AV7 A;  5KWD A;  1IYG A;  5CEA A;  3PUJ A;  1YYH A;  4HB5 A;  3FH8 A;  5HS0 A;  4JL0 A;  5A6C A;  3AU4 A;  1S0P A;  3CVP A;  4FJY A;  3Q73 A;  3MKR A;  4EPZ A;  3BEE A;  4I6G A;  3UIO C;  1HF8 A;  2KZT B;  3PUK A;  3E37 A;  5BW8 C;  3FTX A;  1IQU A;  3EHN A;  4YND A;  5G55 A;  1YCS B;  5CHE E;  4GPK A;  3IBE A;  2IEJ A;  3E30 A;  3CVY A;  3ZW3 A;  1K1A A;  4U96 D;  2RD0 A;  4V3I A;  5AAR A;  2WXQ A;  3U66 A;  3CHS A;  2WVI A;  3PNT B;  4XKB A;  2DYR E;  1Z6T A;  3DSV A;  1YMP A;  4L9P A;  4PUC A;  5KNG A;  3V79 K;  2J8S D;  5EKQ D;  3ULY A;  1IKN D;  3GYZ A;  3T8M A;  4CT4 A;  3MEK A;  1H6P A;  1E8X A;  4K5B A;  4Q96 A;  3Q4A B;  2WXO A;  1NP7 A;  3HG0 D;  4WWO A;  2ZGD A;  3QWV A;  1WG0 A;  3EU5 A;  1HG5 A;  4F1P A;  5AJL A;  2FO1 E;  4XKC A;  1FVF A;  4L23 A;  3TWV A;  1MX4 A;  2XEH A;  4GA1 A;  3KD7 A;  4BT8 A;  1HE8 A;  3Q75 A;  1NFI E;  4HOQ A;  3Q49 B;  3SFY A;  5LFA A;  4BX9 A;  4LNU D;  3UMV A;  3ABM E;  5FQ7 A;  4LCT A;  4K03 A;  3I4G A;  5EIL A;  1DCQ A;  3LY8 A;  1BI8 B;  5E75 A;  3IXE A;  2GRQ B;  1PC2 A;  3KS2 A;  1IQR A;  2YNQ A;  1TJC A;  4UI9 C;  2R05 A;  3VTX A;  2QY7 A;  3L9T A;  2VGY A;  5JMN D;  2QYU A;  4GU5 A;  4EZL A;  3PE4 A;  3FTS A;  5J90 A;  1WM5 A;  3LVQ E;  2Y1L E;  2WXM A;  2OOE A;  2QFC A;  2VSN A;  4HI9 A;  2X6J A;  3T8K A;  2P9K G;  4TXR A;  5ITZ F;  4LEU A;  2PM7 A;  2XZT G;  4YDO A;  2PL2 A;  1TNU A;  4NRH B;  4DK5 A;  5KJL A;  4TUM A;  4UI9 K;  3TWX A;  4HOU A;  4L2L A;  5CED B;  5T3R A;  4JA9 A;  4CGV A;  1IHB A;  5CER B;  4ILG A;  4K5C A;  1OWM A;  4GMJ A;  5KJN A;  2P9S G;  5LX8 A;  1BI7 B;  3HXB A;  3UPV A;  4G23 A;  4U8Y D;  3ZVV A;  3NB2 A;  3QOU A;  3TXN A;  2J49 A;  1S63 A;  3RAU A;  3FFL A;  3L13 A;  4GTS A;  4Y6C A;  1AP7 A;  3JYS A;  1KPS B;  3ABL E;  2CG3 A;  3HVE B;  1P5Q A;  3HYM B;  3IKO B;  4HOR A;  4FJZ A;  1BU9 A;  2WXH A;  4UWK A;  3JCK C;  3FUL A;  1D8E A;  2HM8 A;  2DWZ A;  1HX8 A;  3FU3 A;  5BV0 A;  4WWN A;  1WY6 A;  3D3M A;  2J07 A;  5ENP