2RLQA

Nmr structure of ccp modules 2-3 of complement factor h
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
123
structure length
123
Chain Sequence
PCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement factor H
publication title Structure of the N-terminal region of complement factor H and conformational implications of disease-linked sequence variations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2007-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2rlqA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2rlqA02
3RJ3D 5I0QB 2KMSA 4MUCA 2XWBF 4YNXA 1MD8A 2O39C 2YRAA 2RKYA 3MQLA 1OK9A 1VVCA 2JGWA 2YBYA 2RKZA 5HYTB 3OXUD 1ZJKA 1H2QP 2IZ4A 1OJVA 1UOTP 3O8EB 1Z92B 1GHQB 1FBRA 4A5WB 5HYUB 3EJHA 3ERBA 5HZPB 2XWJI 4C16A 2KRIA 1OK3A 3SW0X 2A55A 3ZRZA 1HFHA 1SS2A 4JHSA 3ZD2A 2BZMA 1OJWA 1H2PP 2QY0A 1LY2A 2LOJA 2XQWC 1G4FA 1GPZA 1H03P 1OK1A 1E88A 4FXGG 4LOSA 2EHFA 2W81A 2RLQA 1E8BA 1VVDA 2XRDA 2CKUA 2CG7A 2W80A 1QUBA 5FO8C 4K12A 2XRBA 3R62A 1C1ZA 3CALA 3GOVA 4AYMA 4J38B 4B2SA 4IGDA 1GKNA 3L89M 2WIIC 2RL0A 2ERJA 3OP8A 3TVJA 1HCCA 1Q3XA 1PPQA 3IX0A 4DJZA 2B5ID 1O9AA 3M7PA 1OJYA 1SRZA 1G4GA 4ONTD 5HYPA 1TPMA 4AYEA 2JRAA 1QO6A 3ZD1A 1ELVA 1QGBA 2JGXA 3KXVA 1TPNA 1GKGA 1U5MA 2RLPA 4B2RA 2MCZA 3IU3I 4AYIA 1CKLA 1OK2A 2EC3A 1HFIA 4CSYA 1E5GA 1TPGA 4ZH1D 3NFPI 4AYDA 5JPMG 2CG6A 3T5OA 2UWNA 3KZJA 4KKDA 4WJG2 2MCYA 4F4OC 1NWVA 4LOTA 1MD7A 3GXEA 2IZ3A 4PZ5A 2G7IA 3INBC 3OEDC 1H04P 2V8EA
chains in the Genus database with same CATH superfamily
3RJ3D 4APLA 5I0QB 4MSLA 2KMSA 4MUCA 2XWBF 4YNXA 3WSXA 1MD8A 2O39C 2YRAA 5DN4A 2RKYA 3MQLA 1OK9A 1VVCA 2JGWA 2YBYA 2RKZA 2ZYCA 5HYTB 3OXUD 1ZJKA 1H2QP 4BWCA 2IZ4A 3VWOA 1OJVA 1UOTP 3O8EB 1Z92B 1GHQB 1FBRA 4A5WB 5HYUB 3EJHA 3ERBA 2Y8SA 5HZPB 2XWJI 4C16A 2KRIA 1OK3A 3SW0X 2A55A 4PO7A 3ZRZA 3FGTA 1HFHA 1SS2A 4JHSA 3ZD2A 4YIZA 2BZMA 1OJWA 3ZLDA 1H2PP 2QY0A 3K3TA 1LY2A 2LOJA 2XQWC 1G4FA 1GPZA 1H03P 1OK1A 3NJAA 5DN5A 1E88A 4FXGG 4LOSA 2EHFA 2W81A 2RLQA 1E8BA 1VVDA 2XRDA 