2RKLA

Crystal structure of s.cerevisiae vta1 c-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
GSTKDELTKIMDRASKIEQIQKLAKYAISALNYEDLPTAKDELTKALDLLNSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of vta1 function in the multivesicular body sorting pathway.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lipid transport
molecule keywords Vacuolar protein sorting-associated protein VTA1
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18097 Vta1_C Vta1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2rklA00
4NPDA 1BDCA 2KUBA 5CBOA 1OVUA 2QRXA 5C39A 1DEEG 2M5AB 2B87B 1H0TB 1LP1B 2UWJE 4ZNCA 2KZIA 1X0TA 1ZW0A 2QVAA 4NPFX 5DJTB 2KZJA 3QWOC 4HB1A 1SS1A 3RGUA 3PH0A 1U7MA 4GODA 2B89A 5K5GB 4CPGA 2M0BA 4IOIH 4ZMDA 2B87A 4NPEA 4BXLA 1EDLA 3FXEA 3S1KA 5CBNA 2KS1B 1LP1A 1OVVA 2LXBA 2WMMA 3MZWB 4WWIA 4K35A 4HJGH 3FXDA 5EFWB 1Y47A 1EDKA 2RKLA 2I8DA 2KIKA 2OTKE 1FC2C 4ASVA 4ASWA 4K3AA 4GOEA 2P58A 4HKZH 2JWDA 3ZDMA 2M5AA 1Q2NA 1NVOA 4JBZA 4EYYQ 2SPZA 1EDJA 2R44A 1OVRA 2LXCB 2B88A 4KJMA 1LT1A 3MHVA 1H0TA 2Q1KA 1EC5A 2ZAEB 1S3JA 1MFTA 2K3RA 4MN4C 2LR2A 1EDIA 4GOFA 2KI7B 1BDDA 1ZXGA 1JM0A 1JMBA 2HR3A 5DJUB 1U7JA
chains in the Genus database with same CATH superfamily
1SQVJ 3H25A 5KAFE 1MV8A 1Y8AA 5CBOA 2N1TA 3AECC 1AQ5A 4HH2A 2YMYA 1Q7YQ 3AEGC 3HUSA 4H13D 2KSJA 5C39A 1S5LH 3V2QA 3CCSP 4BWNA 3BATA 2WZ7A 2IBZD 1M1JA 1KN7A 3KZIH 2A06D 2M5AB 2PRRA 3H32A 4I7ZC 3SSUA 2QEXP 3TGUJ 1LP1B 2ITAA 2V7QH 3M9HA 2E42A 3AE9C 2KZIA 3CC2P 1VQOP 1K04A 1N2DC 2POHA 2QVAA 3EFGA 5DJTB 4C7NB 1S2EA 3L71G 4U3FD 1N73C 2KZJA 3L74G 3U1AA 5TJHA 1BCCE 4DZOA 4KT0J 3V4QA 3TGUG 1CZQA 1SS1A 1L0LD 3P8MC 5AW1B 3W68A 1CSBA 3CXHI 3GLMA 2O1JA 2FBWC 3N4XA 5AW5B 2BCCJ 1URQA 3VP9A 1SQQE 4H13C 3G9RA 3TDKA 3BASA 1QGKB 2A06G 3C1LA 2Z5IA 2JEEA 2KOGA 2E75C 1W2EA 1CI6A 3P8CD 1ZR2A 1NTMD 5L8RJ 1FJKA 1YTZI 1JCDA 1Z56A 2QJPB 2QM7A 5APUA 1PL5A 3GF7A 1VQ9P 1DX7A 1N7SD 2XKMA 3IR9A 2JJLA 2YKPA 4PD4I 3T97B 2WSEJ 3M06A 2IZ0A 1T8ZA 3CCQP 1JNMA 4IOIH 2WTYA 1KMIZ 4RJTA 3D70A 2AXTH 2Y0CA 1A02J 5AW6B 3O8ZA 1LNQA 1DIPA 3H32B 4NPEA 1EDLA 3S1KA 1KYOI 1NJIQ 2OYIA 1LTBC 1NU1K 1KILC 1VQMP 2XZRA 4IFDK 3NXSA 2LXBA 5CCGA 1GTWA 1L0NK 2OYHB 3MZWB 3GF3A 4WY4B 3CMEP 1G1IA 3AE8C 1LTSC 2WSCJ 3BCCJ 4N78E 3OW2O 1QVGO 3L71E 2AEJA 3CXHH 4YPCA 1SQQJ 4DCKA 1YIJP 2WT7A 1JY3N 1VL2A 4WY4D 1EDKA 1M7LA 1MZ9A 2RKLA 1BGYE 2ZXEB 1SFCB 1LTJC 5AW2B 5KKZB 1FZFA 2Q6QA 1VQ8P 3CCLP 3CX5E 2FYUD 3HE5A 5KTBA 1OFCX 3BCCG 3PJSK 2FFDC 5B5EH 1IO4A 1SQQG 3A0BH 2QIWA 3LW5J 3PP5A 3CWBE 4GOEA 1N8RQ 4HKZH 1NYHA 2E5YA 2JWDA 3GW6A 3H1LE 3V4WA 3I55P 2M5AA 1NTZJ 5E79H 3A5TA 3CXHE 3HD7A 4RO0A 1N73B 3M9BA 1NKZB 3HE4B 4JBZA 2G3AA 3SWFA 3G71P 1OW6A 3A7OA 1Q82Q 2NRGA 1VF5B 2I1JA 2R44A 1BCCD 1OVRA 3OA7A 1GL2D 2K1AA 3HE5B 3WMM0 1H0TA 2Q1KA 1EC5A 2H8PD 2IBZG 2ZAEB 3A3YB 1WRGA 2WVRA 2K3RA 4MN4C 3RL0B 1D7MA 1SQBD 2IBZI 2J5UA 3PLNA 2D2CC 1LTTC 4W7ZA 3NMDA 4EI2A 1S5LX 1NU1D 1NTKJ 2ZVOB 2KI7B 1GL2A 4D6TD 1GU4A 3B5NB 1J1DC 1KILB 3H1KD 3Q5RA 3JCUE 4HYTB 4GT1A 3IFMA 1NTMJ 2OARA 3I5CA 2NPSB 4LC1A 1T2KC 1L0LG 1RY3A 