D;  5EN5 D;  4EZK A;  3UM3 A;  3CVW A;  4J6I A;  3CQC B;  4HOT A;  2IOS A;  1E90 A;  3Q78 A;  4HS2 A;  3UM1 A;  4JC8 A;  4G1T A;  2WXN A;  2ETA A;  4XZ4 A;  5D2M C;  4U07 A;  1UW4 B;  2A4Z A;  5T4Y A;  2XGM A;  4GYW A;  3KEA A;  3JQ1 A;  1TYQ G;  4GTR A;  3UIN C;  2PQR A;  5LP0 A;  1KZO A;  1U3D A;  4JEH A;  3TL5 A;  2F0Y A;  2L6J A;  2DYS E;  3TWS A;  2YIN A;  3FEY A;  2AJA A;  5EYL A;  1N0Q A;  2WB2 A;  2VYI A;  4DX6 D;  3Q5M A;  4W9R A;  1ELR A;  4IYP A;  3IHV A;  3HXD A;  5T8I A;  1OUV A;  3Q79 A;  4YVQ C;  2WXG A;  4PS7 A;  3ZKJ A;  3NF1 A;  4P29 A;  3ML9 A;  2X6K A;  1OT8 A;  4H7X A;  3DXM G;  3RRN B;  2XRY A;  4GML A;  4JHJ A;  2M63 A;  1JCR A;  3HXE A;  1UOH A;  3B7S A;  2Y4T A;  4AM9 A;  2DIW A;  2R03 A;  1LD8 A;  3CVL A;  3FUK A;  1DNP A;  4XEI G;  2UY1 B;  3CSF A;  2VJ8 A;  5BUZ A;  2V0P A;  1HFA A;  4KZ0 A;  2AWI A;  3MJW A;  2X6H A;  4MBG A;  1SZ9 A;  1TNZ A;  3SZ7 A;  2OEV A;  4FUL A;  1O1S A;  1TEZ A;  1N52 A;  4HLL A;  2DZN A;  2P9P G;  4LNG A;  3ZN3 A;  4DUI A;  5KJM A;  1FCH A;  4OYS A;  3ZHE B;  2V4H C;  5C1D A;  3UM0 A;  4A3V A;  4FLB A;  4K0R A;  4EHM A;  2Y3A A;  2A5E A;  3B7B A;  3FU0 A;  3JUI A;  1N4R A;  3PNL B;  4EBA A;  1E8W A;  2LUH A;  2ION A;  3OTN A;  4E85 A;  4LSZ E;  2WXJ A;  2I1J A;  4JZY A;  1EDU A;  5FWQ A;  3RU0 A;  2GRN B;  3UI2 A;  3AG1 E;  1ELW A;  2FBN A;  3RSE G;  1LTX A;  2GRR B;  4WAF A;  4PS8 A;  3KSL A;  5BNW A;  3O4Z A;  4A1G A;  2P9I G;  2PZI A;  2MRI A;  4I2Z A;  1IXV A;  4J8E A;  3R9M A;  2F8X K;  1A5E A;  2CG2 A;  3DSS A;  1HH8 A;  4GPM A;  3CK8 A;  2OVF A;  3DSX A;  4JXT A;  4G11 A;  3SNX A;  5AEN A;  3ZRH A;  5DIZ A;  3PZ3 A;  2LSV A;  2R5S A;  3IV0 A;  1OCC E;  4GTV A;  4N2S A;  1U2V G;  3MKQ B;  4O1O A;  1TNO A;  1OY3 D;  3ULE G;  4I2W A;  4N3B A;  4TXP A;  1WDY A;  3MYV A;  5J08 A;  4ZFH A;  4G2V A;  2VSX E;  3QNK A;  4GTQ A;  3MV3 B;  3E33 A;  3LKU A;  3JXI A;  3X2Q E;  5BV1 A;  4JHR A;  1E7U A;  2GRP B;  5CEC B;  3QAR A;  4GZ3 A;  4JW1 A;  