2CKUA 3F6KA 2Y8TA 2CG7A 2W80A 2Y8RA 1QUBA 5FO8C 3ZLEA 4K12A 2XRBA 1RLHA 3R62A 1C1ZA 3CALA 3GOVA 4AYMA 4N7EA 4J38B 4B2SA 4IGDA 1GKNA 3L89M 2WIIC 2RL0A 2ERJA 3OP8A 3TVJA 1HCCA 1Q3XA 1PPQA 3IX0A 4DJZA 2B5ID 1O9AA 3M7PA 1OJYA 1SRZA 1G4GA 4ONTD 5HYPA 1TPMA 4AYEA 2JRAA 1QO6A 3ZD1A 1ELVA 1QGBA 2JGXA 3KXVA 1TPNA 1GKGA 1U5MA 2I2LA 2RLPA 4B2RA 2MCZA 3IU3I 4AYIA 1CKLA 1OK2A 3WSYA 2EC3A 1HFIA 4CSYA 1E5GA 1TPGA 3FGRA 4ZH1D 2X2ZA 3NFPI 4AYDA 5JPMG 2CG6A 3T5OA 2UWNA 3KZJA 4KKDA 4WJG2 3CI0J 2MCYA 4F4OC 1NWVA 4LOTA 1MD7A 3GXEA 2IZ3A 4PZ5A 2G7IA 3INBC 3OEDC 1H04P 2V8EA
chains in the Genus database with same CATH topology
3RJ3D 5I0QB 2KMSA 4MUCA 2XWBF 4YNXA 1MD8A 2O39C 2YRAA 2RKYA 3MQLA 1OK9A 1VVCA 2JGWA 2YBYA 2RKZA 5HYTB 3OXUD 1ZJKA 1H2QP 2IZ4A 1OJVA 1UOTP 3O8EB 1Z92B 1GHQB 1FBRA 4A5WB 5HYUB 3EJHA 3ERBA 5HZPB 2XWJI 4C16A 2KRIA 1OK3A 3SW0X 2A55A 3ZRZA 1HFHA 1SS2A 4JHSA 3ZD2A 2BZMA 1OJWA 1H2PP 2QY0A 1LY2A 2LOJA 2XQWC 1G4FA 1GPZA 1H03P 1OK1A 1E88A 4FXGG 4LOSA 2EHFA 2W81A 2RLQA 1E8BA 1VVDA 2XRDA 2CKUA 2CG7A 2W80A 1QUBA 5FO8C 4K12A 2XRBA 3R62A 1C1ZA 3CALA 3GOVA 4AYMA 4J38B 4B2SA 4IGDA 1GKNA 3L89M 2WIIC 2RL0A 2ERJA 3OP8A 3TVJA 1HCCA 1Q3XA 1PPQA 3IX0A 4DJZA 2B5ID 1O9AA 3M7PA 1OJYA 1SRZA 1G4GA 4ONTD 5HYPA 1TPMA 4AYEA 2JRAA 1QO6A 3ZD1A 1ELVA 1QGBA 2JGXA 3KXVA 1TPNA 1GKGA 1U5MA 2RLPA 4B2RA 2MCZA 3IU3I 4AYIA 1CKLA 1OK2A 2EC3A 1HFIA 4CSYA 1E5GA 1TPGA 4ZH1D 3NFPI 4AYDA 5JPMG 2CG6A 3T5OA 2UWNA 3KZJA 4KKDA 4WJG2 2MCYA 4F4OC 1NWVA 4LOTA 1MD7A 3GXEA 2IZ3A 4PZ5A 2G7IA 3INBC 3OEDC 1H04P 2V8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RJ3 D;  5I0Q B;  2KMS A;  4MUC A;  2XWB F;  4YNX A;  1MD8 A;  2O39 C;  2YRA A;  2RKY A;  3MQL A;  1OK9 A;  1VVC A;  2JGW A;  2YBY A;  2RKZ A;  5HYT B;  3OXU D;  1ZJK A;  1H2Q P;  2IZ4 A;  1OJV A;  1UOT P;  3O8E B;  1Z92 B;  1GHQ B;  1FBR A;  4A5W B;  5HYU B;  3EJH A;  3ERB A;  5HZP B;  2XWJ I;  4C16 A;  2KRI A;  1OK3 A;  3SW0 X;  2A55 A;  3ZRZ A;  1HFH A;  1SS2 A;  4JHS A;  3ZD2 A;  2BZM A;  1OJW A;  1H2P P;  2QY0 