3HD7D 5DJUB 2ZJSE 4JQ0D 3CCMP 1PZQA 5APWA 5AW8B 1FAVA 1RE4A 5AW3B 3RL0g 3TNUB 1P84I 1BDCA 1BSHA 1Q81Q 1VDFA 2J58A 3H1HD 3EFFK 1L0NE 3F5HA 3H1HJ 1OW7A 1N73A 4AUWA 1H89A 2FXPA 5KJ7A 4UB6E 3JCUH 4UB8E 3TGUE 1JO5A 5AW0B 1USEA 2K88A 3L75E 4H0LB 1G2CA 1WT6A 3B5NC 3H1ID 2M3EA 1DEEG 1GZLA 4DJGA 3HD7C 2B87B 2HPCB 1BE3G 3L72J 1G1JA 5KAIE 2UWJE 2ZT9B 4BRYA 1HJBA 1AVOA 1GDTA 1T3JA 1X0TA 5APVA 1S5LE 3G6EP 1SQVK 2Q3EA 2FXOA 1SFCA 2FYUE 2IX7C 3AEDC 1AFOA 2P1JA 1NTKD 1HF9A 1W5CE 5CJ0A 1U57A 3P7KA 2WQYC 3QWOC 4UB6H 2NZ2A 4L74A 3L37A 1LTJB 2W6AA 2N9BA 3KHUA 4PJ0H 1JY2N 3JSVC 5CMZA 1LWUA 1R5SA 1ZN5A 1SQQK 1L4AB 2XV5A 3P8CE 5AVVB 3RK2B 5BU5A 3PH0A 5AVWB 1J1EB 3HD7B 4R4MA 5KLIB 1HH0A 1U7MA 1Q90D 2R32A 3HE4A 1HVVA 3R4YA 4GIFA 4WVZA 2FFDA 2YXQB 3L75G 5AW7B 3W67A 4PJ0E 3CCEP 1NO4A 1H8AA 1SQXJ 3KYQA 1FZEA 5APQA 1WMKA 1BE3E 1RQVA 1JOCA 1JB0J 1NTZD 2E5TA 3AEBC 2JKVA 3CI9A 2H7HA 2YO2A 5E79E 1Q86Q 1IFNA 2M0BA 3V2PA 1PP9E 2BEZF 2FKWB 2QJYC 3KQGA 5B66H 2OYIB 3HTKB 3L70D 4L73A 4ZMDA 1UIXA 2FYUJ 1KB9I 3L72E 1JY3O 2P67A 5CCGC 1GL2B 3AE3C 4BXLA 4M3LA 1SQPD 3B5NA 3BCCE 1KILA 1OVVA 3FWNA 4EIJA 1VQ5P 2PAJA 4TLFA 5AVSB 1AVYA 3VOPA 4AYCA 3U59A 4WWIA 1OZHA 1T3UA 2FY8A 4H44C 1QLED 4HJGH 3FXDA 1YJ9P 3LIEA 1BGYJ 3AE1C 2ZXXA 3H1LG 5EFWB 1R5LA 1FOSE 1UIIA 1VPCA 1S4XA 4OH8B 5AVUB 1RE4C 5AVTB 2QJPC 4C7NA 4WY4A 1YI2P 3CCVP 2WSFH 1FZCC 1X9VA 2N1TD 2W8ZA 3R2PA 4PD4D 1FC2C 1X79B 3H1JG 3NTNA 2L5GB 4ASVA 1FBMA 1TU3F 2V4HA 2ZVNB 3A2AA 3BRVB 1EXIA 5KLVK 1YYCA 2OGUA 2AXTE 2FFDB 2IBZE 1P84H 2P58A 1NTKK 1T6AA 2W6JH 1CW5A 1KFMA 1URQB 1YHQP 5AVQB 2CPBA 2CPSA 3H1IJ 1N7SC 2N1TB 4I7ZB 1VQLP 1IJDB 1RQUA 2SPZA 1DD4A 2QJKB 1BCCJ 1NTMK 3C9IA 1ZP0C 2RN0A 2NPSD 1VQ7P 1L0LE 1NAYA 1SQPJ 2XDJA 3MHVA 3FGAD 2C0WA 1IFMA 2IYOA 1KILD 3H1KG 1S3JA 3UIAA 4L76A 2I1KA 1NKNA 3L70J 3C8VA 2PP6A 2LR2A 3EQ2A 1NTZK 3H1JE 4IFFA 5TISH 3MP7B 3L73D 1KB9D 2ZYGA 2GM4A 3TF5A 1SQPG 3HUSC 1LTIC 2O01H 4YTPC 2HYNA 3RL0D 2WSEH 4EOTA 3CLQA 5AVXB 4YXDC 4WY4C 1YJWP 1EZVE 2YMKA 5GTHH 1GW3A 3AEFC 1M1JB 3TNUA 1NTZE 3B4SA 3E1IA 1PP9G 3VMZA 4WBAA 4Y99C 4C7RA 2N9YB 1YQ4C 2NPSC 5KAFH 1K73Q 4LGDE 1NWQA 2KNCB 2XNXA 1OW8A 3MUDC 2R5DA 4TT3H 5H2FH 3CC4P 1SQXE 3PRJA 2H43A 1MUUA 3AE7C 1P84E 4IL6X 3LIDA 3D6YA 1M57D 2E74B 1N7LA 2ZYAA 1CI6B 1J2JB 2A45I 1LTGC 2FYNC 2KUBA 3QH9A 4OWFA 3IF4A 1OXZA 3L75D 1PGOA 3TK1A 3H1IE 1ZLLA 4PV1C 1FZBA 1KFNA 1S1CX 2K9JB 3OJAB 4U3FG 3VMXA 1YQ3C 4Y28J 2GUVA 1FE6A 3L71J 5APYA 4JF7A 1SP4A 3L74J 1A02F 1FDMA 2E75B 2OYIC 3Q5PA 5H2FE 1NTKE 2IPPA 4AQRD 4L75A 1XTGB 1VF5C 1KQFB 3M9QA 3MUDA 4IFMA 1ZW0A 3CX5H 3WUUA 4ZNCA 3G4SP 3Q3DA 1LJ2A 2OTLP 2BCCG 2K37A 3VMYA 1FZCB 1JY3P 2R3CA 3L73J 3SWKA 2WSFJ 3AE5C 3USSA 1VQKP 1RF0A 1KQSO 3M0DA 1FU1A 2QM8A 1IK7A 2FXMA 2K9JA 2R3SA 1EDJA 1QX8A 1PPJE 2YNYA 3L73G 4GODA 1DEBA 1GK6A 3BVHA 3CD6P 2WPQA 3HRNA 5BU8B 1FZGA 2WPVB 2KP8A 2AXCA 1DD3A 1PV3A 2YXRB 4I1LA 5AW9B 4D6TJ 1OWAA 4CPGA 5K5GB 4UB8H 2M8RA 1N7SA 2Y0DA 2WSSH 2HODA 2O01J 2JWAA 2P2UA 4R4LA 1L2PA 3TSIA 5AW4B 3II6A 2MJZA 1RHZB 1EQ7A 1SQBJ 1HGZA 3H6PA 2KLUA 1YITP 1NH4A 3E1RA 3E7KA 4ZKPA 5KJ7C 1KTMA 2KYVA 1LP1A 2KXPB 4N6JA 1M1JC 2RMZA 4D6TG 3K5BA 1GL2C 3IN6A 2D2CB 2G8YA 1PFIA 2WSCH 2AEFA 3CX5I 1JTHA 1SQPK 1X8YA 3KPEA 4JPZB 3VTPC 4WB4A 3RBXA 1LGHB 4K35A 5CCHD 2C0XA 1BGYD 1SQBG 1RF1C 2O01N 2O1KA 2QJKC 1KYOD 2Y0EA 2A06E 5M1BA 4C46A 3G3ZA 3JC22 1SQXK 1Y9BA 4DOJA 4GDOA 4JYCA 1PIXA 3P32A 1FDIA 3H1HE 2KIKA 4OGQB 1T2KD 4XFJA 3KXDA 2FYUK 5KJ7D 3H1LD 1S9KD 1NAFA 1FDOA 1KQGB 2Q3IA 4ASWA 1ZRTE 4DT0A 1GK4A 3KZIE 5AVRB 2A45H 3GMAA 2WWWA 1M56D 2P7JA 1JTHB 3CX5D 4I6MC 1R8EA 1ZMEC 2YIUB 2KLVA 1H88A 1AQTA 1Q2NA 1SQQD 2E76B 5TISE 3MIWA 5B5EE 3AEEC 3N7NA 4EYYQ 1IC2A 1K05A 2WT7B 1SFCD 2BASA 1AA0A 4H0LC 3RK3E 3VYIA 2WITA 3CXHD 2B9BA 3WU2H 1SQBE 1SQBK 2JDIH 2YKQA 3SWYA 1NTME 2Q7CA 2B88A 4KJMA 1KQLA 1NTZG 4W7YA 3WUTA 1LT1A 3AE6C 5CCGD 3H1JD 4I2LC 2AEMA 4N3YB 3SFEC 3VMAA 1SQVD 1KB9E 3B5ND 1M8OB 3L71D 3V2NA 3WUVA 3TYYA 1PPJD 4BRYB 4Z1MH 5GTHE 5KAIH 2OYHA 3S9OA 4PV1B 1GU5A 1YTZT 4O9BA 3LW5H 1BDDA 2LKMA 1LT9B 3Q2YA 3AE4C 4H0LD 5KLVG 1LTJA 4H44B 3WU2E 1SLQA 3MD0A 1LWUB 1JMBA 2HR3A 3RK3B 4RKUJ 2JR8A 1DH3A 1SFCC 3L4FA 2CK3H 2KSEA 1ZOYC 1PGPA 3L35A 2PGDA 3H1KE 3A0HH 1PP9D 1U7JA 5CHXA 1NTKG 3T97A 1NHLA 1LTAC 2XNDH 2HPCA 2E75D 3M0DC 2BCCD 4NPDA 4W80A 2Z4EA 4RESB 2IFNA 2QJYB 1NTMG 2E43A 1URQD 3VP8A 1IZNB 1GW4A 1L0LJ 1SQPE 3L74E 2IZ1A 1KV4A 1VQ4P 1PGQA 1OVUA 1SVFA 2JP3A 3PTZA 4B86A 2QRXA 3VN0A 2O3JA 2W83C 3CWBD 3O6QA 2WPRA 2YIUC 5APXA 2H89C 2XU6A 3GHGB 2E76C 3H1HG 5AVZB 1H0TB 2D2CD 3TGUD 2BEQD 5KLVE 2P10A 4XA4A 1JUNA 4NPFX 1VQ6P 3V6IA 4PD4E 1XTCC 3EWKA 2C9LY 2QA4P 3A0HE 2QE7H 1FOSF 1JMMA 4HB1A 1BE3J 1HTLC 1LT9A 1YBKA 3L72G 2A45G 3D71A 1URQC 1QEXA 2QSIA 3L75J 4KHXA 2OYOA 1IFPA 4OGQC 1W2BO 1GD2E 3RGUA 1HGVA 2NPSA 4H13B 3V2RA 1M90Q 3O6QB 4JYBA 2GA1A 5GTIE 3AE2C 1ZR4A 3CMAP 2HFED 4YXWH 2JO1A 5KLVJ 2E76D 2KS1A 3B8EB 2M3BA 1BE3D 1K9MQ 3RK3D 1NU1E 3FWLA 4LLHA 1N7SB 2N1TC 2RH0A 2HODB 2B89A 2E74D 2J59M 3CPWO 3Q1MA 1KB9H 3V5BA 3GG2A 1M1KQ 2IYPA 5KKZC 2K9YA 1AV1A 3L70E 4XE5B 5CJ4A 1JY2P 1SQVE 1VQPP 3CCJP 1EZVG 4GKGA 1S72P 1HWTC 5APSA 3L72D 1OMIA 4OGQD 4PD4H 4U7JA 2DW3A 2PFXA 2W90A 4IL6E 3CWBJ 1AJYA 1KORA 1G2CB 3A0BE 2HG5D 3IAOA 3L73E 1NGMB 1YJNP 1RF1A 1BGYG 1SQXG 2B87A 1X22A 3H1LJ 3GHGA 3RK2D 3FXEA 3CCRP 3AEAC 2KS1B 1KD1Q 3CC7P 1QVFO 1L0ND 3RK3C 1KYOE 3ITKA 1IFJA 3HUSB 5CBNA 2KB7P 2W27A 5GTIH 1J1DB 1VQNP 2WMMA 3CWBG 1PGJA 2Z5HA 2ZFCA 1ZV8A 2GUSA 5CCHA 4QMAA 5APTA 1LT9C 3BCCD 3S4RA 2E74C 2FYUG 1NU1G 4Y99B 1Y47A 3D6ZA 1NOHA 3U1CA 1S9KE 3Q5SA 1KYOH 2ZT9D 3BRTB 1HJ0A 1ZRTD 4ZKUA 1HBWA 2I8DA 1FJPA 3RL0C 2FYZA 1FZCA 2Q9IA 4U3FE 3KDPB 1RF0C 2OTKE 3RK2C 1BSNA 3ABVC 3FX0A 1RE3C 3NFQA 1EXJA 1E5WA 1NU1J 4K3AA 1JCCA 2V7QJ 1IK9A 1BCCG 1L4AC 2IFMA 2WPSA 3L36A 2Y9YA 2H88C 3ZDMA 5KLVD 1IFIA 1NVOA 3H1JJ 2Y9ZA 1RE3A 3L70G 2ZT9C 1L0LK 4EDFA 1N86A 2OQQA 3HTKA 1KILE 5KLIC 3RBZA 3M91A 1RF1B 4PV1D 5AVYB 2LXCB 2FYNB 5BVZA 1E79H 1IFDA 2KNCA 1L0NJ 3MTUE 3H1IG 1EZVI 1QL2A 1J1EC 2MKVA 1FS0E 3MGNA 4H44D 3SFDC 1MFTA 1L4AD 2Q5UA 2KK7A 2OTJP 3CCUP 5CCHC 1L4AA 1PP9J 3B71A 1QL1A 1EDIA 1KC8Q 2C9NY 1HUCA 1VF5D 1JY2O 1MKMA 4GOFA 4OVNF 3I56P 1L0NG 2L91A 1PPJG 3OAKA 4U3FJ 1FZAA 2R5BA 1ZXGA 3CL3D 2QG4A 1SQVG 3M0AA 1KZUB 1RH5B 1SQXD 3GHGC 3H1KJ 4A7PA 1K8AQ 2OYHC 1OIPA 1P84D 1JM0A 2BCCE 2VRSA 1GMJA 1JEKA 1MFZA 1OX3A 2YKOA 2ZYDA 1LWUC 4IL6H 4D6TE 5B66E 2HLOA 2YO3A 3F89A 3PHLA 4N78D 2W6BA 3L74D 1EZVD 1USDA 2IDBA
