2RKLA

Crystal structure of s.cerevisiae vta1 c-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
b'GSTKDELTKIMDRASKIEQIQKLAKYAISALNYEDLPTAKDELTKALDLLNSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein VTA1
publication title Structural basis of vta1 function in the multivesicular body sorting pathway.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lipid transport
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18097 Vta1_C Vta1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2rklA00
4NPFX 2B89A 2QRXA 4GODA 2KS1B 4KJMA 1Q2NA 1U7MA 2M5AA 1JM0A 2K3RA 5CBNA 3RGUA 3FXDA 2LXCB 1OVUA 3FXEA 1LP1A 4HJGH 4K3AA 4ZMDA 2HR3A 2B87A 1BDDA 4IOIH 4WWIA 2R44A 4GOEA 4NPEA 2P58A 1H0TA 1FC2C 2LR2A 2Q1KA 5EFWB 4HKZH 2KZIA 5K5GB 1JMBA 2KI7B 1U7JA 2B88A 2OTKE 3S1KA 4NPDA 1X0TA 3ZDMA 3QWOC 4MN4C 2M0BA 1OVRA 1NVOA 3MZWB 1EDLA 2JWDA 5CBOA 4EYYQ 1DEEG 2ZAEB 1ZXGA 1EDIA 1LT1A 2M5AB 1EC5A 1EDJA 2RKLA 2LXBA 4ASWA 4GOFA 2I8DA 1MFTA 2KUBA 4K35A 5C39A 1EDKA 4JBZA 5DJTB 5DJUB 2KIKA 2SPZA 1ZW0A 1S3JA 1LP1B 4ZNCA 1SS1A 2B87B 4HB1A 4CPGA 2QVAA 3PH0A 1BDCA 4ASVA 1OVVA 1Y47A 3MHVA 1H0TB 2UWJE 2KZJA 2WMMA 4BXLA
chains in the Genus database with same CATH superfamily
1KILC 3H1ID 3L70E 2V7QH 3H32A 3AEAC 3O6QA 1K9MQ 1N7SD 3H1KE 3GHGC 1RH5B 4GDOA 2ZT9D 3VMZA 3CC4P 4RESB 3AE5C 3L72E 5CCHA 1BDDA 3BCCJ 1IK9A 4IL6X 2O1KA 2GM4A 2L5GB 1JMBA 1KFNA 2FYUJ 5TJHA 2A06G 3N7NA 5KTBA 2QM7A 1Q81Q 3WUTA 3L73D 1L0LE 3V4QA 1GU4A 1SQPG 2W90A 5CJ0A 3L71E 1QL1A 2E75B 4IFDK 2Q6QA 5AW9B 1HGVA 2LXBA 1N7SC 3PJSK 4WVZA 4D6TG 3CL3D 1LNQA 1T2KD 2KIKA 3PLNA 2KXPB 2ZT9C 1VQPP 1S3JA 1NTKE 3H6PA 3PTZA 3PH0A 1QEXA 1URQC 4ASVA 4WBAA 1KTMA 3BATA 4WY4D 2QEXP 2OQQA 3BRVB 3II6A 2QA4P 3JSVC 3JC22 2OYHC 1JMMA 1JM0A 1SLQA 3IN6A 1K73Q 3E1RA 3CWBG 2Y9ZA 2BEQD 3CMAP 4XE5B 1T8ZA 2XV5A 1L4AB 1R5LA 4I7ZB 1FZCB 1R8EA 4GT1A 1KYOI 2HPCB 2FFDA 3M0DC 4WWIA 2FBWC 1M1KQ 1FC2C 3CX5D 1SVFA 4O9BA 2E42A 4HKZH 4R4MA 3CCQP 1NTZG 3AEEC 2WT7A 2JJLA 3NXSA 4Y99B 3RK2D 4QMAA 3H1LE 4W7YA 4WB4A 5CBOA 1M56D 2H89C 1DEEG 1KYOE 5E79E 2ZAEB 4U3FD 1SQQD 2YMKA 2E74D 1EZVI 3L74G 1YITP 2MKVA 3AE1C 4C7RA 1N73B 5APUA 4JBZA 2YIUC 3L4FA 2HFED 2NRGA 3C1LA 2N1TD 3H1KJ 1DEBA 3D71A 3PP5A 2JKVA 3L72J 2A45G 4L75A 1EZVE 1SQBG 2NPSB 3AEFC 1OW8A 1S5LX 2WSEH 4LLHA 2YO3A 5AW1B 4OGQD 3B8EB 2GA1A 2KSJA 3F89A 3BASA 1BGYD 2K3RA 1QVGO 1NTMD 2WSCH 3RK3D 3VMAA 1EXIA 5KLVJ 5CCHD 2QJPB 3CD6P 1GD2E 2E74C 4ZMDA 4OH8B 1GTWA 3TGUG 3PRJA 1L0LJ 3H1JD 5APQA 1AVOA 1Y8AA 1YTZI 4A7PA 2P58A 3L71J 2Y9YA 1QL2A 2B88A 3AEGC 2FXOA 3EFGA 1QX8A 2N1TC 3CCLP 1J1EB 2C9NY 5B66E 4MN4C 1NVOA 4PV1B 3Q5SA 3KPEA 5CMZA 4DCKA 1NU1D 4C46A 4YXDC 1FJKA 2CK3H 1HJBA 2YKOA 4OGQC 4ASWA 3B5NB 2I8DA 5BU8B 4PJ0H 4OWFA 2HG5D 3LIDA 1PP9D 1SQBJ 1RF1B 3RK3C 1X8YA 5KKZB 1PPJE 2OYIB 4D6TD 5APYA 1H89A 4H44C 3KZIH 1NTMK 1H0TB 1SQVE 1VF5D 2JR8A 2M3EA 5B5EH 2FY8A 1ZMEC 4PJ0E 1LT9B 3OA7A 5M1BA 3ABVC 5AW0B 5CCGA 1FDMA 1CZQA 3H1IG 1YTZT 2LXCB 2Q3EA 3V6IA 1RE3A 1SQXD 2OGUA 1JEKA 3KYQA 2WITA 2P2UA 3L70D 1AV1A 1SP4A 4JYCA 3G9RA 3Q5RA 1FOSF 5K5GB 1NU1K 4BRYB 