A;  1LY2 A;  2LOJ A;  2XQW C;  1G4F A;  1GPZ A;  1H03 P;  1OK1 A;  1E88 A;  4FXG G;  4LOS A;  2EHF A;  2W81 A;  2RLQ A;  1E8B A;  1VVD A;  2XRD A;  2CKU A;  2CG7 A;  2W80 A;  1QUB A;  5FO8 C;  4K12 A;  2XRB A;  3R62 A;  1C1Z A;  3CAL A;  3GOV A;  4AYM A;  4J38 B;  4B2S A;  4IGD A;  1GKN A;  3L89 M;  2WII C;  2RL0 A;  2ERJ A;  3OP8 A;  3TVJ A;  1HCC A;  1Q3X A;  1PPQ A;  3IX0 A;  4DJZ A;  2B5I D;  1O9A A;  3M7P A;  1OJY A;  1SRZ A;  1G4G A;  4ONT D;  5HYP A;  1TPM A;  4AYE A;  2JRA A;  1QO6 A;  3ZD1 A;  1ELV A;  1QGB A;  2JGX A;  3KXV A;  1TPN A;  1GKG A;  1U5M A;  2RLP A;  4B2R A;  2MCZ A;  3IU3 I;  4AYI A;  1CKL A;  1OK2 A;  2EC3 A;  1HFI A;  4CSY A;  1E5G A;  1TPG A;  4ZH1 D;  3NFP I;  4AYD A;  5JPM G;  2CG6 A;  3T5O A;  2UWN A;  3KZJ A;  4KKD A;  4WJG 2;  2MCY A;  4F4O C;  1NWV A;  4LOT A;  1MD7 A;  3GXE A;  2IZ3 A;  4PZ5 A;  2G7I A;  3INB C;  3OED C;  1H04 P;  2V8E A; 
#chains in the Genus database with same CATH topology
 3RJ3 D;  4APL A;  5I0Q B;  4MSL A;  2KMS A;  4MUC A;  2XWB F;  4YNX A;  3WSX A;  1MD8 A;  2O39 C;  2YRA A;  5DN4 A;  2RKY A;  3MQL A;  1OK9 A;  1VVC A;  2JGW A;  2YBY A;  2RKZ A;  2ZYC A;  5HYT B;  3OXU D;  1ZJK A;  1H2Q P;  4BWC A;  2IZ4 A;  3VWO A;  1OJV A;  1UOT P;  3O8E B;  1Z92 B;  1GHQ B;  1FBR A;  4A5W B;  5HYU B;  3EJH A;  3ERB A;  2Y8S A;  5HZP B;  2XWJ I;  4C16 A;  2KRI A;  1OK3 A;  3SW0 X;  2A55 A;  4PO7 A;  3ZRZ A;  3FGT A;  1HFH A;  1SS2 A;  4JHS A;  3ZD2 A;  4YIZ A;  2BZM A;  1OJW A;  3ZLD A;  1H2P P;  2QY0 A;  3K3T A;  1LY2 A;  2LOJ A;  2XQW C;  1G4F A;  1GPZ A;  1H03 P;  1OK1 A;  3NJA A;  5DN5 A;  1E88 A;  4FXG G;  4LOS A;  2EHF A;  2W81 A;  2RLQ A;  1E8B A;  1VVD A;  2XRD A;  2CKU A;  3F6K A;  2Y8T A;  2CG7 A;  2W80 A;  2Y8R A;  1QUB A;  5FO8 C;  3ZLE A;  4K12 A;  2XRB A;  1RLH A;  3R62 A;  1C1Z A;  3CAL A;  3GOV A;  4AYM A;  4N7E A;  4J38 B;  4B2S A;  4IGD A;  1GKN A;  3L89 M;  2WII C;  2RL0 A;  2ERJ A;  3OP8 A;  3TVJ A;  1HCC A;  1Q3X A;  1PPQ A;  3IX0 A;  4DJZ A;  2B5I