2RMLA

Solution structure of the n-terminal soluble domains of bacillus subtilis copa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
147
structure length
147
Chain Sequence
b'MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETSNVIYDPAETGTAAIQEKIEKLGYHVVTEKAEFDIEGMTCAACANRIEKRLNKIEGVANAPVNFALETVTVEYNPKEASVSDLKEAVDKLGYKLKLKGEQDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting P-type ATPase copA
publication title Structure and Cu(I)-binding properties of the N-terminal soluble domains of Bacillus subtilis CopA
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 42
structure length 147
sequence length 147
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rmlA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rmlA01
2W4CA 2XMWA 1MWZA 5KAKA 1AW0A 1U7LA 1APSA 3QMQA 2JDJA 2VV5A 3IWXA 4OJ1A 2QIFA 3HHLD 1N5VA 3VTIA 1OPZA 1SI9A 2XMKA 2XMJA 4Y2MA 2OFGX 1Q8BA 1X0PA 2ACYA 2KYZA 4HI1A 4A46A 1JWWA 4A47A 3HFKA 4Q2MA 1TL4A 4HI2A 2LQBA 3T9NA 1LQ9A 1JK9B 1XBWA 4OIXA 2K1RB 4ZOSA 4YEAA 1FVSA 5F0WA 1K0VA 2LXFA 3BB5A 2OFHX 3KG0A 2GCFA 2IFXA 3CJKA 5T7LA 2OD6A 1YRXA 1CC7A 2BJDA 3DCAA 3GZ7A 4EFAC 3UDCA 5K9FA 1R6YA 1RJJA 2G9OA 2GFFA 4Y2KA 2L3MA 4DL0C 3KNGA 2LDIA 1Q8LA 5A6PA 1FE4A 3BDEA 4QOTA 5B0FA 4FNIA 2GGPB 2N4DA 1P6TA 1GXUA 2BYCA 2RSQA 1OQ6A 2RMLA 3LGNA 4A4JA 1X8DA 1KVIA 2XMTA 1FVQA 2GO8A 4OJHA 2OP5A 5F0UA 3HHLC 5B0EA 3DXSX 3FRYA 3TRGA 1OSDA 2HQIA 2XMVA 1ULRA 2K1RA 1Y0HA 1Q4RA 1GXTA 2OMOA 2QLWA 3LGMA 2AJ1A 1W2IA 1SQEA 2KT2A 2GV1A 2K2PA 4YDXA 2ASYA 1FESA 3HHLB 2HFNA 5B08A 1SB6A 5B09A 2QYCA 1V3ZA 5IXUA 3HDSA 1CPZA 3I9ZA 4A48A 3BN7A 3QGPA 2RILA 2ROGA 2KKHA 1IUJA 1QUPA 1YJTA 1N5QA 2AW0A 1KQKA 1S6UA 2W4DA 2OKQA 3F44A 3FGVA 1KVJA 1YJVA 3WDOA 2GGPA 2QLXA 1VQSA 1FD8A 2ZDPA 2BBEA 1CC8A 2HIQA 2ROEA 2XMMA 1TUVA 2IYGA 4U9RA 4DN9A 2LQ9A 3E8OA 2N4CA 2AJ0A 2BUNA 2HLUA 5A6WA 2BJEA 3HX9A 1YG0A 3LO3A 1X7VA 2N7YA 1OQ3A 2Q3PA 1YJRA 4NPOA 4NL5A 2HFOA 1TL5A 3HF5A 4HH0A 3MCSA 2FB0A 2PD1A 1N5TA 1AFIA 2OD4A 1MWYA 2AP6A 1Y9OA 2ROPA 2RU9A 1YJUA 1TZ0A 2PGCA 5B0AA 2OAUA 3HHLA 1Q53A 2W4PA 3BM7A 1URRA 3K7RA 4FNHA 2CRLA 2KT3A 3IWLA 3KG1A 2FIUA 1Y3KA 3BGUA 4F67A 2XMUA 2K7JA 4HL9A 5B0GA 4DPOA 2IYIA 3MZIA 4Y2IA 2EW9A 3BR8A 1Y3JA 2FTRA 4OJ3A 3TOQA 1TR0A 1AFJA 2GA7A 3KKFA 2ZDOA 3CJKB 1P8GA 5T7LB 4HH1A 2K7KA 1FEEA 2HLTA 2FHMA 3TNVA 1N5SA 5B0CA 1VQYA 1S6OA 2VH7A 5B0BA 3BF4A 4OJGA 4Q2LA 3FMBA 5B0DA 1FE0A 1WD6A 4ZA1A