1SQPK 2FYNC 1LTJC 5GTIH 5AW2B 3RL0B 1VF5C 1BCCJ 3IFMA 1EDIA 3L73G 1VQKP 3S4RA 1L4AA 1FZCA 1RE4A 4PD4I 3C8VA 4EOTA 4DT0A 2HPCA 2WQYC 5APXA 1KB9I 1IFPA 4W7ZA 4L76A 3A2AA 5GTIE 1SS1A 2JO1A 1DD3A 1L0ND 2FFDC 2MJZA 3KHUA 3H1HJ 2FYUE 2ZVOB 5AVYB 5AW3B 3HUSC 4BXLA 3E7KA 3HE5B 2P67A 2HYNA 1GZLA 2WPQA 4PD4E 4KJMA 1J1DC 1KB9E 4UB8H 2ZVNB 1FOSE 1NTKD 2P10A 1N73A 1SFCB 1YJ9P 1IFIA 1CI6B 1KV4A 1Q7YQ 3VMYA 2HR3A 1NTZK 3AEDC 4N78D 1OW6A 1BE3D 2KK7A 1GL2C 1HUCA 3WU2H 2NPSA 4UB8E 3L73J 1MZ9A 3FX0A 3T97B 3L75D 3Q3DA 1KN7A 1YBKA 2M0BA 1VQLP 2JWDA 1KQSO 1M7LA 1K8AQ 4HYTB 4N6JA 3JCUE 1E5WA 1MFTA 2A06E 2POHA 3WU2E 3SFEC 1ZR2A 2W83C 4U3FG 1SQQG 2JDIH 2SPZA 3VOPA 1VQ6P 5KLIC 3CXHH 1SQPE 1AVYA 2ZYGA 3UIAA 1RY3A 2AEJA 1KZUB 2BCCD 4I6MC 1ZRTD 2Q7CA 3A0BE 2E75D 2KS1B 4HH2A 5CCGD 2GUSA 1RQUA 5AVWB 3B5NA 1M90Q 3CXHE 4L73A 2K88A 1RF1A 1P84D 2OYIA 1BGYG 3B71A 3AE4C 1NTMG 3FWLA 1IJDB 3I55P 1H0TA 2YMYA 1KQLA 3A0HH 2BASA 2Q1KA 5EFWB 2M8RA 1NGMB 1VQ8P 3CWBE 1U7JA 3H1JG 3FWNA 3TF5A 1LT9A 1VPCA 1FJPA 3WMM0 1T3UA 3QWOC 4KT0J 3CCEP 5KJ7D 3M9QA 3Q1MA 1NWQA 3V2NA 1L4AD 4YPCA 5KLVE 2R3CA 5CCGC 1VQ4P 2YKQA 3A0HE 1N86A 1NTZE 1E79H 5C39A 1IFJA 1VQ5P 1NU1G 3GHGB 4ZNCA 1JO5A 4BRYA 2O3JA 2Q9IA 3M91A 1FS0E 2A45I 3L74E 2M3BA 1PP9G 3AE7C 3N4XA 3O8ZA 1DIPA 3V2PA 1S9KE 1PIXA 2PAJA 2QJKC 2ZJSE 4H0LB 2V4HA 1BGYJ 3VYIA 1VDFA 1NTMJ 3P8CE 2J5UA 1VQOP 3VN0A 4C7NB 3I5CA 1FAVA 5KJ7C 1FZFA 1FBMA 5BVZA 2R32A 1M1JB 1OVUA 3H1JJ 4DJGA 1YJWP 1SQBE 3I56P 5AW4B 4I7ZC 3U1CA 1PGQA 1JY2N 2AEMA 1JB0J 2YKPA 1SQXG 1LWUC 2NPSD 2RH0A 3HE5A 2ZXXA 1GDTA 3L70G 2IZ1A 1USEA 1ZR4A 3D6ZA 1KYOH 5E79H 1NKZB 3TGUE 3MP7B 1PZQA 1NU1J 1URQB 1SFCA 1SQPJ 4TLFA 2WTYA 1T2KC 2M5AB 1CI6A 3R4YA 1PP9J 2KYVA 2W6BA 3TNUB 2H43A 3G6EP 1KILE 4D6TJ 3AECC 1ZOYC 1GU5A 3SWYA 4CPGA 4WY4C 1NH4A 1A02F 4LC1A 1DD4A 4ZKUA 3T97A 1JTHB 4LGDE 1L2PA 4GKGA 3L37A 3MUDA 4L74A 1L0NG 3AE2C 4ZKPA 1AQ5A 1Q2NA 1BCCE 3B5ND 1LTGC 3BCCD 1JUNA 3CWBJ 1FZEA 3FXEA 1AJYA 1NTKG 2I1KA 5APTA 4XFJA 2QIWA 3HD7B 4GOEA 2I1JA 2P1JA 5APSA 3H1HE 2LR2A 2KZIA 3M9BA 3HTKB 3RK2C 3H1IE 5B66H 3ZDMA 4IL6E 2KS1A 1NTZJ 2IBZD 1BE3G 1J1EC 3U1AA 1FE6A 3V5BA 2IYOA 1G2CB 3K5BA 3L75G 1SQQK 2FYZA 3L74J 3HRNA 3CI9A 1IZNB 1OX3A 3B5NC 5AVRB 3D6YA 1YHQP 5DJUB 2IFNA 2QM8A 2YNYA 1JY3N 1RF1C 2G3AA 3CMEP 5KKZC 1NO4A 1FDOA 3L73E 5AVXB 1CSBA 3B4SA 3RL0D 2C0XA 3BRTB 3V2QA 3CCRP 1OWAA 4B86A 1LT9C 2Z4EA 2BCCG 5AVVB 5CCHC 3OAKA 3EWKA 1ZN5A 2R3SA 3CPWO 1Y9BA 3RGUA 1YI2P 2K37A 2N1TB 3SSUA 1T3JA 1VQNP 2RMZA 2QJYB 2IX7C 5CJ4A 3GHGA 3W68A 4HJGH 2H88C 4IOIH 2R44A 3TGUJ 1YYCA 3QH9A 2G8YA 4OGQB 2W6JH 3P8MC 3L75J 1FZGA 3CX5I 2ZXEB 1PV3A 3RBXA 3KDPB 2XNXA 4IFFA 3RBZA 3G4SP 1OVRA 3G71P 4C7NA 4H44B 3NFQA 2KB7P 3H1KD 1LT1A 1EC5A 1M1JA 1BSNA 1YJNP 4R4LA 1WMKA 3VTPC 2KUBA 2Z5HA 1X22A 3OJAB 3L72D 2Z5IA 4UB6H 2FKWB 4RO0A 1LP1B 4Z1MH 1PGJA 2BCCJ 3C9IA 2XZRA 1BDCA 1GMJA 4YXWH 1Z56A 2HODB 4JPZB 4DZOA 2QG4A 5KLVD 4PD4H 1W5CE 3F5HA 1KORA 3CCVP 1NJIQ 5AW7B 1URQA 1KB9H 4U3FE 1D7MA 1SQQE 4TT3H 1L0LD 2M5AA 1S5LE 4UB6E 2OARA 5AVSB 1LTJB 4AQRD 3TNUA 3TSIA 3L71D 3H1IJ 3WUUA 1SQXK 3TYYA 