D;  1O9A A;  3M7P A;  1OJY A;  1SRZ A;  1G4G A;  4ONT D;  5HYP A;  1TPM A;  4AYE A;  2JRA A;  1QO6 A;  3ZD1 A;  1ELV A;  1QGB A;  2JGX A;  3KXV A;  1TPN A;  1GKG A;  1U5M A;  2I2L A;  2RLP A;  4B2R A;  2MCZ A;  3IU3 I;  4AYI A;  1CKL A;  1OK2 A;  3WSY A;  2EC3 A;  1HFI A;  4CSY A;  1E5G A;  1TPG A;  3FGR A;  4ZH1 D;  2X2Z A;  3NFP I;  4AYD A;  5JPM G;  2CG6 A;  3T5O A;  2UWN A;  3KZJ A;  4KKD A;  4WJG 2;  3CI0 J;  2MCY A;  4F4O C;  1NWV A;  4LOT A;  1MD7 A;  3GXE A;  2IZ3 A;  4PZ5 A;  2G7I A;  3INB C;  3OED C;  1H04 P;  2V8E A; 
#chains in the Genus database with same CATH homology
 3RJ3 D;  5I0Q B;  2KMS A;  4MUC A;  2XWB F;  4YNX A;  1MD8 A;  2O39 C;  2YRA A;  2RKY A;  3MQL A;  1OK9 A;  1VVC A;  2JGW A;  2YBY A;  2RKZ A;  5HYT B;  3OXU D;  1ZJK A;  1H2Q P;  2IZ4 A;  1OJV A;  1UOT P;  3O8E B;  1Z92 B;  1GHQ B;  1FBR A;  4A5W B;  5HYU B;  3EJH A;  3ERB A;  5HZP B;  2XWJ I;  4C16 A;  2KRI A;  1OK3 A;  3SW0 X;  2A55 A;  3ZRZ A;  1HFH A;  1SS2 A;  4JHS A;  3ZD2 A;  2BZM A;  1OJW A;  1H2P P;  2QY0 A;  1LY2 A;  2LOJ A;  2XQW C;  1G4F A;  1GPZ A;  1H03 P;  1OK1 A;  1E88 A;  4FXG G;  4LOS A;  2EHF A;  2W81 A;  2RLQ A;  1E8B A;  1VVD A;  2XRD A;  2CKU A;  2CG7 A;  2W80 A;  1QUB A;  5FO8 C;  4K12 A;  2XRB A;  3R62 A;  1C1Z A;  3CAL A;  3GOV A;  4AYM A;  4J38 B;  4B2S A;  4IGD A;  1GKN A;  3L89 M;  2WII C;  2RL0 A;  2ERJ A;  3OP8 A;  3TVJ A;  1HCC A;  1Q3X A;  1PPQ A;  3IX0 A;  4DJZ A;  2B5I D;  1O9A A;  3M7P A;  1OJY A;  1SRZ A;  1G4G A;  4ONT D;  5HYP A;  1TPM A;  4AYE A;  2JRA A;  1QO6 A;  3ZD1 A;  1ELV A;  1QGB A;  2JGX A;  3KXV A;  1TPN A;  1GKG A;  1U5M A;  2RLP A;  4B2R A;  2MCZ A;  3IU3 I;  4AYI A;  1CKL A;  1OK2 A;  2EC3 A;  1HFI A;  4CSY A;  1E5G A;  1TPG A;  4ZH1 D;  3NFP I;  4AYD A;  5JPM G;  2CG6 A;  3T5O A;  2UWN A;  3KZJ A;  4KKD A;  4WJG 2;  2MCY A;  4F4O C;  1NWV A;  4LOT A;  1MD7 A;  3GXE A;  2IZ3 A;  4PZ5 A;  2G7I A;  3INB C;  3OED C;  1H04 P;  2V8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...