2RKLA

Crystal structure of s.cerevisiae vta1 c-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
GSTKDELTKIMDRASKIEQIQKLAKYAISALNYEDLPTAKDELTKALDLLNSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein VTA1
publication title Structural basis of vta1 function in the multivesicular body sorting pathway.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lipid transport
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18097 Vta1_C Vta1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2rklA00
1ZXGA 2KZIA 4ZMDA 2KZJA 1U7JA 4HB1A 2WMMA 2KIKA 4EYYQ 2KI7B 2JWDA 1X0TA 4ZNCA 4HJGH 4GODA 1FC2C 1JMBA 2KS1B 4IOIH 1BDDA 2R44A 2SPZA 4BXLA 5CBNA 1MFTA 2Q1KA 4NPFX 2LXBA 5K5GB 1OVVA 3MZWB 1Y47A 1U7MA 5DJTB 2QVAA 2RKLA 4HKZH 2LXCB 2B88A 5EFWB 5DJUB 2M0BA 2I8DA 2QRXA 4ASVA 4GOFA 3RGUA 2M5AB 4K3AA 2KUBA 4NPDA 1EDKA 4CPGA 3S1KA 1EDLA 1LT1A 1EDIA 1NVOA 3MHVA 2M5AA 3PH0A 1OVUA 2B87B 2OTKE 3FXDA 4K35A 2UWJE 2B87A 2P58A 1EDJA 2LR2A 4KJMA 2HR3A 4MN4C 2B89A 4WWIA 1SS1A 1EC5A 1JM0A 1OVRA 1LP1B 3ZDMA 2K3RA 3QWOC 1S3JA 1H0TB 5CBOA 4GOEA 2ZAEB 1LP1A 3FXEA 5C39A 1H0TA 1ZW0A 1Q2NA 1BDCA 4ASWA 4NPEA 4JBZA 1DEEG
chains in the Genus database with same CATH superfamily
1YQ3C 2RH0A 3EFGA 4KT0J 1J1DB 2P10A 1VQ4P 5APTA 5AVXB 2KZJA 1NJIQ 3AEAC 3RBZA 1X9VA 1IFPA 2QIWA 3L73J 2KS1B 2WTYA 2MJZA 3P8CE 3CX5I 5GTIH 2Q1KA 4OVNF 2KSEA 2PRRA 1S1CX 1L0LE 3CLQA 1U7MA 1NTMD 2OYHA 2WSSH 3PHLA 2YXRB 4EDFA 2NZ2A 1M1JB 2E5TA 2W6AA 1K73Q 1N7LA 1KC8Q 1X79B 1VQ6P 3RK2B 3N4XA 2HLOA 3R2PA 2A06D 3GF3A 3L74J 2FYUD 3IAOA 3ITKA 2OYIA 3L73G 3F89A 1JCDA 2HODA 3CX5D 1KILE 3NTNA 1L4AD 2AEFA 5CBOA 1AQ5A 1EXJA 4PV1B 3GHGA 1SQPD 1HBWA 1H0TA 2XKMA 1DH3A 1IFJA 1PFIA 4O9BA 5KLVJ 1GW4A 1OIPA 1T2KC 1QL2A 3CCSP 2FFDB 1KILB 1KQLA 4D6TJ 3CWBD 3L71J 1MZ9A 2KP8A 3BCCE 1EZVE 2R3CA 3TSIA 5CHXA 1GD2E 2K88A 3IR9A 3G6EP 3Q3DA 5E79E 3M06A 2G3AA 1JOCA 1MFTA 3MUDC 1IK7A 4L74A 1VQ5P 1N73B 1NTKJ 3HE5B 5DJTB 4JPZB 1MKMA 1J2JB 2BEZF 1BGYD 3KZIH 3HUSA 3L36A 1WT6A 3A0HH 3MHVA 3PH0A 1KB9H 3VP8A 3V4WA 2P58A 3HE5A 1T2KD 1S4XA 4WWIA 2V4HA 1BE3J 3B5ND 4L73A 4PJ0E 5AW3B 3GW6A 2K3RA 2YXQB 1S3JA 2ZFCA 4GOEA 1G2CB 3MIWA 1FDMA 1NGMB 2FYUE 2WPVB 1NTKG 1URQB 2N1TB 1ZR2A 1T3UA 1BDCA 3N7NA 1SQVG 4NPEA 3CX5E 2Q6QA 1NKNA 2W83C 3T97A 2C9NY 2FXPA 3L75J 1SQPE 2HG5D 1GTWA 1SLQA 3F5HA 3VYIA 3V2QA 1JEKA 1LWUC 1A02J 1L0LG 3H1LG 2JKVA 3AEGC 1GMJA 1FOSE 3HTKA 3CWBE 4U3FD 2YO3A 2Q3IA 5AVZB 1BSHA 1OWAA 3K5BA 1L2PA 5TJHA 3E1RA 1Y47A 1VF5D 1WRGA 4H44B 2RKLA 3LIDA 3HRNA 3M0DC 3C9IA 3VOPA 4ZKUA 3A5TA 1NTKK 1LTGC 1K04A 1SQQJ 5AVVB 1PGOA 1LTBC 1RF1A 1LTIC 2YMYA 4L76A 1BGYE 1P84I 5AW5B 4Y99B 3SFEC 5B5EH 1LT9C 3TGUJ 1FDIA 3A0BE 1AQTA 2A45G 1RY3A 1LP1B 4I6MC 1KFMA 1VL2A 1T6AA 5C39A 3Q5SA 3BRVB 3BCCG 3QH9A 1S2EA 1L0NJ 2R5BA 2MKVA 3AE5C 3H1KJ 5GTHE 5AVSB 4BRYA 1HH0A 4EYYQ 1CZQA 2DW3A 3L73D 2WSCH 3CXHD 5CMZA 1QGKB 3AE3C 1KORA 1IFDA 3G3ZA 3BATA 2QJKC 3IN6A 4I7ZC 1NTZG 1RQUA 4GIFA 3CCUP 3H6PA 3V2PA 2XDJA 2WT7B 3RK3B 1DEBA 1PGPA 2I8DA 1KQGB 3OW2O 3B5NA 1ZOYC 3TK1A 2OYIC 1NU1G 2OTJP 3H1KG 3UIAA 1YHQP 4GT1A 4C7RA 