1UIIA 2IBZI 1JTHA 3MD0A 1EQ7A 5AVQB 1A02J 2Y0DA 1HTLC 4GIFA 3M0DA 1FZAA 5AW5B 3CCSP 1QLED 2KLVA 1Q82Q 1LTSC 1PL5A 1BGYE 3GF7A 1W2EA 1NTME 3JCUH 3RK3E 1NYHA 2IFMA 2N9BA 3HUSB 4K35A 3H1JE 1VQ7P 2KLUA 2PP6A 1W2BO 3V2RA 3HD7A 1J1DB 3HTKA 5GTHH 2YXRB 1YIJP 5TISH 1WT6A 2CPSA 2VRSA 1L0NK 2KNCB 3A0BH 1XTGB 1DX7A 3CCUP 2E76B 3KQGA 1IFNA 4GODA 1G2CA 1GK4A 1NU1E 1QGKB 1YQ4C 2QSIA 2K9YA 3CCMP 1S72P 1GL2B 3H1LD 2C9LY 1NTKK 1G1JA 1PP9E 1KYOD 5GTHE 5TISE 1GW3A 4D6TE 2PFXA 1FZBA 3BCCG 2GUVA 2Y0EA 1NAYA 1HVVA 1S1CX 4NPDA 4Y28J 3VP9A 4H0LD 1G1IA 2J58A 3LW5J 1MKMA 1EZVD 2N1TA 2FXMA 2IBZG 3H1HD 3FGAD 1K04A 1MV8A 5DJTB 2ZYAA 4U3FJ 2K1AA 1SQQJ 4H13B 2D2CB 1Y47A 3KXDA 2E75C 2DW3A 1KILB 3MGNA 3IF4A 4M3LA 5KAIH 1ZP0C 1URQD 3HE4B 5AVZB 1VQ9P 3A5TA 1RE3C 2R5BA 2BEZF 4H0LC 2O01N 4BWNA 2O1JA 2OTLP 2E5YA 2A45H 2WPSA 1LP1A 1M1JC 3W67A 1L0NE 2W27A 5KAIE 4JF7A 3A3YB 4N3YB 2WPVB 3R2PA 2HODA 3USSA 1JY2O 4EDFA 3V4WA 1PPJD 2XDJA 2KI7B 1LTTC 1TU3F 2PGDA 1K05A 2Q3IA 3TDKA 2IDBA 2Y0CA 1N2DC 1L4AC 1SQVD 1FZCC 1RE4C 1RF0A 1LTJA 2CPBA 4EYYQ 3EFFK 1ZXGA 2WSFJ 1N7SB 1JCCA 1IC2A 1RHZB 1LJ2A 2QJKB 1H88A 3HD7D 4W80A 2YO2A 2ZT9B 1Q90D 4Y99C 4N78E 1BE3E 2IYPA 3H1KG 2B87B 3GF3A 2K9JB 2Q5UA 1N8RQ 1CW5A 3L75E 3MHVA 3L72G 3L35A 1LTAC 5CHXA 5APVA 1N73C 1HH0A 1S4XA 3GLMA 3AE6C 1JOCA 1RQVA 1USDA 2OYHB 1LWUB 1X79B 2RN0A 3HUSA 1M57D 5KLVG 4XA4A 3FXDA 5APWA 1L0LG 4PV1D 2NPSC 3MIWA 2J59M 1SQVK 1P84I 1P84H 1VL2A 3L71G 2BCCE 2E5TA 2XU6A 2KNCA 2R5DA 3GW6A 3HD7C 3VMXA 2P7JA 1ZRTE 4IL6H 1SQXJ 1ZV8A 2OYOA 1FU1A 2FYUD 2N9YB 2QJPC 3L70J 1GL2A 3L36A 4WY4B 3MZWB 3Q2YA 4PD4D 2OTJP 1OW7A 2XKMA 1Q86Q 1P84E 1WRGA 1LTIC 1KB9D 5AVTB 4GOFA 2NZ2A 1HF9A 1IO4A 1QVFO 1IFDA 2YIUB 1IFMA 2O01J 3P32A 3WUVA 1GK6A 4HB1A 2QE7H 4PV1C 1KMIZ 5AW8B 2V7QJ 1JY3O 1NAFA 3PHLA 5BU5A 1OXZA 2AXCA 4I2LC 1LGHB 3AE3C 1KC8Q 1KQGB 2B89A 2QRXA 4H44D 1L0NJ 2WWWA 3IR9A 3RK2B 4IFMA 5L8RJ 3Q5PA 2OYIC 2AXTH 4JQ0D 2H8PD 1MFZA 2E74B 3VP8A 2PRRA 2FYUK 2QJYC 4I1LA 3H1LG 3TK1A 2A06D 2XNDH 3H25A 1NTKJ 1VQMP 2WSSH 3M0AA 1KD1Q 1KILA 1SQPD 1OMIA 3HE4A 2AXTE 3CCJP 2FXPA 1DH3A 1HWTC 1X9VA 1S2EA 1XTCC 2WPRA 1BCCG 1BE3J 1NHLA 2YXQB 3GG2A 1EDLA 3D70A 3H32B 2W6AA 3O6QB 3LW5H 1EXJA 1EZVG 3CX5H 3CXHD 3RK3B 3NTNA 2IPPA 1IK7A 1SFCD 3H1HG 3RL0C 1J2JB 1OZHA 1JY2P 2UWJE 1M8OB 2WMMA 3CWBD 3KZIE 1N7LA 4NPFX 1UIXA 1S5LH 3SWFA 1R5SA 3CX5E 3H1LJ 1U7MA 4RKUJ 2C0WA 1N7SA 3M9HA 5B5EE 1NOHA 1RF0C 5CBNA 3A7OA 3RL0g 2HLOA 4K3AA 2B9BA 2B87A 1H8AA 1NTZD 2K9JA 5KJ7A 1MUUA 4NPEA 1BSHA 2IZ0A 1YQ3C 2WVRA 4DOJA 4EI2A 2FYNB 2OTKE 2E43A 2E76D 3S1KA 1X0TA 3ITKA 1SFCC 2W8ZA 1JNMA 3L74D 4EIJA 1HGZA 2OYHA 1LWUA 1GL2D 3P7KA 1PPJG 1VF5B 1S9KD 2JP3A 3BCCE 2H7HA 3AE8C 1PGOA 3CC2P 3CLQA 1PGPA 1PFIA 2RKLA 3P8CD 1SQVG 2KSEA 4AYCA 4JYBA 1EDKA 3SFDC 4YTPC 2WSFH 1ZW0A 3E1IA 2JEEA 1SQBD 3MUDC 2FFDB 2QVAA 2WSEJ 1OVVA 3BVHA 3GMAA 1HJ0A 1AQTA 3SWKA 1AFOA 3MTUE 3G3ZA 2IBZE 4RJTA 3AEBC 1JCDA 1NKNA 2AEFA 5KLVK 2WSCJ 4WY4A 1OFCX 3EQ2A 2E76C 2WT7B 1L0LK 3AE9C 2ZYDA 3TGUD 1KQFB 4KHXA 2WZ7A 1FDIA 2LKMA 2KP8A 1U57A 1HBWA 4H13D 2D2CD 1KILD 1JY3P 3IAOA 1SQVJ 3OW2O 2ITAA 1GW4A 1ZLLA 1KFMA 3U59A 3NMDA 5AVUB 3CXHI 5H2FH 1SQBK 1OIPA 5AW6B 3CC7P 5KAFH 1AA0A 2FYUG 2L91A 2JWAA 1LTBC 1BCCD 1EDJA 2KOGA 3M06A 1T6AA 4AUWA 5KLIB 4OVNF 3S9OA 3LIEA 4H13C 2D2CC 5H2FE 4U7JA 1SQXE 2ZFCA 2KZJA 2O01H 5KAFE