chains in the Genus database with same CATH superfamily
3PV8A 2IRXA 5HLFA 1SI9A 4GKKJ 1FX4A 4MFBA 4CDIA 1WJ9A 2I5JB 2IPOB 3R5CA 2KG0A 1N56A 4FDFA 5D3GB 1ZETA 3M9OB 3RU0A 4LQ9A 3IFEA 5LMUJ 3JTPA 2EKYA 3NS5A 4F25A 4Q8EA 3BKUA 3KK3B 3D3CJ 1K9MT 3DU6A 3NGTA 2KT2A 2YWEA 2HQFA 2V2KA 2M70A 3R1HA 4Y3CA 3NOGA 2X1BA 1RT2B 5JVGQ 1KKHA 4BDPA 5HP1B 4H54A 3E8OA 2VPZB 3RBDA 3HSDA 4FBTA 1KOHA 5D6GA 4J9PA 1S0OA 3RAMA 3OFHA 4A8WA 5GAGI 3M9NB 3PIPQ 4MYTA 4ED4A 1XC9A 2CWKA 4ZVSB 3TOQA 5BR8F 1WEXA 3HI9A 2G0CA 2P6SA 3Q8QB 1EIYB 4TQSA 1YJ7A 2OMLA 3IP0A 2EFPA 3NL0A 3T5HA 4M95A 2HFUA 2MGZB 1ZS6A 4LJMA 3ONQA 2CWXA 1MNEA 3DRPB 2JSXA 3MM8A 4IDKB 3QIDA 1Q8LA 5JUMA 2RSQA 3NCRA 3JQMA 1DFDA 5KFWA 1N0UA 1ZAVA 2EEYA 2C3UA 4DV2J 3RTVA 1RTZA 3B4MA 1GFWB 3WDOA 3VGSA 3IG1A 4CO2A 2E5LF 2LDYA 2A18A 3N9UC 4RW7A 4OZNA 3H4DA 1ZTTA 2QA4S 4AL6A 2XS5A 3TO8A 3UNYA 1REGX 2R7UA 1TMMA 4CIOA 1S5ZA 3A12A 3H5SA 1WHVA 1S48A 2CQIA 2CPXA 4M5GA 1T9XA 2NXUA 2HLTA 3BZQA 1N5SA 3KHRA 1S6OA 4RW4B 2EFNA 1FE0A 4ZS6A 3AY0A 2VQEJ 4P9SA 2XCAA 4DL7A 3Q8UA 1PGZA 1U8WA 3Q8PB 1Y10A 4DR4J 3A8EA 1DHMA 2KI2A 1GX5A 2Z2MA 4DI6A 3KDOA 1CS4B 1YKWA 2CJXB 4YP3A 3BPSP 2R7TA 3SBMA 4OFZA 3FCHA 3H8YA 4RW9A 2IBOA 4FNIA 4ETZA 4DLGA 4LF8J 1RLDA 4JI6J 2DHHA 1WF0A 2X1FA 2ZM6J 1ZA2B 3ET6A 3CCWA 4QZVB 2OP5A 2MQPA 1NK6A 1U0HA 3CWJA 1GK8A 1VRUB 2ZZNA 1NKCA 5CA5A 4O4GA 3UCZP 2X3DA 3HVRA 2IVFB 2V6AA 2D1CA 4ENOA 1FJGJ 4WFYA 3NRBA 5JMNA 4TNOA 3FBCA 2LXUA 4DDFA 2PD1A 3QATA 4B9NA 2YNHB 1Y7PA 2O1PA 1RTDA 3DOMA 5IV4A 2ZD1B 5KG2A 2K7JA 3S1TA 3MZIA 3NKYA 5AE2A 4DFKA 1P8GA 4CH7A 5HMWA 1TU0B 3QYYA 1ZA1B 4UTGA 1URNA 4KGZB 4YB5A 4EO8A 4RWXA 1U7LA 3NGKA 3MUTP 2GQQA 2V34A 2KXNB 2OPRA 3H7HB 3IM9A 4LIRA 4C4WA 2C3PA 1R0CB 2LXFA 3K58A 4B3TJ 4DX6A 3CW2C 2DYAA 3MPDA 3Q86A 4DPUA 2BYCA 5KT3A 1VQPS 1KS2A 3HFVA 3BO2A 3EZUA 2VA3A 2NR0A 1U1NA 2CQPA 3E01A 2BXJA 4WKRA 2BRKA 3D7SB 2CPEA 3EDQB 3QWPA 2ZKTA 1B7YB 1H73A 4KQZA 4LR7A 4CM0A 2E7WA 3RRGA 2H5IB 4WK1A 1IBKF 2Y9HA 2DH8A 3VAIA 2DXDA 2IYIA 1HBUB 3A3OB 4DL2A 3FBEA 3JYTA 4DFJA 3MAAB 1PBUA 2ZH6A 2ZUGA 2LA6A 4LVNP 5EWGA 1LW0B 4IR9A 2GJFA 3FQLA 3I6PA 1S97A 4RJVA 5A8WA 4IO9Q 2ZVSA 3MMAB 3I56S 4OL8A 4A47A 3L95X 1UPMB 5A8RA 4AT1B 4I7FB 4JI0F 4R0EA 2DBBA 1CC7A 4J9NA 1JXVA 2DXEA 3HSGA 4C48A 4NX9A 3K5OA 2RDIA 4ANDA 4X4QA 3Q8SB 3JSBA 3MECB 8AT1B 2C28A 1SV5B 1TL1A 2K2PA 