3SWFA 3L74D 1N8RQ 3GHGC 3L4FA 2RMZA 1OW6A 1SQQK 1ZV8A 1G1IA 3D71A 4OGQB 3G9RA 4KHXA 1OZHA 3V2RA 4ASWA 1NYHA 5CCHC 2E75B 4C46A 3JC22 4D6TD 2A45H 1IJDB 3L71D 5AW1B 5AVQB 5BU5A 4ZNCA 1L0NK 1M7LA 2JEEA 1NWQA 3WU2E 1AA0A 1MUUA 3H1JG 1P84E 1NTKD 5E79H 2HPCB 5AW4B 1S5LH 1HTLC 2E74C 3L70J 3AECC 1SFCD 4K3AA 3V5BA 1LT1A 3VMAA 3CCLP 3AE1C 1LWUA 3SWYA 3H1HE 1RE3C 2OTLP 3CI9A 4C7NA 2K1AA 5CCHD 3JSVC 2KNCB 3D6YA 2WPQA 1BCCJ 1BE3D 1OVRA 3H1IG 1LT9B 3USSA 4H13C 2IZ1A 3L74E 3V6IA 1GZLA 3LW5H 1Q2NA 4PJ0H 1HF9A 3PJSK 4PV1D 2B9BA 4YXDC 5KLIB 1FE6A 4A7PA 1QX8A 1UIIA 2XV5A 2PP6A 1ZRTE 3W68A 1X0TA 2IYOA 1J1EC 5KAIH 5KLVE 1D7MA 1N7SD 2H7HA 1YQ4C 3VMZA 1KZUB 2H8PD 1BCCG 2PGDA 1GDTA 3O6QA 2WSFH 1IK9A 1GU4A 3BVHA 3AEEC 2P2UA 2OYHB 1SQXG 2BCCG 1VQKP 3CC4P 1L4AC 2QVAA 4I7ZB 1PPJE 1X8YA 1RF1C 3M9QA 1SQBJ 3CCQP 3I55P 3NFQA 4H13D 1VPCA 4Y28J 3L72E 1WMKA 5AW6B 1NAFA 2KK7A 5AW8B 1SQQD 3C1LA 2OYIB 4XE5B 1NHLA 3AE4C 2HODB 3H32A 1TU3F 3TGUD 3CPWO 1GK6A 1BSNA 3CC7P 5AVUB 3GHGB 1FZAA 1H0TB 2JWAA 2XNDH 2K9YA 2Y9ZA 3PP5A 3E7KA 3U1CA 1FJPA 1L0ND 1K8AQ 1SQBG 1AVOA 3U59A 3IFMA 3RL0D 1HGZA 3H1KD 1Q81Q 1R8EA 4HH2A 4AQRD 4GDOA 1JY2N 1N86A 1E5WA 1RHZB 4BWNA 3L75E 5GTHH 3GF7A 1BDDA 2IBZD 4WBAA 1SFCA 4BXLA 3G71P 3HD7D 2IFNA 4RO0A 4JQ0D 1PP9G 3M9HA 3M91A 3B5NC 2V7QH 3KYQA 4LC1A 4DCKA 5CCHA 2ZYDA 2QJPC 1JY2P 1EXIA 3MGNA 3SWKA 3HUSB 3P7KA 2IYPA 3H1HG 2QRXA 1FOSF 2E74B 2YIUB 1YJNP 5CCGC 2KUBA 4NPDA 1PGJA 3CL3D 2CPBA 1EDIA 4UB8H 2YKOA 3EFFK 2WSCJ 2GM4A 1SQVJ 4R4LA 1SQBK 2LR2A 2Z5HA 3ABVC 3H1JD 3FX0A 1Q82Q 3M0AA 1SQQE 5APYA 1YTZT 1NTME 1L0LJ 1N7SA 3H1LJ 3T97B 1VF5C 1DEEG 2O01H 1ZXGA 5H2FH 3OA7A 1HGVA 1RE3A 4HB1A 2E5YA 2A06E 4WVZA 2KLVA 2AXTE 3CC2P 3HTKB 1L0NE 2JR8A 4W80A 4DT0A 5CCGD 3SFDC 3TF5A 1J1EB 5CBNA 3D70A 2FKWB 1PPJG 2QE7H 3W67A 5K5GB 3MZWB 2Y9YA 1LTJA 3L72G 1MFZA 3WU2H 1PGQA 3L70D 1VQ7P 1P84H 2HYNA 1YJ9P 1T3JA 2RN0A 4H0LD 1EDLA 4N78D 3CD6P 1AVYA 1RF1B 2BASA 2H43A 2O1JA 5KKZC 1JO5A 3BCCJ 3II6A 2POHA 1FAVA 1N2DC 1BCCD 3KQGA 1USEA 1GL2D 2NPSC 5B66H 5TISE 1L4AA 2BCCD 2K9JA 4YTPC 1SQVK 1YJWP 1G1JA 3CXHI 1KYOH 2YKQA 3HD7A 1CW5A 4ZMDA 1KB9D 4BRYB 1R5SA 1NTZJ 2E76C 3HE4A 1EQ7A 1L0LK 3KHUA 2FBWC 3RBXA 4PD4H 1ZLLA 1EZVG 1CSBA 1KFNA 2P1JA 2SPZA 1IFIA 2W27A 1NU1J 5APVA 2R5DA 1NOHA 1OVVA 3LW5J 2WPRA 1QLED 4XA4A 1Y8AA 2R3SA 2P67A 1X22A 3B5NB 4WY4C 2NPSD 1SQBD 1ZP0C 4GOFA 1KN7A 2QJPB 1VQ9P 2D2CD 2O01N 3V2NA 2AXCA 3AE2C 5CJ0A 5BU8B 3L70E 3WMM0 4EIJA 2UWJE 1VQLP 2WVRA 2K37A 1VQMP 1NTMG 1JY2O 2B89A 2WSFJ 4U3FE 3B4SA 2H88C 1HWTC 4GKGA 4YPCA 2E76D 2G8YA 2ZT9D 3TNUA 2IZ0A 1OW8A 2ZAEB 4IL6X 2E42A 1S9KD 2GUSA 2J58A 3Q2YA 5CCGA 3CMAP 3S4RA 2FYUG 4YXWH 1H89A 1NAYA 1FZCA 3H1JJ 3GG2A 1VF5B 3AEFC 3KZIE 1SFCC 1W2BO 2Q3EA 2KI7B 4WY4D 3A0HE 1SQPG 2YKPA 1KYOD 4GODA 1ZR4A 1SP4A 1MV8A 3CCEP 1R5LA 2R44A 3RK2C 1NTZK 3OJAB 1KV4A 4PD4D 2BEQD 3CWBG 5AVWB 5M1BA 1M8OB 5APXA 3Q5PA 3MD0A 1NU1K 1H8AA 4ASVA 1GL2A 3VMYA 4PV1C 1LWUB 3H1IJ 2M5AA 4C7NB 4DZOA 5AVYB 1DX7A 1FDOA 3L73E 3CXHE 2IFMA 1SQVD 1JCCA 2B87A 2FFDC 3KPEA 1K9MQ 5AW9B 3TYYA 5KKZB 3CMEP 1BGYG 2WZ7A 1U57A 2XNXA 1N7SC 