chains in the Genus database with same CATH topology
4NPDA 1BDCA 2KUBA 5CBOA 1OVUA 2QRXA 5C39A 1DEEG 2M5AB 2B87B 1H0TB 1LP1B 2UWJE 4ZNCA 2KZIA 1X0TA 1ZW0A 2QVAA 4NPFX 5DJTB 2KZJA 3QWOC 4HB1A 1SS1A 3RGUA 3PH0A 1U7MA 4GODA 2B89A 5K5GB 4CPGA 2M0BA 4IOIH 4ZMDA 2B87A 4NPEA 4BXLA 1EDLA 3FXEA 3S1KA 5CBNA 2KS1B 1LP1A 1OVVA 2LXBA 2WMMA 3MZWB 4WWIA 4K35A 4HJGH 3FXDA 5EFWB 1Y47A 1EDKA 2RKLA 2I8DA 2KIKA 2OTKE 1FC2C 4ASVA 4ASWA 4K3AA 4GOEA 2P58A 4HKZH 2JWDA 3ZDMA 2M5AA 1Q2NA 1NVOA 4JBZA 4EYYQ 2SPZA 1EDJA 2R44A 1OVRA 2LXCB 2B88A 4KJMA 1LT1A 3MHVA 1H0TA 2Q1KA 1EC5A 2ZAEB 1S3JA 1MFTA 2K3RA 4MN4C 2LR2A 1EDIA 4GOFA 2KI7B 1BDDA 1ZXGA 1JM0A 1JMBA 2HR3A 5DJUB 1U7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPD A;  1BDC A;  2KUB A;  5CBO A;  1OVU A;  2QRX A;  5C39 A;  1DEE G;  2M5A B;  2B87 B;  1H0T B;  1LP1 B;  2UWJ E;  4ZNC A;  2KZI A;  1X0T A;  1ZW0 A;  2QVA A;  4NPF X;  5DJT B;  2KZJ A;  3QWO C;  4HB1 A;  1SS1 A;  3RGU A;  3PH0 A;  1U7M A;  4GOD A;  2B89 A;  5K5G B;  4CPG A;  2M0B A;  4IOI H;  4ZMD A;  2B87 A;  4NPE A;  4BXL A;  1EDL A;  3FXE A;  3S1K A;  5CBN A;  2KS1 B;  1LP1 A;  1OVV A;  2LXB A;  2WMM A;  3MZW B;  4WWI A;  4K35 A;  4HJG H;  3FXD A;  5EFW B;  1Y47 A;  1EDK A;  2RKL A;  2I8D A;  2KIK A;  2OTK E;  1FC2 C;  4ASV A;  4ASW A;  4K3A A;  4GOE A;  2P58 A;  4HKZ H;  2JWD A;  3ZDM A;  2M5A A;  1Q2N A;  1NVO A;  4JBZ A;  4EYY Q;  2SPZ A;  1EDJ A;  2R44 A;  1OVR A;  2LXC B;  2B88 A;  4KJM A;  1LT1 A;  3MHV A;  1H0T A;  2Q1K A;  1EC5 A;  2ZAE B;  1S3J A;  1MFT A;  2K3R A;  4MN4 C;  2LR2 A;  1EDI A;  4GOF A;  2KI7 B;  1BDD A;  1ZXG A;  1JM0 A;  1JMB A;  2HR3 A;  5DJU B;  1U7J A; 
#chains in the Genus database with same CATH topology
 1SQV J;  3H25 A;  5KAF E;  1MV8 A;  1Y8A A;  5CBO A;  2N1T A;  3AEC C;  1AQ5 A;  4HH2 A;  2YMY A;  1Q7Y Q;  3AEG C;  3HUS A;  4H13 D;  2KSJ A;  5C39 A;  1S5L H;  3V2Q A;  3CCS P;  4BWN A;  3BAT A;  2WZ7 A;  2IBZ D;  1M1J A;  1KN7 A;  3KZI H;  2A06 D;  2M5A B;  2PRR A;  3H32 A;  4I7Z C;  3SSU A;  2QEX P;  3TGU J;  1LP1 B;  2ITA A;  2V7Q H;  3M9H A;  2E42 A;  3AE9 C;  2KZI A;  3CC2 P;  1VQO P;  1K04 A;  1N2D C;  2POH A;  2QVA A;  3EFG A;  5DJT B;  4C7N B;  1S2E A;  3L71 G;  4U3F D;  1N73 C;  2KZJ A;  3L74 G;  3U1A A;  5TJH A;  1BCC E;  4DZO A;  4KT0 J;  3V4Q A;  3TGU G;  1CZQ A;  1SS1 A;  1L0L D;  3P8M C;  5AW1 B;  3W68 A;  1CSB A;  3CXH I;  3GLM A;  2O1J A;  2FBW C;  3N4X A;  5AW5 B;  2BCC J;  1URQ A;  3VP9 A;  1SQQ E;  4H13 C;  3G9R A;  3TDK A;  3BAS A;  1QGK B;  2A06 G;  3C1L A;  2Z5I A;  2JEE A;  2KOG A;  2E75 C;  1W2E A;  1CI6 A;  3P8C D;  1ZR2 A;  1NTM D;  5L8R J;  1FJK A;  1YTZ I;  1JCD A;  1Z56 A;  2QJP B;  2QM7 A;  5APU A;  1PL5 A;  3GF7 A;  1VQ9 P;  1DX7 A;  1N7S D;  2XKM A;  3IR9 A;  2JJL A;  2YKP A;  4PD4 I;  3T97 B;  2WSE