2G0IA 1KTQA 3UVJB 3IS9A 3W2VB 1DY3A 4IG0A 2RQMA 5I4MA 5A8KA 5DQIA 2MZJA 1NBEB 1UFKA 3PACA 1WHWA 1VK3A 4U96A 4IRDA 1UWBB 2ZBQA 1LWXA 2BACA 2KN4A 4XO0A 3P5BP 1T03A 3PKYA 1RWNB 4O3OA 1WOSA 4ITSA 2RQCA 1OJ4A 4LBPA 1RTJA 4P52A 3ZZ0A 1FA0A 1NM2A 2JL9A 3I87A 1N5YB 1AW0A 2KFNA 4MK7A 4AUKA 3IBWA 2PEBA 1H98A 4M94A 2I1RA 2NYIA 1YSJA 4RBUA 4QU6A 1W25A 5CD4A 4KJIA 5IWAJ 2DR8A 2E1CA 1PJ7A 2FHOB 1K0VA 4IOBA 1F5BA 2MQOA 4NCBA 1HI1A 4IYQA 2VF3A 4MK9A 4OX9F 4DR1F 4NYOA 5LJ5Y 2GO9A 3ILJA 2VPXB 3SQGA 3F56A 1NHKL 3DRRB 3T1HF 2XMVA 2UU9J 4X62J 4Z2XA 1YLXA 4NLSA 1RT7B 5KG6A 2B6AB 3D3BJ 3GIRA 2GGPA 2QA4G 5G4DA 4ZPAA 5LMNJ 4RWWA 4DWIA 4PKDB 3CDAA 2DITA 1HNWJ 3PDNA 1OYEA 5L38A 3J80Y 1IKYB 3WX4A 1HYSA 4OYWA 4RLEA 2IJNA 4DU8A 1TK5A 3ISND 4PCQA 3BGFA 2XO6A 2BKPA 1NH7A 1Q81T 1QVFR 3KXDA 1G3OA 4BWJA 2C2RA 3F73A 2XMKA 4LF9J 3ZZRA 5F9LA 2PE8A 4H4KC 5CH7B 2ZJQQ 2OPQA 2CPHA 2I5JA 1S1VB 4K4SA 1RA6A 1VI7A 3KLEA 2R8JA 3CCZA 3WZ0A 1WKLA 3IR6B 1RHJB 2V4RA 2NZCA 1OY6A 3L7UA 1KQGB 1CJKA 3S8SA 3R2DJ 3BPDA 2KT5A 1HR0J 3VAHA 3I4PA 1TELA 1KNZA 2LECA 3CC7S 4TU7A 2QO3A 3D54A 1S9GA 3LO3A 1T0TV 2J9CA 3DDKA 4K4TA 3NGDA 3OV7A 4J9RA 2ASDA 3L3CA 5CZVA 3EDRB 1F1BB 4ILRA 1TK8A 3GLJA 1GT8A 1F9HA 4JYAF 3POTB 2QYGA 3VHQA 9RUBA 1WOPA 1H0HB 3MPUB 4ES2A 3MXHP 1U2FA 4DF8A 2PI4A 2EBGA 3RW7A 1W26A 2HK3A 2RT3A 1HWIA 4AQYJ 4B3OA 1KWMA 2AX1A 1WEZA 3ZXWA 1UWAA 3CT9A 3DRSA 1VIOA 1OQ6A 2CPYA 3LANA 4BHQA 1RXOB 2YNFA 2QLWA 3G82B 4WU3A 2G2OA 3BKTA 3M7VA 4MT1A 5HK4A 4A48A 1HMVB 1HNZF 1IM6A 4ED7A 1N48A 3OTEA 4USHA 3QJPA 4IFYB 2E9ZA 4FXWA 4X64F 1O51A 4F0KA 1ZZFA 1IKVB 4JV2A 3BBBA 4Y28C 1X7VA 3D66A 2Q3PA 3QFHA 3H5XA 2HFOA 2P8IA 4ZPTR 5IC4B 1CEZA 1TV6B 4UOGA 1TZ0A 3QT8A 2PN6A 2EG2A 2CVIA 2V4QA 2UV8A 3Q83A 2YPZA 5BXIA 3KKFA 3LP0B 5KT7A 3IO1A 3EPIA 4N41A 1QLNA 4LIWA 1APSA 4ETXA 4UZBA 3ZTRA 5EX0A 4FF3A 3DGVA 3QRPA 2EFVA 3W62A 2BEFA 3KLGA 4CNZA 1WC5A 4MMOA 4OI0A 4M5IA 2BOPA 4HLBA 1VYAA 1S12A 2HWIA 3HO1A 3NG8A 4QPXA 3D2WA 2MZ1A 1TAQA 4ZJLA 2ZFHA 1H2VZ 4AXJA 4EBCA 1GMWD 5B09A 1FDNA 4ILLA 2AZ3A 2QJ3A 4DUZF 2W4DA 1KVJA 3CO9A 2DPIA 3VVTA 3UR3C 1S9EA 1Q86T 3ENWA 1OWXA 2WZ1A 4F2SA 2KT3A 3TW0A 2FJEB 2D3ZA 5GMDA 3K8WA 3GMGA 2FHMA 2JVRA 1AXQA 3OVAA 3BYPA 3MM6A 3DDIA 4IUFA 4WF9Q 1ZBTA 4Y0FA 2IFXA 4LF4J 4ZVPB 5M2PA 3H5YA 5IT9U 1PSDA 1PKUA 4X4VA 2HQGA 3FMWA 3CNQP 3M6VA 2KU7A 2XSFA 3X3UA 1ZAXA 4L3NA 3FSYA 1NK0A 1RT5A 3ILLA 3MF5A 2HZCA 3HHLB 2XY7A 2M4MA 4KGKA 5MLCV 1RABB 2UVWA 2UVRA 1FKPB 4TYBA 4V1Ak 2DGSA 2MZQA 4USVA 2W2OP 3QO9A 3OJUA 4DR7F 2XO7A 3I4HX 4WWSA 1SC3B 2PGCA 4ZP7A 5I42B 4LF2A 3M32A 4P71A 4ANCA 1YJWS 1EP4A 2PMZD 3BDPA 2XWYA 2U2FA 3CXCR 3KTQA 2WK4A 3UCGA 3ULHA 4N77A 1M5SA 4FF4A 1BGXT 2JDJA 3N0VA 3VTIA 2C3YA 4M5DA 4P2MA 5F3TA 1X4BA 1F2HA 3W7BA 3CJRA 1SPBP 1HNXF 2JNJA 1PJ5A 4O23A 1FJEB 1V9OA 3DOLB 3ZTSA 4LFAF 1IXKA 1TTHB 4QR2A 2J0XA 2QYCA 3BN7A 3NS7B 2DNPA 3MPYA 2O67A 3JSMB 2H4YB 1MLAA 2IC3B 3MEEA 2DGQA 3CCVS 1H3DA 4ZCMA 4EYIB 1VHFA 2RHQB 1J5EJ 1KQFB 3K17A 2ROPA 1HQEA 3CUNA 2HS4A 4A8MP 3KLHB 1XMQJ 3D6MB 2M8HA 2R4FA 2HNYB 3GB0A 1TKTA 3CCSS 5E3CA 3UFCX 4K0KJ 1RWKB 1DQAA 5LOQA 2CVEA 3MTJA 4ED0A 4K2XA 5DDPC 2YKAA 4B3MF 4TYAA 3W60A 3QJJA 1N5YA 4FN5A 2GJ2A 4B3RF 4PABA 3D9BA 3W9HA 4EMDA 1F6TA 1JK9B 2J6UA 2ZNZA 1P1TA 3MMCB 4NA3A 4AE5A 2DISA 3CMAS 2YKPA 2GFFA 3NAIA 4KGVB 3OLBA 4GVBA 4DV5F 4A8OA 3V6HA 9ATCB 1R3NA 2YKMB 2E5JA 3N6MA 2VBZA 2WHOA 1V3SA 1D8ZA 1XN9A 3M8PA 2WW4A 5J1EA 3OTDA 3HK2A 2HBYB 3NGRA 1S6QA 2WVCA 1B4SA 1YRTA 4FYYB 3PHEA 2V0NA 2DNOA 1IBMF 1WACA 2MZTA 5FDLA 3C6TB 3QSYB 4RUAA 4B9LA 3MR2A 1U1OA 2C3MA 3R5DA 4KYZA 1QAYA 1FNMA 2G1DA 3WIVA 2IAJB 1S1TB 3OXLA 3OUYB 4X84A 1OY8A 4M63A 3JS9A 4DR5J 3I31A 5D78A 1U1QA 4NLRA 1N5VA 2QX0A 4J9UE 1KQSR 2K1RB 2YQ3A 3H90A 3BGOP 2J0WA 1K44A 2VQFF 3U1LA 4ZPVR 2F8EX 2GS8A 3CJ0A 4NLDA 2QT7A 2H1YA 2JEJA 1XNQJ 3IC1A 4EBEA 4ZCIA 2EKNA 3O1LA 1XNRF 1FVQA 2W2QP 4L6V3 2XSJB 1VC6A 5HQLA 2KDOA 4PWDB 2AW0A 2AWZA 4ZDNA 3SSQA 2I8EA 2NREA 1WF2A 1FO1A 1TUGB 2NCKL 3O8WA 1WEYA 2RU9A 1OPIA 2DR9A 1NDCA 1RTHA 1I6JA 3C19A 3IMQJ 3G87A 1K0TA 1RAAB 4DS4A 1I94F 1K73T 3W65A 3M8ZA 1KHVA 3CMQA 4Y6IA 1DLOB 4F4XA 1VCTA 4ES3A 5F8NA 2OTJS 2C3OA 3QGHA 4J7CA 1WG1A 4ECRA 2R7SA 4HI1A 2AZ1A 3D0GE 3HFKA 3PW4A 2OEKA 3H59A 4YR3A 2DGOA 1IKXA 4WXOA 2LFVA 4DV4J 1R6YA 1VHIA 2RDJA 4ECXA 3UCUP 4ICLB 1YJ9S 3LW5C 2MKHA 4ZVFA 4ED5A 5G0RB 3D1QA 2VG5A 3CCMS 3DLEA 5GMKa 4YOEA 1A6LA 4LUBA 4IFYA 3IRXB 4FYVB 1GXLA 1UA0A 1YGYA 3M8YA 2FDNA 4QQBA 3LPYA 5CXTA 2LLZA 4PQUA 5KG5A 4C0OC 2NLWA 3MCMA 3AD9C 3QLHB 4JBCA 3D28A 3IGVA 1XMBA 2DY9A 4O44B 3WHIA 3TNVA 3RGIA 5IT0A 1RLCL 1ZPWX 1PYOB 1WD6A 2VFVA 2CPJA 2NS1B 3UN5A 5CYJA 1X4EA 2BR0A 3S6EA 4DR6F 2MKKA 3GSIA 1KLMA 3LALA 3MR5A 4E0DA 2J8SA 2LEBA 1FDAA 3MEGA 2F63A 4F2RA 4WIQA 2VDIA 1KOOA 3DLKA 3RR8A 2FY8A 5BR8J 5B0EA 3US5A 2HIYA 3JXOA 