2V7QJ 2JJLA 1KQSO 1SQPK 2QM7A 3QWOC 2N9YB 1L0LD 4N6JA 3B71A 3H1LD 3RK2D 3H25A 2KZIA 2AEJA 2M3EA 3D6ZA 1S9KE 5KJ7C 1SQXJ 2BCCJ 3GMAA 4W7ZA 1LJ2A 4JYBA 2M3BA 1LTJC 2NPSA 1CI6A 3NXSA 3O6QB 5KTBA 3BRTB 4WB4A 2C0WA 1ZMEC 1YYCA 2AXTH 1VDFA 4QMAA 5B5EE 4Z1MH 2WWWA 1NO4A 1DD3A 1KILD 3CX5H 1HJ0A 4AYCA 2OARA 4HKZH 2O01J 3E1IA 2B88A 2KLUA 2CK3H 1RF0A 4D6TE 3L71E 1E79H 4CPGA 2I1JA 4U3FG 2ZJSE 3RL0C 1A02F 2Y0EA 2QJKB 3BCCD 3H32B 4RJTA 3SSUA 1FZBA 1IC2A 1YBKA 1RE4C 2CPSA 2O3JA 5KJ7D 1USDA 3TDKA 1NTKE 1JTHA 1SQVE 3HD7C 1YI2P 4WY4A 3FXEA 1DD4A 2KYVA 1HJBA 4N3YB 5TISH 4B86A 2W90A 2N9BA 2IBZI 3RL0g 1PP9J 3WUVA 2WSEJ 4H44C 1NTZD 2W6JH 3CCJP 3H1LE 1S72P 1M56D 3A0BH 2QJYC 4M3LA 5APUA 5CJ4A 3H1HJ 1SFCB 1BE3E 2R32A 1JY3N 1URQD 3AE8C 2N1TD 4IOIH 3S9OA 1SQXK 2KS1A 1NU1D 4Y99C 1RQVA 3EWKA 2XZRA 4TLFA 1LTTC 1KTMA 3VMXA 1PL5A 2M0BA 3JCUE 1JY3P 2J5UA 1T8ZA 4L75A 3AE6C 1M1JA 4OWFA 3AE7C 1UIXA 1LNQA 3FGAD 1KD1Q 4MN4C 4IFMA 4DOJA 1LTSC 4H44D 1JM0A 1NH4A 2O1KA 3NMDA 4R4MA 1FZCC 1JUNA 1N7SB 2QM8A 1W5CE 1XTCC 1GU5A 3L74G 1H88A 1S5LE 2W6BA 2FYNC 3RK3C 1Y9BA 3PTZA 1KILA 4H0LC 2FFDA 2GUVA 3L72J 3TGUE 3R4YA 1FC2C 3P32A 4DJGA 2XU6A 4H13B 1IO4A 1W2EA 4UB6E 1SVFA 1NTZE 5L8RJ 5KLVG 2JO1A 5APWA 1LTJB 1OW7A 1FU1A 4W7YA 2I1KA 4D6TG 4IL6E 1GL2C 3L71G 3CCRP 1NKZB 1HVVA 4XFJA 1N73A 5KAFE 1QL1A 3A7OA 1NU1E 5KJ7A 4OGQC 4EOTA 1KQFB 2KB7P 3H1KE 3H1ID 4LLHA 3A3YB 3AE9C 2ZVOB 1NVOA 1OFCX 3C8VA 2FYZA 3FXDA 1HUCA 2E75C 1JNMA 3I56P 1AJYA 2IBZE 4KJMA 2HR3A 3L35A 2Z4EA 3RL0B 1OX3A 1Q90D 1L4AB 1SS1A 1GW3A 2K9JB 5KAIE 3RK3D 1KB9I 3CXHH 3VP9A 3OAKA 2Q7CA 2WSEH 2Y0DA 2QEXP 1OMIA 1G2CA 1ZW0A 5BVZA 5KLVK 3HD7B 1URQA 2N1TA 5AW2B 3Q1MA 4RESB 2W8ZA 2KSJA 1BE3G 1LGHB 3HE4B 4EI2A 4TT3H 1U7JA 1SQXD 2Q5UA 2KIKA 2D2CC 1RE4A 2HFED 4OGQD 5GTIE 1M57D 3H1JE 1OXZA 1RH5B 1PV3A 2QJYB 2AEMA 3L75G 2YNYA 4NPFX 2LXBA 1RF0C 2NRGA 2E75D 2ZT9C 3FWNA 1NTMJ 2IX7C 2LXCB 2GA1A 5EFWB 2WPSA 5DJUB 2E43A 1GK4A 1KMIZ 3PRJA 3KDPB 2JDIH 1QEXA 5APQA 3CCMP 2Z5IA 1OVUA 2C0XA 2QG4A 5KLIC 2OTKE 4K35A 1FS0E 1QVFO 2FYUJ 3H1IE 2J59M 2KXPB 3TNUB 1AV1A 1JY3O 3L37A 3Q5RA 2FXOA 3I5CA 1FJKA 1S5LX 3ZDMA 1FZGA 3B8EB 1VQPP 1LP1A 1SQQG 1Q86Q 2M8RA 1SQPJ 2ZXXA 1P84D 1J1DC 1KYOI 1XTGB 3RK3E 1FZCB 1YITP 1DIPA 2Q9IA 2YMKA 1FZEA 4N78E 2H89C 2OYHC 3TGUG 2ITAA 4I2LC 2L91A 1PP9D 1AFOA 3U1AA 3CWBJ 4PD4I 4IFFA 2JWDA 3BASA 2FYNB 1BCCE 4HJGH 4UB8E 3H1HD 1JMBA 3WUUA 4H0LB 2A06G 2JP3A 2VRSA 2ZYGA 3V4QA 5AVTB 1SQXE 4U7JA 2BCCE 1L0NG 1PIXA 2PFXA 4JYCA 1JMMA 1QVGO 1M1JC 2QSIA 1GL2B 3MUDA 1KB9E 1IFNA 1BGYJ 2WT7A 4RKUJ 3RGUA 2M5AB 2IBZG 2LKMA 1EDKA 3S1KA 2QA4P 1ZN5A 1PZQA 2ZXEB 5H2FE 1NTMK 2B87B 3EQ2A 5AW7B 3JCUH 1IZNB 4IFDK 1ZRTD 1EDJA 4LGDE 3AEDC 5KLVD 4OH8B 2IDBA 2ZYAA 3VTPC 3MTUE 1LTAC 2ZVNB 1VQOP 5APSA 2FY8A 2FYUK 1SQBE 2L5GB 1KILC 2IPPA 4JBZA 1YTZI 2Y0CA 1PPJD 3KXDA 2WMMA 3HUSC 1JB0J 3P8CD 3VN0A 3L72D 2NPSB 1CI6B 3G4SP 2YIUC 1PP9E 2D2CB 5AW0B 2OYOA 3A2AA 1N73C 2A45I 1VQ8P 2C9LY 4U3FJ 4AUWA 1YIJP 1M1KQ 4I1LA 4UB6H 5B66E 1EZVI 3FWLA 2E76B 2HPCA 1VQNP 4IL6H 2YO2A 2ZT9B 3O8ZA 2OGUA 3AEBC 2P7JA 1FZFA 5AVRB 5KAFH 1IFMA 1K05A 1KYOE 1M90Q 3M0DA 1Z56A 1Q7YQ 4ZKPA 3GLMA 4HYTB 2KOGA 3PLNA 3LIEA 3M9BA 2OQQA 3L70G 1JTHB 2WQYC 1FBMA 2KNCA 1EC5A 3L75D 4PD4E 2WITA 4JF7A 3CCVP 1URQC 2N1TC 4WY4B 2E74D 3P8MC 1LT9A 3IF4A 3WUTA 2FXMA 1EZVD 2PAJA 3MP7B