chains in the Genus database with same CATH topology
4NPFX 2B89A 2QRXA 4GODA 2KS1B 4KJMA 1Q2NA 1U7MA 2M5AA 1JM0A 2K3RA 5CBNA 3RGUA 3FXDA 2LXCB 1OVUA 3FXEA 1LP1A 4HJGH 4K3AA 4ZMDA 2HR3A 2B87A 1BDDA 4IOIH 4WWIA 2R44A 4GOEA 4NPEA 2P58A 1H0TA 1FC2C 2LR2A 2Q1KA 5EFWB 4HKZH 2KZIA 5K5GB 1JMBA 2KI7B 1U7JA 2B88A 2OTKE 3S1KA 4NPDA 1X0TA 3ZDMA 3QWOC 4MN4C 2M0BA 1OVRA 1NVOA 3MZWB 1EDLA 2JWDA 5CBOA 4EYYQ 1DEEG 2ZAEB 1ZXGA 1EDIA 1LT1A 2M5AB 1EC5A 1EDJA 2RKLA 2LXBA 4ASWA 4GOFA 2I8DA 1MFTA 2KUBA 4K35A 5C39A 1EDKA 4JBZA 5DJTB 5DJUB 2KIKA 2SPZA 1ZW0A 1S3JA 1LP1B 4ZNCA 1SS1A 2B87B 4HB1A 4CPGA 2QVAA 3PH0A 1BDCA 4ASVA 1OVVA 1Y47A 3MHVA 1H0TB 2UWJE 2KZJA 2WMMA 4BXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPF X;  2B89 A;  2QRX A;  4GOD A;  2KS1 B;  4KJM A;  1Q2N A;  1U7M A;  2M5A A;  1JM0 A;  2K3R A;  5CBN A;  3RGU A;  3FXD A;  2LXC B;  1OVU A;  3FXE A;  1LP1 A;  4HJG H;  4K3A A;  4ZMD A;  2HR3 A;  2B87 A;  1BDD A;  4IOI H;  4WWI A;  2R44 A;  4GOE A;  4NPE A;  2P58 A;  1H0T A;  1FC2 C;  2LR2 A;  2Q1K A;  5EFW B;  4HKZ H;  2KZI A;  5K5G B;  1JMB A;  2KI7 B;  1U7J A;  2B88 A;  2OTK E;  3S1K A;  4NPD A;  1X0T A;  3ZDM A;  3QWO C;  4MN4 C;  2M0B A;  1OVR A;  1NVO A;  3MZW B;  1EDL A;  2JWD A;  5CBO A;  4EYY Q;  1DEE G;  2ZAE B;  1ZXG A;  1EDI A;  1LT1 A;  2M5A B;  1EC5 A;  1EDJ A;  2RKL A;  2LXB A;  4ASW A;  4GOF A;  2I8D A;  1MFT A;  2KUB A;  4K35 A;  5C39 A;  1EDK A;  4JBZ A;  5DJT B;  5DJU B;  2KIK A;  2SPZ A;  1ZW0 A;  1S3J A;  1LP1 B;  4ZNC A;  1SS1 A;  2B87 B;  4HB1 A;  4CPG A;  2QVA A;  3PH0 A;  1BDC A;  4ASV A;  1OVV A;  1Y47 A;  3MHV A;  1H0T B;  2UWJ E;  2KZJ A;  2WMM A;  4BXL A; 
#chains in the Genus database with same CATH topology
 1KIL C;  3H1I D;  3L70 E;  2V7Q H;  3H32 A;  3AEA C;  3O6Q A;  1K9M Q;  1N7S D;  3H1K E;  3GHG C;  1RH5 B;  4GDO A;  2ZT9 D;  3VMZ A;  3CC4 P;  4RES B;  3AE5 C;  3L72 E;  5CCH A;  1BDD A;  3BCC J;  1IK9 A;  4IL6 X;  2O1K A;  2GM4 A;  2L5G B;  1JMB A;  1KFN A;  2FYU J;  5TJH A;  2A06 G;  3N7N A;  5KTB A;  2QM7 A;  1Q81 Q;  3WUT A;  3L73 D;  1L0L E;  3V4Q A;  1GU4 A;  1SQP G;  2W90 A;  5CJ0 A;  3L71 E;  1QL1 A;  2E75 B;  4IFD K;  2Q6Q A;  5AW9 B;  1HGV A;  2LXB A;  1N7S C;  3PJS K;  4WVZ A;  4D6T G;  3CL3 D;  1LNQ A;  1T2K D;  2KIK A;  3PLN A;  2KXP B;  2ZT9 C;  1VQP P;  1S3J A;  1NTK E;  3H6P A;  3PTZ A;  3PH0 A;  1QEX A;  1URQ C;  4ASV A;  4WBA A;  1KTM A;  3BAT A;  4WY4 D;  2QEX P;  2OQQ A;  3BRV B;  3II6 A;  2QA4 P;  3JSV C;  3JC2 2;  2OYH C;  1JMM A;  1JM0 A;  1SLQ A;  3IN6 A;  1K73 Q;  3E1R A;  3CWB G;  2Y9Z A;  2BEQ D;  3CMA P;  4XE5 B;  1T8Z A;  2XV5 A;  1L4A B;  1R5L A;  4I7Z B;  1FZC B;  1R8E A;  4GT1 A;  1KYO I;  2HPC B;  2FFD A;  3M0D C;  4WWI A;  2FBW C;  1M1K Q;  1FC2 C;  3CX5 D;  1SVF A;  4O9B A;  2E42 A;  4HKZ H;  4R4M A;  3CCQ P;  1NTZ G;  3AEE C;  2WT7 A;  2JJL A;  3NXS A;  4Y99 B;  3RK2 D;  4QMA A;  3H1L E;  4W7Y A;  4WB4 A;  5CBO A;  1M56 D;  2H89 C;  1DEE G;  1KYO E;  5E79 E;  2ZAE B;  4U3F D;  1SQQ D;  2YMK A;  2E74 D;  1EZV I;  3L74 G;  1YIT P;  2MKV A;  3AE1 C;  4C7R A;  1N73 B;  5APU A;  4JBZ A;  2YIU C;  3L4F A;  2HFE D;  2NRG A;  3C1L A;  2N1T D;  3H1K J;  1DEB A;  3D71 A;  3PP5 A;  2JKV A;  3L72 J;  2A45 G;  4L75 A;  1EZV E;  1SQB G;  2NPS B;  3AEF C;  1OW8 A;  1S5L X;  2WSE H;  4LLH A;  2YO3 A;  5AW1 B;  4OGQ D;  3B8E B;  2GA1 A;  2KSJ A;  3F89 A;  3BAS A;  1BGY D;  2K3R A;  1QVG O;  1NTM D;  2WSC H;  3RK3 D;  3VMA A;  1EXI A;  5KLV J;  5CCH D;  2QJP B;  3CD6 P;  1GD2 E;  2E74 C;  4ZMD A;  4OH8 B;  1GTW A;  3TGU G;  3PRJ A;  1L0L J;  3H1J D;  5APQ A;  1AVO A;  1Y8A A;  1YTZ I;  4A7P A;  2P58 A;  3L71 J;  2Y9Y A;  1QL2 A;  2B88 A;  3AEG C;  2FXO A;  3EFG A;  1QX8 A;  2N1T C;  3CCL P;  1J1E B;  2C9N Y;  5B66 E;  4MN4 C;  1NVO A;  4PV1 B;  3Q5S A;  3KPE A;  5CMZ A;  4DCK A;  1NU1 D;  4C46 A;  4YXD C;  1FJK A;  2CK3 H;  1HJB A;  2YKO A;  4OGQ C;  4ASW A;  3B5N B;  2I8D A;  5BU8 B;  4PJ0 H;  4OWF A;  2HG5 D;  3LID A;  1PP9 D;  1SQB J;  1RF1 B;  3RK3 C;  1X8Y A;  5KKZ B;  1PPJ E;  2OYI B;  4D6T D;  5APY A;  1H89 A;  4H44 C;  3KZI H;  1NTM K;  1H0T B;  1SQV E;  1VF5 D;  2JR8 A;  2M3E A;  5B5E H;  2FY8 A;  1ZME C;  4PJ0 E;  1LT9 B;  3OA7 A;  5M1B A;  3ABV C;  5AW0 B;  5CCG A;  1FDM A;  1CZQ A;  3H1I G;  1YTZ T;  2LXC B;  2Q3E A;  3V6I A;  1RE3 A;  1SQX D;  2OGU A;  1JEK A;  3KYQ A;  2WIT A;  2P2U A;  3L70 D;  1AV1 A;  1SP4 A;  4JYC A;  3G9R A;  3Q5R A;  1FOS F;  5K5G B;  1NU1 K;  4BRY B;  1SQP K;  2FYN C;  1LTJ C;  5GTI H;  5AW2 B;  3RL0 B;  1VF5 C;  1BCC J;  3IFM A;  1EDI A;  3L73 G;  1VQK P;  3S4R A;  1L4A A;  1FZC A;  1RE4 A;  4PD4 I;  3C8V A;  4EOT A;  4DT0 A;  2HPC A;  2WQY C;  5APX A;  1KB9 I;  1IFP A;  4W7Z A;  4L76 A;  3A2A A;  5GTI E;  1SS1 A;  2JO1 A;  1DD3 A;  1L0N D;  2FFD C;  2MJZ A;  3KHU A;  3H1H J;  2FYU E;  2ZVO B;  5AVY B;  5AW3 B;  3HUS C;  4BXL A;  3E7K A;  3HE5 B;  2P67 A;  2HYN A;  1GZL A;  2WPQ A;  4PD4 E;  4KJM A;  1J1D C;  1KB9 E;  4UB8 H;  2ZVN B;  1FOS E;  1NTK D;  2P10 A;  1N73 A;  1SFC B;  1YJ9 P;  1IFI A;  1CI6 B;  1KV4 A;  1Q7Y Q;  3VMY A;  2HR3 A;  1NTZ K;  3AED C;  4N78 D;  1OW6 A;  1BE3 D;  2KK7 A;  1GL2 C;  1HUC A;  3WU2 H;  2NPS A;  4UB8 E;  3L73 J;  1MZ9 A;  3FX0 A;  3T97 B;  3L75 D;  3Q3D A;  1KN7 A;  1YBK A;  2M0B A;  1VQL P;  2JWD A;  1KQS O;  1M7L A;  1K8A Q;  4HYT B;  4N6J A;  3JCU E;  1E5W A;  1MFT A;  2A06 E;  2POH A;  3WU2 E;  3SFE C;  1ZR2 A;  2W83 C;  4U3F G;  1SQQ G;  2JDI H;  2SPZ A;  3VOP A;  1VQ6 P;  5KLI C;  3CXH H;  1SQP E;  1AVY A;  2ZYG A;  3UIA A;  1RY3 A;  2AEJ A;  1KZU B;  2BCC D;  4I6M C;  1ZRT D;  2Q7C A;  3A0B E;  2E75 D;  2KS1 B;  4HH2 A;  5CCG D;  2GUS A;  1RQU A;  5AVW B;  3B5N A;  1M90 Q;  3CXH E;  4L73 A;  2K88 A;  1RF1 A;  1P84 D;  2OYI A;  1BGY G;  3B71 A;  3AE4 C;  1NTM G;  3FWL A;  1IJD B;  3I55 P;  1H0T A;  2YMY A;  1KQL A;  3A0H H;  2BAS