2FO7 A;  4WNG A;  4BTB A;  2J4D A;  1V54 E;  3VLF A;  3Q47 B;  4KT6 B;  1ZBP A;  3I5P A;  3AS8 A;  4KXK B;  5CMY A;  3CVU A;  4XE0 A;  4GZD A;  3N71 A;  3EDT B;  2F37 A;  4NUR A;  4RG9 A;  4U95 D;  4I43 A;  2OV8 A;  2XPI A;  5D0O D;  3KAE A;  2WXR A;  3RRU A;  1O1R A;  5EIB E;  3FHE A;  2C0M A;  4BEP A;  3V2X A;  4KBQ A;  2ETB A;  4U04 A;  3LDZ A;  3CHQ A;  1TN6 A;  3FUD A;  3JUE A;  2WMO A;  3QWW A;  3CLJ A;  4J8Y A;  3P2B A;  2HO1 A;  2JAB A;  3ZFW A;  4N2Q A;  4CYM D;  4M7C A;  2VGX A;  4FAD A;  2DBA A;  3MCX A;  2IOL A;  3SFZ A;  4DI4 A;  4HOS A;  2R02 A;  3UKU G;  2H6H A;  2GGF A;  5AYW D;  3TG5 A;  3HVE A;  4CDN A;  4TRQ A;  3UQ3 A;  3UXG A;  5HRY A;  3D9N A;  2WXL A;  4BWR A;  3L54 A;  4GAA A;  1AWC B;  4OAV B;  2L6B A;  3MX3 A;  3E4B A;  4DX5 D;  2OVB A;  2R2L A;  4CZ2 D;  3MV2 B;  2V8S E;  5LCW C;  3U9W A;  3UKR G;  3RIB A;  3IHY A;  4RSY A;  4I1O B;  5ENS D;  2DZO A;  2I9C A;  2MHK A;  1PY1 A;  3CHP A;  3D9H A;  3FUJ A;  4OVU A;  2C2L A;  3B95 A;  3T5V A;  2VSO E;  3FWV A;  3ZU7 B;  2XEN A;  2VTB A;  3TWR A;  4YDY A;  1DC2 A;  4UWG A;  2BKK B;  2WXP A;  4I9E A;  5M72 A;  2PNN A;  4UQZ A;  2Y0B G;  2R59 A;  4Q69 A;  2HYZ A;  5G05 J;  1HG2 A;  3PH0 C;  4I6E A;  4KYO B;  4HRN A;  3UM2 A;  4BTA A;  3SGH A;  2GW1 A;  4JB8 P;  5ANR A;  4J0U A;  3CVX A;  5KNH D;  1EF1 C;  4F6R D;  3URZ A;  3AG2 E;  2UY1 A;  4ANV A;  3GZS A;  3ZYL A;  4FA6 A;  4BFR A;  1U3C A;  4AOF A;  3L82 A;  3DSW A;  2HE0 A;  4DPR A;  2WXI A;  4L7T A;  3APD A;  1BPO A;  1K3Z D;  5G04 C;  4UWL A;  4BET A;  3BQO A;  3J5P A;  4HXI A;  2HR2 A;  2CHW A;  1MQS A;  5BPP A;  3TJP A;  1FVH A;  4KMO A;  2CHZ A;  4ILH B;  2QC9 A;  5FZQ A;  1SZA A;  1OWL A;  3NZS A;  3BUA A;  3QAQ A;  4I9C A;  3ONK A;  3CHO A;  3APC A;  4QQI A;  4BSX A;  4UUC A;  3ASG A;  4GA0 A;  3D9I A;  2XS1 A;  2I6H A;  1MHQ A;  2XRZ A;  3ASO E;  3HDX A;  1E96 B;  4AY5 A;  4XIF A;  4PDX A;  3TWU A;  3R7Q A;  1OWN A;  1TN7 A;  4GZ6 A;  2WXF A;  1OCR E;  1SW6 A;  3ISM