chains in the Genus database with same CATH topology
1ZXGA 2KZIA 4ZMDA 2KZJA 1U7JA 4HB1A 2WMMA 2KIKA 4EYYQ 2KI7B 2JWDA 1X0TA 4ZNCA 4HJGH 4GODA 1FC2C 1JMBA 2KS1B 4IOIH 1BDDA 2R44A 2SPZA 4BXLA 5CBNA 1MFTA 2Q1KA 4NPFX 2LXBA 5K5GB 1OVVA 3MZWB 1Y47A 1U7MA 5DJTB 2QVAA 2RKLA 4HKZH 2LXCB 2B88A 5EFWB 5DJUB 2M0BA 2I8DA 2QRXA 4ASVA 4GOFA 3RGUA 2M5AB 4K3AA 2KUBA 4NPDA 1EDKA 4CPGA 3S1KA 1EDLA 1LT1A 1EDIA 1NVOA 3MHVA 2M5AA 3PH0A 1OVUA 2B87B 2OTKE 3FXDA 4K35A 2UWJE 2B87A 2P58A 1EDJA 2LR2A 4KJMA 2HR3A 4MN4C 2B89A 4WWIA 1SS1A 1EC5A 1JM0A 1OVRA 1LP1B 3ZDMA 2K3RA 3QWOC 1S3JA 1H0TB 5CBOA 4GOEA 2ZAEB 1LP1A 3FXEA 5C39A 1H0TA 1ZW0A 1Q2NA 1BDCA 4ASWA 4NPEA 4JBZA 1DEEG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXG A;  2KZI A;  4ZMD A;  2KZJ A;  1U7J A;  4HB1 A;  2WMM A;  2KIK A;  4EYY Q;  2KI7 B;  2JWD A;  1X0T A;  4ZNC A;  4HJG H;  4GOD A;  1FC2 C;  1JMB A;  2KS1 B;  4IOI H;  1BDD A;  2R44 A;  2SPZ A;  4BXL A;  5CBN A;  1MFT A;  2Q1K A;  4NPF X;  2LXB A;  5K5G B;  1OVV A;  3MZW B;  1Y47 A;  1U7M A;  5DJT B;  2QVA A;  2RKL A;  4HKZ H;  2LXC B;  2B88 A;  5EFW B;  5DJU B;  2M0B A;  2I8D A;  2QRX A;  4ASV A;  4GOF A;  3RGU A;  2M5A B;  4K3A A;  2KUB A;  4NPD A;  1EDK A;  4CPG A;  3S1K A;  1EDL A;  1LT1 A;  1EDI A;  1NVO A;  3MHV A;  2M5A A;  3PH0 A;  1OVU A;  2B87 B;  2OTK E;  3FXD A;  4K35 A;  2UWJ E;  2B87 A;  2P58 A;  1EDJ A;  2LR2 A;  4KJM A;  2HR3 A;  4MN4 C;  2B89 A;  4WWI A;  1SS1 A;  1EC5 A;  1JM0 A;  1OVR A;  1LP1 B;  3ZDM A;  2K3R A;  3QWO C;  1S3J A;  1H0T B;  5CBO A;  4GOE A;  2ZAE B;  1LP1 A;  3FXE A;  5C39 A;  1H0T A;  1ZW0 A;  1Q2N A;  1BDC A;  4ASW A;  4NPE A;  4JBZ A;  1DEE G; 
#chains in the Genus database with same CATH topology
 1YQ3 C;  2RH0 A;  3EFG A;  4KT0 J;  1J1D B;  2P10 A;  1VQ4 P;  5APT A;  5AVX B;  2KZJ A;  1NJI Q;  3AEA C;  3RBZ A;  1X9V A;  1IFP A;  2QIW A;  3L73 J;  2KS1 B;  2WTY A;  2MJZ A;  3P8C E;  3CX5 I;  5GTI H;  2Q1K A;  4OVN F;  2KSE A;  2PRR A;  1S1C X;  1L0L E;  3CLQ A;  1U7M A;  1NTM D;  2OYH A;  2WSS H;  3PHL A;  2YXR B;  4EDF A;  2NZ2 A;  1M1J B;  2E5T A;  2W6A A;  1K73 Q;  1N7L A;  1KC8 Q;  1X79 B;  1VQ6 P;  3RK2 B;  3N4X A;  2HLO A;  3R2P A;  2A06 D;  3GF3 A;  3L74 J;  2FYU D;  3IAO A;  3ITK A;  2OYI A;  3L73 G;  3F89 A;  1JCD A;  2HOD A;  3CX5 D;  1KIL E;  3NTN A;  1L4A D;  2AEF A;  5CBO A;  1AQ5 A;  1EXJ A;  4PV1 B;  3GHG A;  1SQP D;  1HBW A;  1H0T A;  2XKM A;  1DH3 A;  1IFJ A;  1PFI A;  4O9B A;  5KLV J;  1GW4 A;  1OIP A;  1T2K C;  1QL2 A;  3CCS P;  2FFD B;  1KIL B;  1KQL A;  4D6T J;  3CWB D;  3L71 J;  1MZ9 A;  2KP8 A;  3BCC E;  1EZV E;  2R3C A;  3TSI A;  5CHX A;  1GD2 E;  2K88 A;  3IR9 A;  3G6E P;  3Q3D A;  5E79 E;  3M06 A;  2G3A A;  1JOC A;  1MFT A;  3MUD C;  1IK7 A;  4L74 A;  1VQ5 P;  1N73 B;  1NTK J;  3HE5 B;  5DJT B;  4JPZ B;  1MKM A;  