A;  2Q1K A;  5EFW B;  2M8R A;  1NGM B;  1VQ8 P;  3CWB E;  1U7J A;  3H1J G;  3FWN A;  3TF5 A;  1LT9 A;  1VPC A;  1FJP A;  3WMM 0;  1T3U A;  3QWO C;  4KT0 J;  3CCE P;  5KJ7 D;  3M9Q A;  3Q1M A;  1NWQ A;  3V2N A;  1L4A D;  4YPC A;  5KLV E;  2R3C A;  5CCG C;  1VQ4 P;  2YKQ A;  3A0H E;  1N86 A;  1NTZ E;  1E79 H;  5C39 A;  1IFJ A;  1VQ5 P;  1NU1 G;  3GHG B;  4ZNC A;  1JO5 A;  4BRY A;  2O3J A;  2Q9I A;  3M91 A;  1FS0 E;  2A45 I;  3L74 E;  2M3B A;  1PP9 G;  3AE7 C;  3N4X A;  3O8Z A;  1DIP A;  3V2P A;  1S9K E;  1PIX A;  2PAJ A;  2QJK C;  2ZJS E;  4H0L B;  2V4H A;  1BGY J;  3VYI A;  1VDF A;  1NTM J;  3P8C E;  2J5U A;  1VQO P;  3VN0 A;  4C7N B;  3I5C A;  1FAV A;  5KJ7 C;  1FZF A;  1FBM A;  5BVZ A;  2R32 A;  1M1J B;  1OVU A;  3H1J J;  4DJG A;  1YJW P;  1SQB E;  3I56 P;  5AW4 B;  4I7Z C;  3U1C A;  1PGQ A;  1JY2 N;  2AEM A;  1JB0 J;  2YKP A;  1SQX G;  1LWU C;  2NPS D;  2RH0 A;  3HE5 A;  2ZXX A;  1GDT A;  3L70 G;  2IZ1 A;  1USE A;  1ZR4 A;  3D6Z A;  1KYO H;  5E79 H;  1NKZ B;  3TGU E;  3MP7 B;  1PZQ A;  1NU1 J;  1URQ B;  1SFC A;  1SQP J;  4TLF A;  2WTY A;  1T2K C;  2M5A B;  1CI6 A;  3R4Y A;  1PP9 J;  2KYV A;  2W6B A;  3TNU B;  2H43 A;  3G6E P;  1KIL E;  4D6T J;  3AEC C;  1ZOY C;  1GU5 A;  3SWY A;  4CPG A;  4WY4 C;  1NH4 A;  1A02 F;  4LC1 A;  1DD4 A;  4ZKU A;  3T97 A;  1JTH B;  4LGD E;  1L2P A;  4GKG A;  3L37 A;  3MUD A;  4L74 A;  1L0N G;  3AE2 C;  4ZKP A;  1AQ5 A;  1Q2N A;  1BCC E;  3B5N D;  1LTG C;  3BCC D;  1JUN A;  3CWB J;  1FZE A;  3FXE A;  1AJY A;  1NTK G;  2I1K A;  5APT A;  4XFJ A;  2QIW A;  3HD7 B;  4GOE A;  2I1J A;  2P1J A;  5APS A;  3H1H E;  2LR2 A;  2KZI A;  3M9B A;  3HTK B;  3RK2 C;  3H1I E;  5B66 H;  3ZDM A;  4IL6 E;  2KS1 A;  1NTZ J;  2IBZ D;  1BE3 G;  1J1E C;  3U1A A;  1FE6 A;  3V5B A;  2IYO A;  1G2C B;  3K5B A;  3L75 G;  1SQQ K;  2FYZ A;  3L74 J;  3HRN A;  3CI9 A;  1IZN B;  1OX3 A;  3B5N C;  5AVR B;  3D6Y A;  1YHQ P;  5DJU B;  2IFN A;  2QM8 A;  2YNY A;  1JY3 N;  1RF1 C;  2G3A A;  3CME P;  5KKZ C;  1NO4 A;  1FDO A;  3L73 E;  5AVX B;  1CSB A;  3B4S A;  3RL0 D;  2C0X A;  3BRT B;  3V2Q A;  3CCR P;  1OWA A;  4B86 A;  1LT9 C;  2Z4E A;  2BCC G;  5AVV B;  5CCH C;  3OAK A;  3EWK A;  1ZN5 A;  2R3S A;  3CPW O;  1Y9B A;  3RGU A;  1YI2 P;  2K37 A;  2N1T B;  3SSU A;  1T3J A;  1VQN P;  2RMZ A;  2QJY B;  2IX7 C;  5CJ4 A;  3GHG A;  3W68 A;  4HJG H;  2H88 C;  4IOI H;  2R44 A;  3TGU J;  1YYC A;  3QH9 A;  2G8Y A;  4OGQ B;  2W6J H;  3P8M C;  3L75 J;  1FZG A;  3CX5 I;  2ZXE B;  1PV3 A;  3RBX A;  3KDP B;  2XNX A;  4IFF A;  3RBZ A;  3G4S P;  1OVR A;  3G71 P;  4C7N A;  4H44 B;  3NFQ A;  2KB7 P;  3H1K D;  1LT1 A;  1EC5 A;  1M1J A;  1BSN A;  1YJN P;  4R4L A;  1WMK A;  3VTP C;  2KUB A;  2Z5H A;  1X22 A;  3OJA B;  3L72 D;  2Z5I A;  4UB6 H;  2FKW B;  4RO0 A;  1LP1 B;  4Z1M H;  1PGJ A;  2BCC J;  3C9I A;  2XZR A;  1BDC A;  1GMJ A;  4YXW H;  1Z56 A;  2HOD B;  4JPZ B;  4DZO A;  2QG4 A;  5KLV D;  4PD4 H;  1W5C E;  3F5H A;  1KOR A;  3CCV P;  1NJI Q;  5AW7 B;  1URQ A;  1KB9 H;  4U3F E;  1D7M A;  1SQQ E;  4TT3 H;  1L0L D;  