J;  3M06 A;  2IZ0 A;  1T8Z A;  3CCQ P;  1JNM A;  4IOI H;  2WTY A;  1KMI Z;  4RJT A;  3D70 A;  2AXT H;  2Y0C A;  1A02 J;  5AW6 B;  3O8Z A;  1LNQ A;  1DIP A;  3H32 B;  4NPE A;  1EDL A;  3S1K A;  1KYO I;  1NJI Q;  2OYI A;  1LTB C;  1NU1 K;  1KIL C;  1VQM P;  2XZR A;  4IFD K;  3NXS A;  2LXB A;  5CCG A;  1GTW A;  1L0N K;  2OYH B;  3MZW B;  3GF3 A;  4WY4 B;  3CME P;  1G1I A;  3AE8 C;  1LTS C;  2WSC J;  3BCC J;  4N78 E;  3OW2 O;  1QVG O;  3L71 E;  2AEJ A;  3CXH H;  4YPC A;  1SQQ J;  4DCK A;  1YIJ P;  2WT7 A;  1JY3 N;  1VL2 A;  4WY4 D;  1EDK A;  1M7L A;  1MZ9 A;  2RKL A;  1BGY E;  2ZXE B;  1SFC B;  1LTJ C;  5AW2 B;  5KKZ B;  1FZF A;  2Q6Q A;  1VQ8 P;  3CCL P;  3CX5 E;  2FYU D;  3HE5 A;  5KTB A;  1OFC X;  3BCC G;  3PJS K;  2FFD C;  5B5E H;  1IO4 A;  1SQQ G;  3A0B H;  2QIW A;  3LW5 J;  3PP5 A;  3CWB E;  4GOE A;  1N8R Q;  4HKZ H;  1NYH A;  2E5Y A;  2JWD A;  3GW6 A;  3H1L E;  3V4W A;  3I55 P;  2M5A A;  1NTZ J;  5E79 H;  3A5T A;  3CXH E;  3HD7 A;  4RO0 A;  1N73 B;  3M9B A;  1NKZ B;  3HE4 B;  4JBZ A;  2G3A A;  3SWF A;  3G71 P;  1OW6 A;  3A7O A;  1Q82 Q;  2NRG A;  1VF5 B;  2I1J A;  2R44 A;  1BCC D;  1OVR A;  3OA7 A;  1GL2 D;  2K1A A;  3HE5 B;  3WMM 0;  1H0T A;  2Q1K A;  1EC5 A;  2H8P D;  2IBZ G;  2ZAE B;  3A3Y B;  1WRG A;  2WVR A;  2K3R A;  4MN4 C;  3RL0 B;  1D7M A;  1SQB D;  2IBZ I;  2J5U A;  3PLN A;  2D2C C;  1LTT C;  4W7Z A;  3NMD A;  4EI2 A;  1S5L X;  1NU1 D;  1NTK J;  2ZVO B;  2KI7 B;  1GL2 A;  4D6T D;  1GU4 A;  3B5N B;  1J1D C;  1KIL B;  3H1K D;  3Q5R A;  3JCU E;  4HYT B;  4GT1 A;  3IFM A;  1NTM J;  2OAR A;  3I5C A;  2NPS B;  4LC1 A;  1T2K C;  1L0L G;  1RY3 A;  3HD7 D;  5DJU B;  2ZJS E;  4JQ0 D;  3CCM P;  1PZQ A;  5APW A;  5AW8 B;  1FAV A;  1RE4 A;  5AW3 B;  3RL0 g;  3TNU B;  1P84 I;  1BDC A;  1BSH A;  1Q81 Q;  1VDF A;  2J58 A;  3H1H D;  3EFF K;  1L0N E;  3F5H A;  3H1H J;  1OW7 A;  1N73 A;  4AUW A;  1H89 A;  2FXP A;  5KJ7 A;  4UB6 E;  3JCU H;  4UB8 E;  3TGU E;  1JO5 A;  5AW0 B;  1USE A;  2K88 A;  3L75 E;  4H0L B;  1G2C A;  1WT6 A;  3B5N C;  3H1I D;  2M3E A;  1DEE G;  1GZL A;  4DJG A;  3HD7 C;  2B87 B;  2HPC B;  1BE3 G;  3L72 J;  1G1J A;  5KAI E;  2UWJ E;  2ZT9 B;  4BRY A;  1HJB A;  1AVO A;  1GDT A;  1T3J A;  1X0T A;  5APV A;  1S5L E;  3G6E P;  1SQV K;  2Q3E A;  2FXO A;  1SFC A;  2FYU E;  2IX7 C;  3AED C;  1AFO A;  2P1J A;  1NTK D;  1HF9 A;  1W5C E;  5CJ0 A;  1U57 A;  3P7K A;  2WQY C;  3QWO C;  4UB6 H;  2NZ2 A;  4L74 A;  3L37 A;  1LTJ B;  2W6A A;  2N9B A;  3KHU A;  4PJ0 H;  1JY2 N;  3JSV C;  5CMZ A;  1LWU A;  1R5S A;  1ZN5 A;  1SQQ K;  1L4A B;  2XV5 A;  3P8C E;  5AVV B;  3RK2 B;  5BU5 A;  3PH0 A;  5AVW B;  1J1E B;  3HD7 B;  4R4M A;  5KLI B;  1HH0 A;  1U7M A;  1Q90 D;  2R32 A;  3HE4 A;  1HVV A;  3R4Y A;  4GIF A;  4WVZ A;  2FFD A;  2YXQ B;  3L75 G;  5AW7 B;  3W67 A;  4PJ0 E;  3CCE P;  1NO4 A;  1H8A A;  1SQX J;  3KYQ A;  1FZE A;  5APQ A;  1WMK A;  1BE3 E;  1RQV A;  1JOC A;  1JB0 J;  1NTZ D;  2E5T A;  3AEB C;  2JKV A;  3CI9 A;  2H7H A;  2YO2 A;  5E79 E;  1Q86 Q;  1IFN A;  2M0B A;  3V2P A;  1PP9 E;  2BEZ F;  2FKW B;  2QJY C;  3KQG A;  5B66 H;  2OYI B;  3HTK B;  3L70 D;  4L73 A;  4ZMD A;  1UIX A;  2FYU J;  1KB9 I;  3L72 E;  1JY3 O;  2P67 A;  5CCG C;  1GL2 B;  3AE3 C;  4BXL A;  4M3L A;  1SQP D;  3B5N A;  3BCC E;  1KIL A;  1OVV A;  3FWN A;  4EIJ A;  1VQ5 P;  2PAJ A;  4TLF A;  5AVS B;  1AVY A;  3VOP A;  4AYC A;  3U59 A;  4WWI A;  1OZH A;  1T3U A;  2FY8 A;  4H44 C;  1QLE D;  4HJG H;  3FXD A;  1YJ9 P;  3LIE A;  1BGY J;  3AE1 C;  2ZXX A;  3H1L G;  5EFW B;  1R5L A;  1FOS E;  1UII A;  1VPC A;  1S4X A;  4OH8 B;  5AVU B;  1RE4 C;  5AVT B;  2QJP C;  4C7N A;  4WY4 A;  1YI2 P;  3CCV P;  2WSF H;  1FZC C;  1X9V A;  2N1T D;  2W8Z A;  3R2P A;  4PD4 D;  1FC2 C;  1X79 B;  3H1J G;  3NTN A;  2L5G B;  4ASV A;  1FBM A;  1TU3 F;  2V4H A;  2ZVN B;  3A2A A;  3BRV B;  1EXI A;  5KLV K;  1YYC A;  2OGU A;  2AXT E;  2FFD B;  2IBZ E;  1P84 H;  2P58 A;  1NTK K;  1T6A A;  2W6J H;  1CW5 A;  1KFM A;  1URQ B;  1YHQ P;  5AVQ B;  2CPB A;  2CPS A;  3H1I J;  1N7S C;  2N1T B;  4I7Z B;  1VQL P;  1IJD B;  1RQU A;  2SPZ A;  1DD4 A;  2QJK B;  1BCC J;  1NTM K;  3C9I A;  1ZP0 C;  2RN0 A;  2NPS D;  1VQ7 P;  1L0L E;  1NAY A;  1SQP J;  2XDJ A;  3MHV A;  3FGA D;  2C0W A;  1IFM A;  2IYO A;  1KIL D;  3H1K G;  1S3J A;  3UIA A;  4L76 A;  2I1K A;  1NKN A;  3L70 J;  3C8V A;  2PP6 A;  2LR2 A;  3EQ2 A;  1NTZ K;  3H1J E;  4IFF A;  5TIS H;  3MP7 B;  3L73 D;  1KB9 D;  2ZYG A;  2GM4 A;  3TF5 A;  1SQP G;  3HUS C;  1LTI C;  2O01 H;  4YTP C;  2HYN A;  3RL0 D;  2WSE H;  4EOT A;  3CLQ A;  5AVX B;  4YXD C;  4WY4 C;  1YJW P;  1EZV E;  2YMK A;  5GTH H;  1GW3 A;  3AEF C;  1M1J B;  3TNU A;  1NTZ E;  3B4S A;  3E1I A;  1PP9 G;  3VMZ A;  4WBA A;  4Y99 C;  4C7R A;  2N9Y B;  1YQ4 C;  2NPS C;  5KAF H;  1K73 Q;  4LGD E;  1NWQ A;  2KNC B;  2XNX A;  1OW8 A;  3MUD C;  2R5D A;  4TT3 H;  5H2F H;  3CC4 P;  1SQX E;  3PRJ A;  2H43 A;  1MUU A;  3AE7 C;  1P84 E;  4IL6 X;  3LID A;  3D6Y A;  1M57 D;  2E74 B;  1N7L A;  2ZYA A;  1CI6 B;  1J2J B;  2A45 I;  1LTG C;  2FYN C;  2KUB A;  3QH9 A;  4OWF A;  3IF4 A;  1OXZ A;  3L75 D;  1PGO A;  3TK1 A;  3H1I E;  1ZLL A;  4PV1 C;  1FZB A;  1KFN A;  1S1C X;  2K9J B;  3OJA B;  4U3F G;  3VMX A;  1YQ3 C;  4Y28 J;  2GUV A;  1FE6 A;  3L71 J;  5APY A;  4JF7 A;  1SP4 A;  3L74 J;  1A02 F;  1FDM A;  2E75 B;  2OYI C;  3Q5P A;  5H2F E;  1NTK E;  2IPP A;  4AQR D;  4L75 A;  1XTG B;  1VF5 C;  1KQF B;  3M9Q A;  3MUD A;  4IFM A;  1ZW0 A;  3CX5 H;  3WUU A;  4ZNC A;  3G4S P;  3Q3D A;  1LJ2 A;  2OTL P;  2BCC G;  2K37 A;  3VMY A;  1FZC B;  1JY3 P;  2R3C A;  3L73 J;  3SWK A;  2WSF J;  3AE5 C;  3USS A;  1VQK P;  1RF0 A;  1KQS O;  3M0D A;  1FU1 A;  2QM8 A;  1IK7 A;  2FXM A;  2K9J A;  2R3S A;  1EDJ A;  1QX8 A;  1PPJ E;  2YNY A;  3L73 G;  4GOD A;  1DEB A;  1GK6 A;  3BVH A;  3CD6 P;  2WPQ A;  3HRN A;  5BU8 B;  1FZG A;  2WPV B;  2KP8 A;  2AXC A;  1DD3 A;  1PV3 A;  2YXR B;  4I1L A;  5AW9 B;  4D6T J;  1OWA A;  4CPG A;  5K5G B;  4UB8 H;  2M8R A;  1N7S A;  2Y0D A;  2WSS H;  2HOD A;  2O01 J;  2JWA A;  2P2U A;  4R4L A;  1L2P A;  3TSI A;  5AW4 B;  3II6 A;  2MJZ A;  1RHZ B;  1EQ7 