C;  2H6I A;  3TWQ A;  1H6O A;  3NOG D;  1SA5 A;  3EU9 A;  3LY7 A;  2FUL A;  4ATG A;  2P9U G;  1TJF A;  2EQX A;  3D9O A;  2H6F A;  1N54 A;  1H2V C;  3ENE A;  2V5Q C;  3FUE A;  5ENO D;  4JVS A;  3FUH A;  3APF A;  1FT2 A;  2JEK A;  3W9G A;  2UWJ G;  3VLD A;  5EID A;  2J9Q A;  3DRA A;  3G2V A;  1INZ A;  2BED A;  4HLE A;  4BX8 A;  3L16 A;  3PEU B;  3GZ1 A;  3QDN A;  5A7D B;  3V30 A;  4JA7 A;  3OAW A;  4ACL A;  3ZXP A;  2XCC A;  3GW4 A;  2LXL A;  1TN8 A;  1OWO A;  1EYH A;  4G24 A;  4LUN U;  4XI9 A;  3ZIM A;  4WWP A;  2CHX A;  4JPS A;  1XGW A;  3ZNG A;  3DWL G;  4K5A B;  2WQH A;  3ZGQ A;  4ANX A;  2FI7 A;  5JHB A;  2BKG A;  1MYO A;  3S2A A;  3FU6 A;  3BG1 B;  1H0A A;  3FTZ A;  2OEW A;  2EIN E;  4YVO A;  4FC8 A;  1OCZ E;  5AQ7 A;  2ZXW E;  3RRM B;  4U0Z A;  1QQE A;  5FIO A;  3PEV B;  4JEU A;  4DLQ A;  4TV3 A;  3UX4 A;  3DEO A;  1NL4 A;  3LY9 A;  3MA5 A;  3Q9U C;  3CVV A;  1N4P A;  2IU1 A;  4LNB A;  1NZN A;  3ONL A;  1LF8 A;  3ZXS A;  1KT1 A;  2YQ8 A;  4ANU A;  4UWF A;  1HU3 A;  1Q2Z A;  5B1A E;  4N3A A;  3NAW A;  3S7D A;  5ENT D;  3TWW A;  4AJW A;  1A17 A;  3D9L A;  4Q94 A;  4MS6 A;  2KZT A;  1V55 E;  3RJV A;  3LJN A;  2IO3 C;  1UJK A;  4A1S A;  1WAO 1;  1Z3Y A;  2AXU A;  5CBO A;  4AY6 A;  2C0L A;  5ENR D;  2P9L G;  3C72 A;  3CQG B;  4GTO A;  1HXI A;  1HO8 A;  5CRV A;  3V2O A;  2LNI A;  5JJ6 A;  5B3S E;  3PZ4 A;  5AQB A;  4N5C A;  1MX2 A;  3GZ2 A;  3EUV A;  3AAA C;  1H2T C;  3R7R A;  3ZUV B;  4I6J A;  3Q7A A;  4BT9 A;  2KCL A;  5ENQ D;  3SBS A;  5KJK A;  4CEM A;  3QJZ A;  3SQV A;  4C0M A;  3DSU A;  4MLP A;  1N4S A;  2NC9 A;  4XI0 A;  4DX1 A;  4AVX A;  4GTT A;  4C48 B;  2GRM A;  1D8D A;  2ZGG A;  4ACK A;  2XHE A;  5ARG A;  3CHR A;  4WNE A;  3KEZ A;  3LJ3 A;  4KVO A;  2IJG X;  4U63 A;  3TGO A;  1O5M A;  2A5U A;  4L1B A;  4CCA A;  5AIJ A;  2KBX A;  1UG3 A;  1UJJ A;  3UIP C;  2ZIS A;  4F1S A;  4D10 C;  4DX7 D;  3SHF A;  4F53 A;  5D66 A;  4J8S A;  4E6H A;  2KCV A;  3G2W A;  3FUF A;  1NI1 A;  3PZD A;  2EIK E;  2YHE A;  1N94 A;  2AW6 A;  5CCL A;  3HRA A;  3SFX A;  3B13 A;  4BY6 A;  3ESK A;  4F7A A;  2JLB A;  2E0I A;  3FUN A;  5AQA A;  3AU5 A;  4B8C B;  1D9S A;  2Y4U A;  3NOC D;  1LD7 A;  5BT1 A;  5FIN A;  3L6A A;  4WND A;  2XEE A;  1Y6I A;  3J5Q B;  5G05 C;  4EBA G;  2AVP A;  3PVL A;  3PE3 A;  4O60 A;  1G3N B;  5D0Q D;  2MYO A;  2EIL E;  4RVB A;  1TNY A;  3P1U A;  4G8K A;  2LAH A;  4LRZ A;  2BF0 X;  4GTP A;  1MZC A;  2MOW A;  3CIA A;  2V4L A;  3QK0 A;  2AXZ A;  4Z68 A;  4JD2 G;  4BSZ B;  2CFU A;  2VSY A;  3I3N A;  4GCN A;  4GTM A;  5EYP F;  4FP7 A;  3FTV A;  2DCP A;  5B1B E;  2F8Y A;  3ZEF A;  1DCE A;  5FZS A;  3HIZ A;  4J8F A;  3BU8 A;  2IY0 C;  4MRU A;  5FTP A;  3L08 A;  2P58 C;  4CDM A;  1UN8 A;  2XGS A;  4APO A;  4BES A;  3CKB A;  2R17 C;  3AG4 E;  3QWP A;  1QNF A;  3B7U X;  3OXL A;  3E34 A;  3TWT A;  3ESL A;  1UN9 A;  3S7J A;  5EDS A;  3R9A B;  2ZU6 B;  2DVW A;  3PRZ A;  4HBD A;  4ATZ D;  3G2S A;  3PDN A;  5FQ8 A;  5EX0 A;  3Q15 A;  4FHJ A;  4I1A A;  3EHQ A;  5FQ6 A;  1X5B A;  2E2E A;  3F6Q A;  3JXJ A;  3LS8 A;  1K1B A;  2LAI A;  2KCK A;  3B7T A;  2FEZ A;  4KZC A;  4ANW A;  3ULQ A;  2P9N G;  1FT1 A;  5FJY A;  2GRO B;  1IHG A;  2BTD A;  2KXP C;  3PS6 A;  3CR3 A;  2I1K A;  4URK A;  4AXH A;  3SY2 A;  3DPD A;  3PZ2 A;  2ZIR A;  2RFM A;  3FUM A;  1KLX A;  2XCB A;  3Q9N C;  5IY5 E;  3G2U A;  1VDY A;  4U8H A;  3ML8 A;  3PRE A;  4HI8 A;  3QC1 A;  5LOZ A;  4DRX E;  2KC7 A;  3WXX A;  4X8Q A;  3ASD A;  5JJ7 A;  3DEP A;  3K9I A;  4HFG A;  4YDE A;  4CRW A;  2X38 A;  3CVQ A;  2J4B A;  4DJA A;  4DLO A;  1N9A A;  5CMW A;  4EEC A;  3EIQ C;  1E7V A;  1SQM A;  4GB9 A;  1PAQ A;  1OWP A;  2L9B A;  2L0T B;  3C3R A;  3ZPJ A;  2WMN A;  3D9P A;  4CT0 A;  4QFV A;  2VQ2 A;  2XEV A;  4TXQ A;  2IFU A;  1DVP A;  4TUU A;  4A63 B;  1BD8 A;  3RK6 A; 
#chains in the Genus database with same CATH homology
 4TXQ A;  4TXR A;  5H7P A;  4TXP A;  2LXL A;  4U7E B;  2LUH A;  2RKK A;  2LXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...