2M5A A;  1S5L E;  4UB6 E;  2OAR A;  5AVS B;  1LTJ B;  4AQR D;  3TNU A;  3TSI A;  3L71 D;  3H1I J;  3WUU A;  1SQX K;  3TYY A;  1UII A;  2IBZ I;  1JTH A;  3MD0 A;  1EQ7 A;  5AVQ B;  1A02 J;  2Y0D A;  1HTL C;  4GIF A;  3M0D A;  1FZA A;  5AW5 B;  3CCS P;  1QLE D;  2KLV A;  1Q82 Q;  1LTS C;  1PL5 A;  1BGY E;  3GF7 A;  1W2E A;  1NTM E;  3JCU H;  3RK3 E;  1NYH A;  2IFM A;  2N9B A;  3HUS B;  4K35 A;  3H1J E;  1VQ7 P;  2KLU A;  2PP6 A;  1W2B O;  3V2R A;  3HD7 A;  1J1D B;  3HTK A;  5GTH H;  2YXR B;  1YIJ P;  5TIS H;  1WT6 A;  2CPS A;  2VRS A;  1L0N K;  2KNC B;  3A0B H;  1XTG B;  1DX7 A;  3CCU P;  2E76 B;  3KQG A;  1IFN A;  4GOD A;  1G2C A;  1GK4 A;  1NU1 E;  1QGK B;  1YQ4 C;  2QSI A;  2K9Y A;  3CCM P;  1S72 P;  1GL2 B;  3H1L D;  2C9L Y;  1NTK K;  1G1J A;  1PP9 E;  1KYO D;  5GTH E;  5TIS E;  1GW3 A;  4D6T E;  2PFX A;  1FZB A;  3BCC G;  2GUV A;  2Y0E A;  1NAY A;  1HVV A;  1S1C X;  4NPD A;  4Y28 J;  3VP9 A;  4H0L D;  1G1I A;  2J58 A;  3LW5 J;  1MKM A;  1EZV D;  2N1T A;  2FXM A;  2IBZ G;  3H1H D;  3FGA D;  1K04 A;  1MV8 A;  5DJT B;  2ZYA A;  4U3F J;  2K1A A;  1SQQ J;  4H13 B;  2D2C B;  1Y47 A;  3KXD A;  2E75 C;  2DW3 A;  1KIL B;  3MGN A;  3IF4 A;  4M3L A;  5KAI H;  1ZP0 C;  1URQ D;  3HE4 B;  5AVZ B;  1VQ9 P;  3A5T A;  1RE3 C;  2R5B A;  2BEZ F;  4H0L C;  2O01 N;  4BWN A;  2O1J A;  2OTL P;  2E5Y A;  2A45 H;  2WPS A;  1LP1 A;  1M1J C;  3W67 A;  1L0N E;  2W27 A;  5KAI E;  4JF7 A;  3A3Y B;  4N3Y B;  2WPV B;  3R2P A;  2HOD A;  3USS A;  1JY2 O;  4EDF A;  3V4W A;  1PPJ D;  2XDJ A;  2KI7 B;  1LTT C;  1TU3 F;  2PGD A;  1K05 A;  2Q3I A;  3TDK A;  2IDB A;  2Y0C A;  1N2D C;  1L4A C;  1SQV D;  1FZC C;  1RE4 C;  1RF0 A;  1LTJ A;  2CPB A;  4EYY Q;  3EFF K;  1ZXG A;  2WSF J;  1N7S B;  1JCC A;  1IC2 A;  1RHZ B;  1LJ2 A;  2QJK B;  1H88 A;  3HD7 D;  4W80 A;  2YO2 A;  2ZT9 B;  1Q90 D;  4Y99 C;  4N78 E;  1BE3 E;  2IYP A;  3H1K G;  2B87 B;  3GF3 A;  2K9J B;  2Q5U A;  1N8R Q;  1CW5 A;  3L75 E;  3MHV A;  3L72 G;  3L35 A;  1LTA C;  5CHX A;  5APV A;  1N73 C;  1HH0 A;  1S4X A;  3GLM A;  3AE6 C;  1JOC A;  1RQV A;  1USD A;  2OYH B;  1LWU B;  1X79 B;  2RN0 A;  3HUS A;  1M57 D;  5KLV G;  4XA4 A;  3FXD A;  5APW A;  1L0L G;  4PV1 D;  2NPS C;  3MIW A;  2J59 M;  1SQV K;  1P84 I;  1P84 H;  1VL2 A;  3L71 G;  2BCC E;  2E5T A;  2XU6 A;  2KNC A;  2R5D A;  3GW6 A;  3HD7 C;  3VMX A;  2P7J A;  1ZRT E;  4IL6 H;  1SQX J;  1ZV8 A;  2OYO A;  1FU1 A;  2FYU D;  2N9Y B;  2QJP C;  3L70 J;  1GL2 A;  3L36 A;  4WY4 B;  3MZW B;  3Q2Y A;  4PD4 D;  2OTJ P;  1OW7 A;  2XKM A;  1Q86 Q;  1P84 E;  1WRG A;  1LTI C;  1KB9 D;  5AVT B;  4GOF A;  2NZ2 A;  1HF9 A;  1IO4 A;  1QVF O;  1IFD A;  2YIU B;  1IFM A;  2O01 J;  3P32 A;  3WUV A;  1GK6 A;  4HB1 A;  2QE7 H;  4PV1 C;  1KMI Z;  5AW8 B;  2V7Q J;  1JY3 O;  1NAF A;  3PHL A;  5BU5 A;  1OXZ A;  2AXC A;  4I2L C;  1LGH B;  3AE3 C;  1KC8 Q;  1KQG B;  2B89 A;  2QRX A;  4H44 D;  1L0N J;  2WWW A;  3IR9 A;  3RK2 B;  4IFM A;  5L8R J;  3Q5P A;  2OYI C;  2AXT H;  4JQ0 D;  2H8P D;  1MFZ A;  2E74 B;  3VP8 A;  2PRR A;  2FYU K;  2QJY C;  