1J2J B;  2BEZ F;  1BGY D;  3KZI H;  3HUS A;  3L36 A;  1WT6 A;  3A0H H;  3MHV A;  3PH0 A;  1KB9 H;  3VP8 A;  3V4W A;  2P58 A;  3HE5 A;  1T2K D;  1S4X A;  4WWI A;  2V4H A;  1BE3 J;  3B5N D;  4L73 A;  4PJ0 E;  5AW3 B;  3GW6 A;  2K3R A;  2YXQ B;  1S3J A;  2ZFC A;  4GOE A;  1G2C B;  3MIW A;  1FDM A;  1NGM B;  2FYU E;  2WPV B;  1NTK G;  1URQ B;  2N1T B;  1ZR2 A;  1T3U A;  1BDC A;  3N7N A;  1SQV G;  4NPE A;  3CX5 E;  2Q6Q A;  1NKN A;  2W83 C;  3T97 A;  2C9N Y;  2FXP A;  3L75 J;  1SQP E;  2HG5 D;  1GTW A;  1SLQ A;  3F5H A;  3VYI A;  3V2Q A;  1JEK A;  1LWU C;  1A02 J;  1L0L G;  3H1L G;  2JKV A;  3AEG C;  1GMJ A;  1FOS E;  3HTK A;  3CWB E;  4U3F D;  2YO3 A;  2Q3I A;  5AVZ B;  1BSH A;  1OWA A;  3K5B A;  1L2P A;  5TJH A;  3E1R A;  1Y47 A;  1VF5 D;  1WRG A;  4H44 B;  2RKL A;  3LID A;  3HRN A;  3M0D C;  3C9I A;  3VOP A;  4ZKU A;  3A5T A;  1NTK K;  1LTG C;  1K04 A;  1SQQ J;  5AVV B;  1PGO A;  1LTB C;  1RF1 A;  1LTI C;  2YMY A;  4L76 A;  1BGY E;  1P84 I;  5AW5 B;  4Y99 B;  3SFE C;  5B5E H;  1LT9 C;  3TGU J;  1FDI A;  3A0B E;  1AQT A;  2A45 G;  1RY3 A;  1LP1 B;  4I6M C;  1KFM A;  1VL2 A;  1T6A A;  5C39 A;  3Q5S A;  3BRV B;  3BCC G;  3QH9 A;  1S2E A;  1L0N J;  2R5B A;  2MKV A;  3AE5 C;  3H1K J;  5GTH E;  5AVS B;  4BRY A;  1HH0 A;  4EYY Q;  1CZQ A;  2DW3 A;  3L73 D;  2WSC H;  3CXH D;  5CMZ A;  1QGK B;  3AE3 C;  1KOR A;  1IFD A;  3G3Z A;  3BAT A;  2QJK C;  3IN6 A;  4I7Z C;  1NTZ G;  1RQU A;  4GIF A;  3CCU P;  3H6P A;  3V2P A;  2XDJ A;  2WT7 B;  3RK3 B;  1DEB A;  1PGP A;  2I8D A;  1KQG B;  3OW2 O;  3B5N A;  1ZOY C;  3TK1 A;  2OYI C;  1NU1 G;  2OTJ P;  3H1K G;  3UIA A;  1YHQ P;  4GT1 A;  4C7R A;  3SWF A;  3L74 D;  1N8R Q;  3GHG C;  3L4F A;  2RMZ A;  1OW6 A;  1SQQ K;  1ZV8 A;  1G1I A;  3D71 A;  4OGQ B;  3G9R A;  4KHX A;  1OZH A;  3V2R A;  4ASW A;  1NYH A;  5CCH C;  2E75 B;  4C46 A;  3JC2 2;  4D6T D;  2A45 H;  1IJD B;  3L71 D;  5AW1 B;  5AVQ B;  5BU5 A;  4ZNC A;  1L0N K;  1M7L A;  2JEE A;  1NWQ A;  3WU2 E;  1AA0 A;  1MUU A;  3H1J G;  1P84 E;  1NTK D;  5E79 H;  2HPC B;  5AW4 B;  1S5L H;  1HTL C;  2E74 C;  3L70 J;  3AEC C;  1SFC D;  4K3A A;  3V5B A;  1LT1 A;  3VMA A;  3CCL P;  3AE1 C;  1LWU A;  3SWY A;  3H1H E;  1RE3 C;  2OTL P;  3CI9 A;  4C7N A;  2K1A A;  5CCH D;  3JSV C;  2KNC B;  3D6Y A;  2WPQ A;  1BCC J;  1BE3 D;  1OVR A;  3H1I G;  1LT9 B;  3USS A;  4H13 C;  2IZ1 A;  3L74 E;  3V6I A;  1GZL A;  3LW5 H;  1Q2N A;  4PJ0 H;  1HF9 A;  3PJS K;  4PV1 D;  2B9B A;  4YXD C;  5KLI B;  1FE6 A;  4A7P A;  1QX8 A;  1UII A;  2XV5 A;  2PP6 A;  1ZRT E;  3W68 A;  1X0T A;  2IYO A;  1J1E C;  5KAI H;  5KLV E;  1D7M A;  1N7S D;  2H7H A;  1YQ4 C;  3VMZ A;  1KZU B;  2H8P D;  1BCC G;  2PGD A;  1GDT A;  3O6Q A;  2WSF H;  1IK9 A;  1GU4 A;  3BVH A;  3AEE C;  2P2U A;  2OYH B;  1SQX G;  2BCC G;  1VQK P;  3CC4 P;  1L4A C;  2QVA A;  4I7Z B;  1PPJ E;  1X8Y A;  1RF1 C;  3M9Q A;  1SQB J;  3CCQ P;  3I55 P;  3NFQ A;  4H13 D;  1VPC A;  4Y28 J;  3L72 E;  1WMK A;  5AW6 B;  1NAF A;  2KK7 A;  5AW8 B;  1SQQ D;  3C1L A;  2OYI B;  4XE5 B;  1NHL A;  3AE4 