2H5JB 4OI6A 4DG1B 2AGOA 3DI6A 3B4DA 1SB6A 1N36F 7AT1B 2DGXA 5EWEA 1CJVB 3W5XA 1FKOA 3E51A 2PA8D 1VMBA 4OLOA 3NAHA 1FI4A 4OHXA 2YY3A 1XIQA 4EI2A 1HL6A 2OAUA 4I4BA 4Q7AA 4I67A 2OUGA 3IN5A 5J2PA 3FNNA 5CQGA 4HACB 3OW2R 4TU8A 4FS2A 4J9MA 3FZBA 3BSOA 3MR3A 4OHYA 3J81U 5ETRA 3JAMU 1NB7A 2MQMA 2E5LJ 4A46A 2XCPA 2WBRA 1Y5NB 2QTWA 2AT1B 2Z57B 3ENAA 4J9LA 2CFXA 5I3UB 4FPRA 3NMRA 2V5HG 4YS2A 1SC4B 3GYNA 3QRRA 2P5VA 2CJYB 4ZIVA 2KJVA 3IGNA 3IA0A 3PXGa 4YDXA 4W90B 2Y1RI 3HJVA 5KFDA 4R8UB 3PTWA 4NI2B 2BQRA 5BYQA 5ADZA 2HVHA 2PT0A 5IQ6A 1EHWA 5A2QU 5I42A 1R89A 3CDEA 2CYYA 1NO8A 1Q8IA 5D4LA 4KR0B 3HKWA 3THPA 3W66A 3NLCA 2QMWA 4ZHRA 4A8QA 3OL6A 5C25B 1IN0A 2BANB 4IRKA 4G3IA 5ETLA 2DNNA 1D9FA 4B17A 3Q0AA 2YQ0A 2YWHA 3MHYA 4M5HA 4WP9A 2YKNA 4LF5F 4RZRA 2OSRA 3VGTA 1LQ9A 1EX8A 4X4RA 3M8QB 4XPCA 2BJ7A 4DV6F 4Q45A 2A0FB 1KBRA 2WRMA 2CPFA 2WB1D 3QFWA 4DV0F 2PFFB 2B9WA 2FLLA 2XYGB 3BN4A 2LCWA 2OELA 1SJRA 2YWKA 1ULRA 2JRSA 2YNGB 2AJ1A 3UD3P 2CZ4A 4ZPWR 2W25A 3QT5A 2HYIB 5F8IA 1RT4A 2O5DA 3KHGA 1SQFA 1NJIT 2WAQD 1BD6A 2POKA 1S1UA 4OI4A 1NPKA 3T9ZA 4XDDA 5E3RA 3GFZA 2BJ1A 3KLHA 4KY3A 1N52B 4X4PA 3CULA 1Y3KA 1GQEA 3CDUA 2M5YA 5AJ3F 4I68A 3ZZUA 4CLUA 1OYDA 4EBDA 2D9PA 4L72B 2CJQA 3MD3A 4HHJA 4LRCA 2W2NP 4HTJA 4J9SA 1QJHA 1U24A 1E6VB 3W9IA 4X4SA 3V2UC 4UOCA 4KV8A 1DAXA 3RBZA 3CC2S 5DG7A 2J76E 3G71S 4PR6A 1UP1A 1HW9A 3LP1A 3ZNJ1 3PX0A 1X0FA 2HQIA 5EDWA 2HFNA 4CRJA 4WYLA 3W9JA 3MFHA 1JLCB 3U7JA 1M5PC 4PUOA 3GSDA 3M2RA 1F3VA 4K5RA 4EGLA 4DSEA 4JI0J 4J5OA 5JVHQ 4KFBA 3M6WA 4I2QA 1FNXH 4OZ2A 4RU9A 4WZQA 3P5TL 4IFVB 1P27B 1EQ0A 3B82A 2Y0BB 2A1BA 2KTQA 1RWUA 3QAEA 2NSCA 1WHYA 3UO0A 3TUZC 2VDHA 1NSKL 1S1TA 1QSSA 2XMWA 3OUYA 1R8CA 3SMZA 1UVNA 5KFXA 2ZH9A 3BS9A 2VG7A 4U7UD 4RPFA 4Z37A 1HHSA 2ALZA 2H4WB 4DUYF 2M8DB 4QJVA 2XY6A 4P75A 5KFMA 3HZEA 1RJJA 2VOOA 1G4CA 2RQ4A 2YPYA 3KUGA 1EETA 1YI2S 1YBUA 4KAIA 4CLSA 3M2UA 2GO8A 2DY1A 5LXRA 3KMQA 1HKAA 1WTBA 4PWDA 4OYPA 3RAQA 1EARA 2K3IA 4OYBA 1U1KA 4OI1A 1T02A 4FVMA 4QWDA 1NU4A 3DHWC 4C3MA 2GIQA 4OX9J 4N76A 4DR1J 3CD0A 2P9EA 3P6YC 2Q66A 1C1CA 1FFWB 3T1HJ 3FZ2A 1IKWB 5KFJA 1A7GE 3A1YG 4LSNB 5K14B 3FEXB 1DLOA 4HEA9 2OTLS 1WUUA 2ACYA 1Z1ZA 1H2UX 3R5AA 5T14A 5C42B 3D1HA 3OR2B 3D5MA 4N8NA 2X7IA 5IT9Y 3C14A 1G6BA 4RNHA 1FX2A 1AUSL 2RMLA 1S72S 4NE9C 4RW8A 3LP2A 3HHLC 4YB6A 3DXSX 2CNOB 2YKQA 5KFLA 3LGMA 1W2IA 2HHUA 2L9DA 3PW7A 4WE1A 3W63A 