4I1L A;  3H1L G;  3TK1 A;  2A06 D;  2XND H;  3H25 A;  1NTK J;  1VQM P;  2WSS H;  3M0A A;  1KD1 Q;  1KIL A;  1SQP D;  1OMI A;  3HE4 A;  2AXT E;  3CCJ P;  2FXP A;  1DH3 A;  1HWT C;  1X9V A;  1S2E A;  1XTC C;  2WPR A;  1BCC G;  1BE3 J;  1NHL A;  2YXQ B;  3GG2 A;  1EDL A;  3D70 A;  3H32 B;  2W6A A;  3O6Q B;  3LW5 H;  1EXJ A;  1EZV G;  3CX5 H;  3CXH D;  3RK3 B;  3NTN A;  2IPP A;  1IK7 A;  1SFC D;  3H1H G;  3RL0 C;  1J2J B;  1OZH A;  1JY2 P;  2UWJ E;  1M8O B;  2WMM A;  3CWB D;  3KZI E;  1N7L A;  4NPF X;  1UIX A;  1S5L H;  3SWF A;  1R5S A;  3CX5 E;  3H1L J;  1U7M A;  4RKU J;  2C0W A;  1N7S A;  3M9H A;  5B5E E;  1NOH A;  1RF0 C;  5CBN A;  3A7O A;  3RL0 g;  2HLO A;  4K3A A;  2B9B A;  2B87 A;  1H8A A;  1NTZ D;  2K9J A;  5KJ7 A;  1MUU A;  4NPE A;  1BSH A;  2IZ0 A;  1YQ3 C;  2WVR A;  4DOJ A;  4EI2 A;  2FYN B;  2OTK E;  2E43 A;  2E76 D;  3S1K A;  1X0T A;  3ITK A;  1SFC C;  2W8Z A;  1JNM A;  3L74 D;  4EIJ A;  1HGZ A;  2OYH A;  1LWU A;  1GL2 D;  3P7K A;  1PPJ G;  1VF5 B;  1S9K D;  2JP3 A;  3BCC E;  2H7H A;  3AE8 C;  1PGO A;  3CC2 P;  3CLQ A;  1PGP A;  1PFI A;  2RKL A;  3P8C D;  1SQV G;  2KSE A;  4AYC A;  4JYB A;  1EDK A;  3SFD C;  4YTP C;  2WSF H;  1ZW0 A;  3E1I A;  2JEE A;  1SQB D;  3MUD C;  2FFD B;  2QVA A;  2WSE J;  1OVV A;  3BVH A;  3GMA A;  1HJ0 A;  1AQT A;  3SWK A;  1AFO A;  3MTU E;  3G3Z A;  2IBZ E;  4RJT A;  3AEB C;  1JCD A;  1NKN A;  2AEF A;  5KLV K;  2WSC J;  4WY4 A;  1OFC X;  3EQ2 A;  2E76 C;  2WT7 B;  1L0L K;  3AE9 C;  2ZYD A;  3TGU D;  1KQF B;  4KHX A;  2WZ7 A;  1FDI A;  2LKM A;  2KP8 A;  1U57 A;  1HBW A;  4H13 D;  2D2C D;  1KIL D;  1JY3 P;  3IAO A;  1SQV J;  3OW2 O;  2ITA A;  1GW4 A;  1ZLL A;  1KFM A;  3U59 A;  3NMD A;  5AVU B;  3CXH I;  5H2F H;  1SQB K;  1OIP A;  5AW6 B;  3CC7 P;  5KAF H;  1AA0 A;  2FYU G;  2L91 A;  2JWA A;  1LTB C;  1BCC D;  1EDJ A;  2KOG A;  3M06 A;  1T6A A;  4AUW A;  5KLI B;  4OVN F;  3S9O A;  3LIE A;  4H13 C;  2D2C C;  5H2F E;  4U7J A;  1SQX E;  2ZFC A;  2KZJ A;  2O01 H;  5KAF E; 
#chains in the Genus database with same CATH homology
 4NPF X;  2B89 A;  2QRX A;  4GOD A;  2KS1 B;  4KJM A;  1Q2N A;  1U7M A;  2M5A A;  1JM0 A;  2K3R A;  5CBN A;  3RGU A;  3FXD A;  2LXC B;  1OVU A;  3FXE A;  1LP1 A;  4HJG H;  4K3A A;  4ZMD A;  2HR3 A;  2B87 A;  1BDD A;  4IOI H;  4WWI A;  2R44 A;  4GOE A;  4NPE A;  2P58 A;  1H0T A;  1FC2 C;  2LR2 A;  2Q1K A;  5EFW B;  4HKZ H;  2KZI A;  5K5G B;  1JMB A;  2KI7 B;  1U7J A;  2B88 A;  2OTK E;  3S1K A;  4NPD A;  1X0T A;  3ZDM A;  3QWO C;  4MN4 C;  2M0B A;  1OVR A;  1NVO A;  3MZW B;  1EDL A;  2JWD A;  5CBO A;  4EYY Q;  1DEE G;  2ZAE B;  1ZXG A;  1EDI A;  1LT1 A;  2M5A B;  1EC5 A;  1EDJ A;  2RKL A;  2LXB A;  4ASW A;  4GOF A;  2I8D A;  1MFT A;  2KUB A;  4K35 A;  5C39 A;  1EDK A;  4JBZ A;  5DJT B;  5DJU B;  2KIK A;  2SPZ A;  1ZW0 A;  1S3J A;  1LP1 B;  4ZNC A;  1SS1 A;  2B87 B;  4HB1 A;  4CPG A;  2QVA A;  3PH0 A;  1BDC A;  4ASV A;  1OVV A;  1Y47 A;  3MHV A;  1H0T B;  2UWJ E;  2KZJ A;  2WMM A;  4BXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...