C;  2HOD B;  3H32 A;  1TU3 F;  3TGU D;  3CPW O;  1GK6 A;  1BSN A;  3CC7 P;  5AVU B;  3GHG B;  1FZA A;  1H0T B;  2JWA A;  2XND H;  2K9Y A;  2Y9Z A;  3PP5 A;  3E7K A;  3U1C A;  1FJP A;  1L0N D;  1K8A Q;  1SQB G;  1AVO A;  3U59 A;  3IFM A;  3RL0 D;  1HGZ A;  3H1K D;  1Q81 Q;  1R8E A;  4HH2 A;  4AQR D;  4GDO A;  1JY2 N;  1N86 A;  1E5W A;  1RHZ B;  4BWN A;  3L75 E;  5GTH H;  3GF7 A;  1BDD A;  2IBZ D;  4WBA A;  1SFC A;  4BXL A;  3G71 P;  3HD7 D;  2IFN A;  4RO0 A;  4JQ0 D;  1PP9 G;  3M9H A;  3M91 A;  3B5N C;  2V7Q H;  3KYQ A;  4LC1 A;  4DCK A;  5CCH A;  2ZYD A;  2QJP C;  1JY2 P;  1EXI A;  3MGN A;  3SWK A;  3HUS B;  3P7K A;  2IYP A;  3H1H G;  2QRX A;  1FOS F;  2E74 B;  2YIU B;  1YJN P;  5CCG C;  2KUB A;  4NPD A;  1PGJ A;  3CL3 D;  2CPB A;  1EDI A;  4UB8 H;  2YKO A;  3EFF K;  2WSC J;  2GM4 A;  1SQV J;  4R4L A;  1SQB K;  2LR2 A;  2Z5H A;  3ABV C;  3H1J D;  3FX0 A;  1Q82 Q;  3M0A A;  1SQQ E;  5APY A;  1YTZ T;  1NTM E;  1L0L J;  1N7S A;  3H1L J;  3T97 B;  1VF5 C;  1DEE G;  2O01 H;  1ZXG A;  5H2F H;  3OA7 A;  1HGV A;  1RE3 A;  4HB1 A;  2E5Y A;  2A06 E;  4WVZ A;  2KLV A;  2AXT E;  3CC2 P;  3HTK B;  1L0N E;  2JR8 A;  4W80 A;  4DT0 A;  5CCG D;  3SFD C;  3TF5 A;  1J1E B;  5CBN A;  3D70 A;  2FKW B;  1PPJ G;  2QE7 H;  3W67 A;  5K5G B;  3MZW B;  2Y9Y A;  1LTJ A;  3L72 G;  1MFZ A;  3WU2 H;  1PGQ A;  3L70 D;  1VQ7 P;  1P84 H;  2HYN A;  1YJ9 P;  1T3J A;  2RN0 A;  4H0L D;  1EDL A;  4N78 D;  3CD6 P;  1AVY A;  1RF1 B;  2BAS A;  2H43 A;  2O1J A;  5KKZ C;  1JO5 A;  3BCC J;  3II6 A;  2POH A;  1FAV A;  1N2D C;  1BCC D;  3KQG A;  1USE A;  1GL2 D;  2NPS C;  5B66 H;  5TIS E;  1L4A A;  2BCC D;  2K9J A;  4YTP C;  1SQV K;  1YJW P;  1G1J A;  3CXH I;  1KYO H;  2YKQ A;  3HD7 A;  1CW5 A;  4ZMD A;  1KB9 D;  4BRY B;  1R5S A;  1NTZ J;  2E76 C;  3HE4 A;  1EQ7 A;  1L0L K;  3KHU A;  2FBW C;  3RBX A;  4PD4 H;  1ZLL A;  1EZV G;  1CSB A;  1KFN A;  2P1J A;  2SPZ A;  1IFI A;  2W27 A;  1NU1 J;  5APV A;  2R5D A;  1NOH A;  1OVV A;  3LW5 J;  2WPR A;  1QLE D;  4XA4 A;  1Y8A A;  2R3S A;  2P67 A;  1X22 A;  3B5N B;  4WY4 C;  2NPS D;  1SQB D;  1ZP0 C;  4GOF A;  1KN7 A;  2QJP B;  1VQ9 P;  2D2C D;  2O01 N;  3V2N A;  2AXC A;  3AE2 C;  5CJ0 A;  5BU8 B;  3L70 E;  3WMM 0;  4EIJ A;  2UWJ E;  1VQL P;  2WVR A;  2K37 A;  1VQM P;  1NTM G;  1JY2 O;  2B89 A;  2WSF J;  4U3F E;  3B4S A;  2H88 C;  1HWT C;  4GKG A;  4YPC A;  2E76 D;  2G8Y A;  2ZT9 D;  3TNU A;  2IZ0 A;  1OW8 A;  2ZAE B;  4IL6 X;  2E42 A;  1S9K D;  2GUS A;  2J58 A;  3Q2Y A;  5CCG A;  3CMA P;  3S4R A;  2FYU G;  4YXW H;  1H89 A;  1NAY A;  1FZC A;  3H1J J;  3GG2 A;  1VF5 B;  3AEF C;  3KZI E;  1SFC C;  1W2B O;  2Q3E A;  2KI7 B;  4WY4 D;  3A0H E;  1SQP G;  2YKP A;  1KYO D;  4GOD A;  1ZR4 A;  1SP4 A;  1MV8 A;  3CCE P;  1R5L A;  2R44 A;  3RK2 C;  1NTZ K;  3OJA B;  1KV4 A;  4PD4 D;  2BEQ D;  3CWB G;  5AVW B;  5M1B A;  1M8O B;  5APX A;  3Q5P A;  3MD0 A;  1NU1 K;  1H8A A;  4ASV A;  1GL2 A;  3VMY A;  4PV1 C;  1LWU B;  3H1I J;  2M5A A;  4C7N B;  4DZO A;  5AVY B;  1DX7 A;  1FDO A;  3L73 E;  3CXH E;  2IFM A;  1SQV