A;  1SQB J;  1HGZ A;  3H6P A;  2KLU A;  1YIT P;  1NH4 A;  3E1R A;  3E7K A;  4ZKP A;  5KJ7 C;  1KTM A;  2KYV A;  1LP1 A;  2KXP B;  4N6J A;  1M1J C;  2RMZ A;  4D6T G;  3K5B A;  1GL2 C;  3IN6 A;  2D2C B;  2G8Y A;  1PFI A;  2WSC H;  2AEF A;  3CX5 I;  1JTH A;  1SQP K;  1X8Y A;  3KPE A;  4JPZ B;  3VTP C;  4WB4 A;  3RBX A;  1LGH B;  4K35 A;  5CCH D;  2C0X A;  1BGY D;  1SQB G;  1RF1 C;  2O01 N;  2O1K A;  2QJK C;  1KYO D;  2Y0E A;  2A06 E;  5M1B A;  4C46 A;  3G3Z A;  3JC2 2;  1SQX K;  1Y9B A;  4DOJ A;  4GDO A;  4JYC A;  1PIX A;  3P32 A;  1FDI A;  3H1H E;  2KIK A;  4OGQ B;  1T2K D;  4XFJ A;  3KXD A;  2FYU K;  5KJ7 D;  3H1L D;  1S9K D;  1NAF A;  1FDO A;  1KQG B;  2Q3I A;  4ASW A;  1ZRT E;  4DT0 A;  1GK4 A;  3KZI E;  5AVR B;  2A45 H;  3GMA A;  2WWW A;  1M56 D;  2P7J A;  1JTH B;  3CX5 D;  4I6M C;  1R8E A;  1ZME C;  2YIU B;  2KLV A;  1H88 A;  1AQT A;  1Q2N A;  1SQQ D;  2E76 B;  5TIS E;  3MIW A;  5B5E E;  3AEE C;  3N7N A;  4EYY Q;  1IC2 A;  1K05 A;  2WT7 B;  1SFC D;  2BAS A;  1AA0 A;  4H0L C;  3RK3 E;  3VYI A;  2WIT A;  3CXH D;  2B9B A;  3WU2 H;  1SQB E;  1SQB K;  2JDI H;  2YKQ A;  3SWY A;  1NTM E;  2Q7C A;  2B88 A;  4KJM A;  1KQL A;  1NTZ G;  4W7Y A;  3WUT A;  1LT1 A;  3AE6 C;  5CCG D;  3H1J D;  4I2L C;  2AEM A;  4N3Y B;  3SFE C;  3VMA A;  1SQV D;  1KB9 E;  3B5N D;  1M8O B;  3L71 D;  3V2N A;  3WUV A;  3TYY A;  1PPJ D;  4BRY B;  4Z1M H;  5GTH E;  5KAI H;  2OYH A;  3S9O A;  4PV1 B;  1GU5 A;  1YTZ T;  4O9B A;  3LW5 H;  1BDD A;  2LKM A;  1LT9 B;  3Q2Y A;  3AE4 C;  4H0L D;  5KLV G;  1LTJ A;  4H44 B;  3WU2 E;  1SLQ A;  3MD0 A;  1LWU B;  1JMB A;  2HR3 A;  3RK3 B;  4RKU J;  2JR8 A;  1DH3 A;  1SFC C;  3L4F A;  2CK3 H;  2KSE A;  1ZOY C;  1PGP A;  3L35 A;  2PGD A;  3H1K E;  3A0H H;  1PP9 D;  1U7J A;  5CHX A;  1NTK G;  3T97 A;  1NHL A;  1LTA C;  2XND H;  2HPC A;  2E75 D;  3M0D C;  2BCC D;  4NPD A;  4W80 A;  2Z4E A;  4RES B;  2IFN A;  2QJY B;  1NTM G;  2E43 A;  1URQ D;  3VP8 A;  1IZN B;  1GW4 A;  1L0L J;  1SQP E;  3L74 E;  2IZ1 A;  1KV4 A;  1VQ4 P;  1PGQ A;  1OVU A;  1SVF A;  2JP3 A;  3PTZ A;  4B86 A;  2QRX A;  3VN0 A;  2O3J A;  2W83 C;  3CWB D;  3O6Q A;  2WPR A;  2YIU C;  5APX A;  2H89 C;  2XU6 A;  3GHG B;  2E76 C;  3H1H G;  5AVZ B;  1H0T B;  2D2C D;  3TGU D;  2BEQ D;  5KLV E;  2P10 A;  4XA4 A;  1JUN A;  4NPF X;  1VQ6 P;  3V6I A;  4PD4 E;  1XTC C;  3EWK A;  2C9L Y;  2QA4 P;  3A0H E;  2QE7 H;  1FOS F;  1JMM A;  4HB1 A;  1BE3 J;  1HTL C;  1LT9 A;  1YBK A;  3L72 G;  2A45 G;  3D71 A;  1URQ C;  1QEX A;  2QSI A;  3L75 J;  4KHX A;  2OYO A;  1IFP A;  4OGQ C;  1W2B O;  1GD2 E;  3RGU A;  1HGV A;  2NPS A;  4H13 B;  3V2R A;  1M90 Q;  3O6Q B;  4JYB A;  2GA1 A;  5GTI E;  3AE2 C;  1ZR4 A;  3CMA P;  2HFE D;  4YXW H;  2JO1 A;  5KLV J;  2E76 D;  2KS1 A;  3B8E B;  2M3B A;  1BE3 D;  1K9M Q;  3RK3 D;  1NU1 E;  3FWL A;  4LLH A;  1N7S B;  2N1T C;  2RH0 A;  2HOD B;  2B89 A;  2E74 D;  2J59 M;  3CPW O;  3Q1M A;  1KB9 H;  3V5B A;  3GG2 A;  1M1K Q;  2IYP A;  5KKZ C;  2K9Y A;  1AV1 A;  3L70 E;  4XE5 B;  5CJ4 A;  1JY2 P;  1SQV E;  1VQP P;  3CCJ P;  1EZV G;  4GKG A;  1S72 P;  1HWT C;  5APS A;  3L72 D;  1OMI A;  4OGQ D;  4PD4 H;  4U7J A;  2DW3 A;  2PFX A;  2W90 A;  4IL6 E;  3CWB J;  1AJY A;  1KOR A;  1G2C B;  3A0B E;  2HG5 D;  3IAO A;  3L73 E;  1NGM B;  1YJN P;  1RF1 A;  1BGY G;  1SQX G;  2B87 A;  1X22 A;  3H1L J;  3GHG A;  3RK2 D;  3FXE A;  3CCR P;  3AEA C;  2KS1 B;  1KD1 Q;  3CC7 P;  1QVF O;  1L0N D;  3RK3 C;  1KYO E;  3ITK A;  1IFJ A;  3HUS B;  5CBN A;  2KB7 P;  2W27 A;  5GTI H;  1J1D B;  1VQN P;  2WMM A;  3CWB G;  1PGJ A;  2Z5H A;  2ZFC A;  1ZV8 A;  2GUS A;  5CCH A;  4QMA A;  5APT A;  1LT9 C;  3BCC D;  3S4R A;  2E74 C;  2FYU G;  1NU1 G;  4Y99 B;  1Y47 A;  3D6Z A;  1NOH A;  3U1C A;  1S9K E;  3Q5S A;  1KYO H;  2ZT9 D;  3BRT B;  1HJ0 A;  1ZRT D;  4ZKU A;  1HBW A;  2I8D A;  1FJP A;  3RL0 C;  2FYZ A;  1FZC A;  2Q9I A;  4U3F E;  3KDP B;  1RF0 C;  2OTK E;  3RK2 C;  1BSN A;  3ABV C;  3FX0 A;  1RE3 C;  3NFQ A;  1EXJ A;  1E5W A;  1NU1 J;  4K3A A;  1JCC A;  2V7Q J;  1IK9 A;  1BCC G;  1L4A C;  2IFM A;  2WPS A;  3L36 A;  2Y9Y A;  2H88 C;  3ZDM A;  5KLV D;  1IFI A;  1NVO A;  3H1J J;  2Y9Z A;  1RE3 A;  3L70 G;  2ZT9 C;  1L0L K;  4EDF A;  1N86 A;  2OQQ A;  3HTK A;  1KIL E;  5KLI C;  3RBZ A;  3M91 A;  1RF1 B;  4PV1 D;  5AVY B;  2LXC B;  2FYN B;  5BVZ A;  1E79 H;  1IFD A;  2KNC A;  1L0N J;  3MTU E;  3H1I G;  1EZV I;  1QL2 A;  1J1E C;  2MKV A;  1FS0 E;  3MGN A;  4H44 D;  3SFD C;  1MFT A;  1L4A D;  2Q5U A;  2KK7 A;  2OTJ P;  3CCU P;  5CCH C;  1L4A A;  1PP9 J;  3B71 A;  1QL1 A;  1EDI A;  1KC8 Q;  2C9N Y;  1HUC A;  1VF5 D;  1JY2 O;  1MKM A;  4GOF A;  4OVN F;  3I56 P;  1L0N G;  2L91 A;  1PPJ G;  3OAK A;  4U3F J;  1FZA A;  2R5B A;  1ZXG A;  3CL3 D;  2QG4 A;  1SQV G;  3M0A A;  1KZU B;  1RH5 B;  1SQX D;  3GHG C;  3H1K J;  4A7P A;  1K8A Q;  2OYH C;  1OIP A;  1P84 D;  1JM0 A;  2BCC E;  2VRS A;  1GMJ A;  1JEK A;  1MFZ A;  1OX3 A;  2YKO A;  2ZYD A;  1LWU C;  4IL6 H;  4D6T E;  5B66 E;  2HLO A;  2YO3 A;  3F89 A;  3PHL A;  4N78 D;  2W6B A;  3L74 D;  1EZV D;  1USD A;  2IDB A; 
#chains in the Genus database with same CATH homology
 4NPD A;  1BDC A;  2KUB A;  5CBO A;  1OVU A;  2QRX A;  5C39 A;  1DEE G;  2M5A B;  2B87 B;  1H0T B;  1LP1 B;  2UWJ E;  4ZNC A;  2KZI A;  1X0T A;  1ZW0 A;  2QVA A;  4NPF X;  5DJT B;  2KZJ A;  3QWO C;  4HB1 A;  1SS1 A;  3RGU A;  3PH0 A;  1U7M A;  4GOD A;  2B89 A;  5K5G B;  4CPG A;  2M0B A;  4IOI H;  4ZMD A;  2B87 A;  4NPE A;  4BXL A;  1EDL A;  3FXE A;  3S1K A;  5CBN A;  2KS1 B;  1LP1 A;  1OVV A;  2LXB A;  2WMM A;  3MZW B;  4WWI A;  4K35 A;  4HJG H;  3FXD A;  5EFW B;  1Y47 A;  1EDK A;  2RKL A;  2I8D A;  2KIK A;  2OTK E;  1FC2 C;  4ASV A;  4ASW A;  4K3A A;  4GOE A;  2P58 A;  4HKZ H;  2JWD A;  3ZDM A;  2M5A A;  1Q2N A;  1NVO A;  4JBZ A;  4EYY Q;  2SPZ A;  1EDJ A;  2R44 A;  1OVR A;  2LXC B;  2B88 A;  4KJM A;  1LT1 A;  3MHV A;  1H0T A;  2Q1K A;  1EC5 A;  2ZAE B;  1S3J A;  1MFT A;  2K3R A;  4MN4 C;  2LR2 A;  1EDI A;  4GOF A;  2KI7 B;  1BDD A;  1ZXG A;  1JM0 A;  1JMB A;  2HR3 A;  5DJU B;  1U7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...