2XTJP 1U26A 3EPGA 2AEJA 4QU7A 1JQGA 5ETKA 1B0TA 3T5KA 3NBPA 3M4XA 4ZK7M 5KFVA 1O0PA 1YJRA 5CD4H 3MOJB 3T1YF 2ZH5A 1U1RA 2YH0A 3WIUA 4QW8A 2RUSA 1GH8A 3DRXA 1BQNB 1IBCB 2RHSB 2GIRA 3I5CA 4ZVTB 2DR7A 4DCPB 3TANA 2GZOA 3TP2A 1V5VA 2GVZA 3DMJB 2WVEA 1JLGB 2ASLA 4QW9A 3KLFA 1HPZB 4NCAA 1BUXA 2GAGC 1U1PA 4PXDA 4C11A 5ETTA 5DQGA 2ZUAA 4NLVA 1CULB 3R1LA 5K8PA 5DG8A 1PILA 5F8MA 2XLJA 3AB4B 2I9SA 4CYUA 4F4WA 1N33F 1B0VA 4P7VA 1FRKA 4JI8F 4G65A 4JYAJ 1Z4UA 3VZIA 5HATA 3TUPA 1PYSB 5ETOA 3DGPA 3RB0A 5DETA 2PMHA 5K8OA 3D0HE 2MQQA 4OX6A 1S4EA 1C0UA 2JWNA 3RRKA 4NXMF 1KN6A 4OZ0A 1UZHA 5L1IA 2ZH4A 4FNHA 5HLFB 2K06A 5KFAA 4MFBB 1DQ8A 5B0GA 2FJBB 2JLFA 1RWMB 1UW9A 3JQKA 4R25A 2GQCA 5GAEI 4CO5A 2XLIA 2LEPA 1Q5VA 3Q23A 1HNZJ 3GIJA 4B08A 2LQ8A 4O0IA 4X64J 4J91A 4LBHA 1BMQB 1HNIA 3T9NA 2H48B 3C6UA 2GCFA 5L9XA 2HNZA 3ETMA 5L46A 4LF1A 4DL3A 3AODA 5I3UA 3RRHA 2RQKA 1VQ4S 4BCAA 2V8HA 4M5JA 4Z7CA 3NS6A 1OSDA 3KK1A 2WVFA 1NDLA 4FF1A 1BXNA 4KTQA 1DBDA 4RW6A 3F44A 2IMOA 4M5NA 4OZJA 4Y2AA 4LSLA 3PEJA 1J27A 1Y00A 3UI3A 1S9FA 4B9MA 1RTIA 3TA2A 2ZOGA 1YITS 4GRSA 1TP7A 1WG4A 2ADCA 3CMES 2H65B 4WIIA 2LQJA 3ZTQA 2GX8A 3MM8B 1Q1KA 3G96A 2V2ZA 2BANA 2PDAA 4DUZJ 3DDNA 2AYBA 2CJBA 4NWBA 1RT6A 4RNNA 4O3NA 1NJYA 3BB5A 2PA3A 1RK8A 3IG1B 3OSPA 1SIZA 1D8YA 2D3O1 2UUAF 1LK5A 1JLAA 1SBRA 1EB0A 1P9YA 2DNGA 3A4TA 3OTCA 2W8KA 2HW3A 4DQRA 3DXBA 2M88A 5D0GA 1TL3A 2CJAA 4QIGA 1D3WA 1TUVA 4O3RA 1OQ3A 3W2WA 2GVDA 1Q82T 4CLYA 2GNKA 3GQCA 4WFXA 3OL9A 1BHNA 1N54B 3FFIA 2HAIA 1ZH5A 3MWBA 3CIMA 3CB4A 3BH7B 1R0BG 3PR5B 1NXIA 4UUWA 3KYLA 1NUEA 2EFGA 2FJDB 3MEDA 4RW9B 2M9KA 2XS2A 1JXLA 1SC6A 1N32J 1NZAA 1RGVA 3ET6B 2YTCA 1U0HB 7FDRA 4DSFA 1RE1B 3LWLA 4G1QA 4DLEA 1T9TA 2IJFA 4O4GB 4RNFA 2JEGA 2XEXA 5SUHA 1N0VC 2V4JA 4ZVRB 3HVTA 5H9EJ 1GXTA 4LSZB 4IKAA 2WONA 3H4BA 4AL7A 1RTDB 5KFGA 3DOMB 1P9QC 5E5NA 3AD8C 4M8LA 2HGNA 1JLCA 1DRZA 4CLKA 4QIFA 4ZLJA 1VBZA 2I6WA 4NPOA 4F36A 3TVKA 3MR7A 5BYSA 1NB2A 2R3VA 1HNXJ 2E9RX 4FXVA 3ILIA 2DNHA 1LXJA 2K3KA 4IFVA 4HL9A 4DOZA 1LOUA 2EW9A 2LYVA 2OPRB 3N6NA 5L39A 5KOWA 2DEIA 4CH0S 4M5LA 4LFAJ 3FMBA 4OHVA 7FD1A 2UXBF 4O3QA 2XI2A 1WTFA 1VR6A 1QSYA 3GFYA 4OX7A 1DJ0A 2UZAA 1X5PA 3UWTA 4J37A 1BE4A 1N6QA 3E01B 4QWBA 1ZM9A 1TFWA 5GAHU 2OO4A 3C16A 5M2RA 5D15A 4G1IA 5C24A 3NNCA 4B3MJ 1TFYA 2C1EB 1V5IB 2D3OR 1DARA 4RUBA 1Q79A 4B3RJ 4ZPBA 1YJVA 3JYTB 1VQ8S 4A8YA 1WC4A 4DMZA 1Z2LA 