D;  1JCC A;  2B87 A;  2FFD C;  3KPE A;  1K9M Q;  5AW9 B;  3TYY A;  5KKZ B;  3CME P;  1BGY G;  2WZ7 A;  1U57 A;  2XNX A;  1N7S C;  2V7Q J;  2JJL A;  1KQS O;  1SQP K;  2QM7 A;  3QWO C;  2N9Y B;  1L0L D;  4N6J A;  3B71 A;  3H1L D;  3RK2 D;  3H25 A;  2KZI A;  2AEJ A;  2M3E A;  3D6Z A;  1S9K E;  5KJ7 C;  1SQX J;  2BCC J;  3GMA A;  4W7Z A;  1LJ2 A;  4JYB A;  2M3B A;  1LTJ C;  2NPS A;  1CI6 A;  3NXS A;  3O6Q B;  5KTB A;  3BRT B;  4WB4 A;  2C0W A;  1ZME C;  1YYC A;  2AXT H;  1VDF A;  4QMA A;  5B5E E;  4Z1M H;  2WWW A;  1NO4 A;  1DD3 A;  1KIL D;  3CX5 H;  1HJ0 A;  4AYC A;  2OAR A;  4HKZ H;  2O01 J;  3E1I A;  2B88 A;  2KLU A;  2CK3 H;  1RF0 A;  4D6T E;  3L71 E;  1E79 H;  4CPG A;  2I1J A;  4U3F G;  2ZJS E;  3RL0 C;  1A02 F;  2Y0E A;  2QJK B;  3BCC D;  3H32 B;  4RJT A;  3SSU A;  1FZB A;  1IC2 A;  1YBK A;  1RE4 C;  2CPS A;  2O3J A;  5KJ7 D;  1USD A;  3TDK A;  1NTK E;  1JTH A;  1SQV E;  3HD7 C;  1YI2 P;  4WY4 A;  3FXE A;  1DD4 A;  2KYV A;  1HJB A;  4N3Y B;  5TIS H;  4B86 A;  2W90 A;  2N9B A;  2IBZ I;  3RL0 g;  1PP9 J;  3WUV A;  2WSE J;  4H44 C;  1NTZ D;  2W6J H;  3CCJ P;  3H1L E;  1S72 P;  1M56 D;  3A0B H;  2QJY C;  4M3L A;  5APU A;  5CJ4 A;  3H1H J;  1SFC B;  1BE3 E;  2R32 A;  1JY3 N;  1URQ D;  3AE8 C;  2N1T D;  4IOI H;  3S9O A;  1SQX K;  2KS1 A;  1NU1 D;  4Y99 C;  1RQV A;  3EWK A;  2XZR A;  4TLF A;  1LTT C;  1KTM A;  3VMX A;  1PL5 A;  2M0B A;  3JCU E;  1JY3 P;  2J5U A;  1T8Z A;  4L75 A;  3AE6 C;  1M1J A;  4OWF A;  3AE7 C;  1UIX A;  1LNQ A;  3FGA D;  1KD1 Q;  4MN4 C;  4IFM A;  4DOJ A;  1LTS C;  4H44 D;  1JM0 A;  1NH4 A;  2O1K A;  3NMD A;  4R4M A;  1FZC C;  1JUN A;  1N7S B;  2QM8 A;  1W5C E;  1XTC C;  1GU5 A;  3L74 G;  1H88 A;  1S5L E;  2W6B A;  2FYN C;  3RK3 C;  1Y9B A;  3PTZ A;  1KIL A;  4H0L C;  2FFD A;  2GUV A;  3L72 J;  3TGU E;  3R4Y A;  1FC2 C;  3P32 A;  4DJG A;  2XU6 A;  4H13 B;  1IO4 A;  1W2E A;  4UB6 E;  1SVF A;  1NTZ E;  5L8R J;  5KLV G;  2JO1 A;  5APW A;  1LTJ B;  1OW7 A;  1FU1 A;  4W7Y A;  2I1K A;  4D6T G;  4IL6 E;  1GL2 C;  3L71 G;  3CCR P;  1NKZ B;  1HVV A;  4XFJ A;  1N73 A;  5KAF E;  1QL1 A;  3A7O A;  1NU1 E;  5KJ7 A;  4OGQ C;  4EOT A;  1KQF B;  2KB7 P;  3H1K E;  3H1I D;  4LLH A;  3A3Y B;  3AE9 C;  2ZVO B;  1NVO A;  1OFC X;  3C8V A;  2FYZ A;  3FXD A;  1HUC A;  2E75 C;  1JNM A;  3I56 P;  1AJY A;  2IBZ E;  4KJM A;  2HR3 A;  3L35 A;  2Z4E A;  3RL0 B;  1OX3 A;  1Q90 D;  1L4A B;  1SS1 A;  1GW3 A;  2K9J B;  5KAI E;  3RK3 D;  1KB9 I;  3CXH H;  3VP9 A;  3OAK A;  2Q7C A;  2WSE H;  2Y0D A;  2QEX P;  1OMI A;  1G2C A;  1ZW0 A;  5BVZ A;  5KLV K;  3HD7 B;  1URQ A;  2N1T A;  5AW2 B;  3Q1M A;  4RES B;  2W8Z A;  2KSJ A;  1BE3 G;  1LGH B;  3HE4 B;  4EI2 A;  4TT3 H;  1U7J A;  1SQX D;  2Q5U A;  2KIK A;  2D2C C;  1RE4 A;  2HFE D;  4OGQ D;  5GTI E;  1M57 D;  3H1J E;  1OXZ A;  1RH5 B;  1PV3 A;  2QJY B;  2AEM A;  3L75 G;  2YNY A;  4NPF X;  2LXB A;  1RF0 C;  2NRG A;  2E75 D;  2ZT9 C;  3FWN A;  1NTM J;  2IX7 C;  2LXC B;  2GA1 A;  5EFW B;  2WPS A;  5DJU B;  2E43 A;  1GK4 A;  1KMI Z;  3PRJ A;  3KDP B;  2JDI H;  