5ETQA 4PG8A 1LWEA 4PPDA 1HBMA 2MPUA 5A8WB 2VG6B 1M5OC 3C15A 5KFUA 2YNIA 4CT8A 5F8LA 2IVMA 5A8RB 3CTRA 5LSOA 5A0YA 4NRTA 1JLQA 3FRZA 1HWLA 3GIIA 2UUTA 2CQHA 1YDLA 2E44A 4PWUA 2DNKA 2DXFA 2OGUA 1REVA 1UJ4A 4YEAA 1T05A 1TL1B 4KO0A 3T5JA 3OVSA 1IQZA 1S6PA 1IBMJ 3IS9B 4IG0B 5A8KB 1TQLA 3CJTA 3J7AN 1AZSA 4LF7F 1X5OA 3FUYA 1Q4RA 1RBLA 2B8QA 2B5JA 2QLJB 4F0MA 2FHJD 4ZIWA 3T6JA 1T03B 5HL7Q 1MN7A 3PJXA 3OR1A 4UZCA 3M2VA 1UW4A 1RTJB 4ZCKA 2DK2A 2VQFJ 1HWUA 3SV3A 3GE9A 2ZC4A 1N34F 1L3SA 1IM4A 1RDRA 2CRLA 3A3NB 1XNRJ 1UEKA 2V8GA 1HQUA 5KFZA 2UP1A 3EXCX 4I64A 1PJ6A 2Y1IA 4I2PA 2BKOA 1JLBA 1SJ3P 1KR4A 2ZOMA 2Z58B 5IV3A 1JB0C 4JI6F 3OQ2A 3S01A 1Q0NA 1R8AA 2HHVA 2GMJA 4A8KA 2MSTA 5DZ7A 3EGNA 2VFTA 1OO0B 5K8NA 3O3LA 1R27B 2W7OA 2GGPB 2N3OA 3CDBA 5E33A 5THWA 1VQOS 2H3EB 1NHVA 2XYHB 3KHHA 1Q5YA 4B9TA 5F0UA 3OLAA 5L8RC 4ZLNA 4F3QA 4F3OA 4C98A 3AOAA 3NY0A 1HYSB 3G8TA 2FC8A 1S59A 3HT3A 3PNIA 1NZ8A 5KFTA 4GO5X 4MKYA 3Q24A 1NEEA 4ELUA 3OT9A 4HH0A 2FB0A 5AXMA 1OY9A 1HARA 2DHSA 3PRVA 1QVGR 4G6VB 1SXLA 3VALA 1JLFA 2HVZA 2D41A 4CLFA 1IR2A 4DU7A 1FRJA 2OPQB 4B3SF 2HHWA 4HHUA 4ELTA 3KLEB 2NSBA 2GIFA 3MD1A 1S77D 2ZVIA 3GCWP 4IG3A 3KNAA 2FJAB 2CQGA 4J9QA 2M52A 3WQPA 3PKMA 3CSKA 1CJKB 2DPJA 3TVYA 4NA2A 5GMEA 3UQSA 3R7SB 3R3TA 2J9DE 3H25A 1U2RA 3HSJA 3K57A 4K4ZA 4MIWA 1S9GB 3TUJC 1BC6A 2DGWA 3VQTA 3BSAA 4IRCA 3AXKA 5HVGA 1KDNA 1Y11A 2JLEA 5CABA 1R31A 4P10A 5MAOA 1VLYA 1FCAA 3CJ5A 4F26A 4DR6J 3UN2A 1JIHA 4DBQA 5GAGU 2O3DA 3CJ3A 4LFCF 1OIAA 2QL9B 4LMZA 4KBIA 1UA1A 2WTFA 4NYZA 4B3OB 3Q2TC 2DNMA 3BF4A 1RISA 2DCLA 4RO0A 1ZPVA 4NRUA 1N36J 3DLGA 5KG3A 3TAQA 3DRSB 4OV1A 2BE2A 2KVQE 3HHLD 3QNWB 3J81j 4D3HA 1JWWA 3GFXA 4ED2A 2EFQA 1U4BA 5DDRC 8ATCB 2YNFB 4S0MA 1RKIA 1PIEA 2UUCF 2KH9A 1VBYA 1XK8A 3ITHA 4NLTA 1FWLA 3TQEA 3HKZD 2VHGA 1D9DA 2AV5A 1R8BA 1SUQA 2XI3A 2MJNA 3NXZA 4X65J 2AYMA 4NOHA 3EVWA 2VKRA 3V6KA 3NOCA 4ES1A 3SYZA 5KG1A 1H74A 2DHXA 2HK2A 2YWFA 3K0JA 1NNDA 2CQBA 4QYZK 2DR6A 1T3OA 2OPSA 3KLIA 4HVZA 4A8FA 1SJFA 2ZZMA 3GILA 3KLGB 1VQNS 2F8MA 2FLOA 1FXLA 1ZM4A 4DFMA 2UV8G 4MH8A 2BM1A 1X9WA 1LWFA 4N7TA 4KH1B 4XTTA 4WFAQ 2W2MP 2PSZA 2E9TA 3CCLS 2IRUA 4UUXA 4X62F 2BJDA 3DCAA 4EFAC 3ISZA 5K9FA 4URQU 5HJXA 1FEHA 1QD1A 5IC6B 4CT9A 2QL5B 3KUHA 4DV1F 1F5AA 3LF0A 1HBOA 5KFPA 3M8RA 4F4KA 2IRYA 4M5MA 1S9EB 1FD2A 2WOMA 3BQ2A 4U8YA 2CJKA 1U6FA 5KFSA 2AQ4A 2B4VA 3QAUA 3T1AA 5IZHA 1GAOA 