1QEX A;  5APQ A;  3CCM P;  2Z5I A;  1OVU A;  2C0X A;  2QG4 A;  5KLI C;  2OTK E;  4K35 A;  1FS0 E;  1QVF O;  2FYU J;  3H1I E;  2J59 M;  2KXP B;  3TNU B;  1AV1 A;  1JY3 O;  3L37 A;  3Q5R A;  2FXO A;  3I5C A;  1FJK A;  1S5L X;  3ZDM A;  1FZG A;  3B8E B;  1VQP P;  1LP1 A;  1SQQ G;  1Q86 Q;  2M8R A;  1SQP J;  2ZXX A;  1P84 D;  1J1D C;  1KYO I;  1XTG B;  3RK3 E;  1FZC B;  1YIT P;  1DIP A;  2Q9I A;  2YMK A;  1FZE A;  4N78 E;  2H89 C;  2OYH C;  3TGU G;  2ITA A;  4I2L C;  2L91 A;  1PP9 D;  1AFO A;  3U1A A;  3CWB J;  4PD4 I;  4IFF A;  2JWD A;  3BAS A;  2FYN B;  1BCC E;  4HJG H;  4UB8 E;  3H1H D;  1JMB A;  3WUU A;  4H0L B;  2A06 G;  2JP3 A;  2VRS A;  2ZYG A;  3V4Q A;  5AVT B;  1SQX E;  4U7J A;  2BCC E;  1L0N G;  1PIX A;  2PFX A;  4JYC A;  1JMM A;  1QVG O;  1M1J C;  2QSI A;  1GL2 B;  3MUD A;  1KB9 E;  1IFN A;  1BGY J;  2WT7 A;  4RKU J;  3RGU A;  2M5A B;  2IBZ G;  2LKM A;  1EDK A;  3S1K A;  2QA4 P;  1ZN5 A;  1PZQ A;  2ZXE B;  5H2F E;  1NTM K;  2B87 B;  3EQ2 A;  5AW7 B;  3JCU H;  1IZN B;  4IFD K;  1ZRT D;  1EDJ A;  4LGD E;  3AED C;  5KLV D;  4OH8 B;  2IDB A;  2ZYA A;  3VTP C;  3MTU E;  1LTA C;  2ZVN B;  1VQO P;  5APS A;  2FY8 A;  2FYU K;  1SQB E;  2L5G B;  1KIL C;  2IPP A;  4JBZ A;  1YTZ I;  2Y0C A;  1PPJ D;  3KXD A;  2WMM A;  3HUS C;  1JB0 J;  3P8C D;  3VN0 A;  3L72 D;  2NPS B;  1CI6 B;  3G4S P;  2YIU C;  1PP9 E;  2D2C B;  5AW0 B;  2OYO A;  3A2A A;  1N73 C;  2A45 I;  1VQ8 P;  2C9L Y;  4U3F J;  4AUW A;  1YIJ P;  1M1K Q;  4I1L A;  4UB6 H;  5B66 E;  1EZV I;  3FWL A;  2E76 B;  2HPC A;  1VQN P;  4IL6 H;  2YO2 A;  2ZT9 B;  3O8Z A;  2OGU A;  3AEB C;  2P7J A;  1FZF A;  5AVR B;  5KAF H;  1IFM A;  1K05 A;  1KYO E;  1M90 Q;  3M0D A;  1Z56 A;  1Q7Y Q;  4ZKP A;  3GLM A;  4HYT B;  2KOG A;  3PLN A;  3LIE A;  3M9B A;  2OQQ A;  3L70 G;  1JTH B;  2WQY C;  1FBM A;  2KNC A;  1EC5 A;  3L75 D;  4PD4 E;  2WIT A;  4JF7 A;  3CCV P;  1URQ C;  2N1T C;  4WY4 B;  2E74 D;  3P8M C;  1LT9 A;  3IF4 A;  3WUT A;  2FXM A;  1EZV D;  2PAJ A;  3MP7 B; 
#chains in the Genus database with same CATH homology
 1ZXG A;  2KZI A;  4ZMD A;  2KZJ A;  1U7J A;  4HB1 A;  2WMM A;  2KIK A;  4EYY Q;  2KI7 B;  2JWD A;  1X0T A;  4ZNC A;  4HJG H;  4GOD A;  1FC2 C;  1JMB A;  2KS1 B;  4IOI H;  1BDD A;  2R44 A;  2SPZ A;  4BXL A;  5CBN A;  1MFT A;  2Q1K A;  4NPF X;  2LXB A;  5K5G B;  1OVV A;  3MZW B;  1Y47 A;  1U7M A;  5DJT B;  2QVA A;  2RKL A;  4HKZ H;  2LXC B;  2B88 A;  5EFW B;  5DJU B;  2M0B A;  2I8D A;  2QRX A;  4ASV A;  4GOF A;  3RGU A;  2M5A B;  4K3A A;  2KUB A;  4NPD A;  1EDK A;  4CPG A;  3S1K A;  1EDL A;  1LT1 A;  1EDI A;  1NVO A;  3MHV A;  2M5A A;  3PH0 A;  1OVU A;  2B87 B;  2OTK E;  3FXD A;  4K35 A;  2UWJ E;  2B87 A;  2P58 A;  1EDJ A;  2LR2 A;  4KJM A;  2HR3 A;  4MN4 C;  2B89 A;  4WWI A;  1SS1 A;  1EC5 A;  1JM0 A;  1OVR A;  1LP1 B;  3ZDM A;  2K3R A;  3QWO C;  1S3J A;  1H0T B;  5CBO A;  4GOE A;  2ZAE B;  1LP1 A;  3FXE A;  5C39 A;  1H0T A;  1ZW0 A;  1Q2N A;  1BDC A;  4ASW A;  4NPE A;  4JBZ A;  1DEE G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...