4YN3B 4MKAA 2BQUA 4LF5J 2N4CA 2YX4A 4QYRA 2R7OA 3ZFVA 2R8GA 2U1AA 1T95A 5F8JA 3GONA 1XERA 3L4BC 4X66J 8RUCA 1HI0P 1SKWA 5K5MA 2HWHA 3MM6B 4LF9F 2QMXA 1XWLA 3V6DA 3NP5A 3SFGA 3N79A 4WK3A 1YBTA 2HPUA 4Q2LA 2CG4A 2QA2A 2ASJA 1VFJA 3NEKA 2HS3A 2VFRA 2MQ8A 2DNRA 2QLBB 5HAOA 5DM6Q 4WZMA 5CCLA 4OZLA 2FJVA 5HJYA 1RT5B 1G2EA 2HRYA 2A6MA 2DHAA 3KJVA 4C2MA 3UDCA 3I55S 2R2TA 2CPDA 5AJ3J 3QO9B 3GTYX 2KYXA 1ZYQA 1S76D 5KFQA 4K5SA 1VBXA 3M32B 5KT5A 1RBAA 1S6UA 3VGVA 2XNRA 2IYGA 3OXGA 1EP4B 2R7WA 3N28A 2N82B 4NEZA 2KHCA 3Q2SC 3EUNA 1YJNS 1WSVA 5LSRA 2M0GB 4DX8H 3CCJS 2VG6A 3FCVA 4P7TA 4M5DB 3CJ2A 4ECUA 1Q8KA 2FGCA 2XG8A 4CO4A 3I82A 5JJBA 3R97A 2VKZG 2V8DA 4MKVA 5C5JA 1U02A 5KG0A 3RJMB 2Q6BA 1NK8A 3O5TB 1G7CB 3AOBA 2DGUA 2HMIA 2YH1A 1NK4A 2JC0A 4LT6A 3IAS9 2ZJPQ 5A6PA 3FCWA 4X4UA 3MEEB 1NPPA 2A10A 3H2LA 2V8VA 3R5BA 3FRYA 2L08A 2HQCA 4DR2F 1CSJA 1HQEB 3H2UB 1OS5A 2B8PA 1L3VA 1TKTB 1HBNB 1K8AT 1CBKA 2W7PA 3BBCA 1CC8A 3BSCA 3M6UA 4DUYJ 2MTLA 3N5FA 3UE2A 2ZHBA 1LFWA 1S10A 1DURA 2BV3A 1KC8T 4CWBA 2DR5A 2M2BA 4EK2A 3VCDA 2R42A 2Y1LB 1H6KX 3R6GB 1AROP 5I3PA 2VASA 2W4CA 4GVBB 3TZYA 4ZN1A 2RF2B 3CEDA 5HQ8A 1VQ5S 3DNCA 3BGRA 2QG9B 4F50A 3NWRA 3FVYA 5ETVA 5KT6A 1YRXA 3M8PB 5HMYA 2E5IA 2VJVA 5J1EB 2LDIA 3HVWA 2B0GA 4DV3J 3X1LB 2HBQB 2F4VF 4AYBD 3VAKA 3PYDA 4ZITA 1X8DA 4ZPDA 2DNLA 1RYRA 1S6QB 4ECSA 5KT4A 1F9EB 3DM2A 1IR0A 1GEHA 5FDLB 2FZKB 3PJ9A 4USUA 4H4OB 2CZ9A 1TKZB 3SQOP 1HI8A 4NEYA 1WDTA 2MMYA 4WFZA 5A76A 4ZLPA 4UW2A 3R6LB 2XGPA 2OHDA 1EQMA 2Z8QA 6FD1A 3CD6S 4PG6A 2RUGA 1RKJA 6AT1B 1VRTA 2IBKA 2VIHA 2RDDA 2NPIA 3BYRA 3VAMA 2XHWA 3PW5A 1UCNA 3SSRA 2KZMA 1U2CA 3V6JA 1GX6A 3TQ1A 1IBLF 5H9EK 3V4IB 3A8KA 1IJFB 3O44A 2V50A 4LR9A 4ED3A 4OYAA 1U6ZA 1RU2A 3KWMA 4HKQA 4Y2MA 3DYAA 4FF2A 4WYWA 2MKJA 1TL4A 1HW8A 1XR5A 1XMOF 5ETSA 2RH3A 1NSPA 1GMWA 4GKJJ 2F7VA 4IH6A 4V19J 1Y4ZB 2ATLA 1NDPA 3EGWB 2JEIA 4PYDA 3G86A 3T1YJ 3LH2S 4DL0C 3HHKA 1V3RA 2CQ3A 4FKXA 2WB4A 1UEUA 1PAEX 2QA1A 1PG5B 3Q8YA 2KG1A 2XBPA 1RTHB 2D69A 3EVOA 1SL1A 4R0JA 4UQGA 3EGZA 2CQ4A 4M1KA 1YIJS 4J9OA 4OZ5A 1KEKA 4NCGA 2HZVA 1YQHA 5IT4A 4TVAB 3IWLA 1T8EA 3R27A 4KRWA 5F41A 1VQKS 3ENVA 3MFIA 4OJ3A 1LKZA 3DLJA 1N33J 2ACMA 1IKXB 4JI8J 2K7KA 1FEEA 2VUGA 1KFSA 2XLKA 1MG7A 4ZVQB 4Q0BA 5KFIA 2VV5A 5C2CA 1X0PA 1UEVA 5JXSA 4Q2MA 2LU1A 4RL1A 2O66A 3TYTA 5SZTA 3M1VA 2VG5B 5DGAA 3DLEB 2BOAA 4XDCA 3IRWP 4NXMJ 4ECYA 3TARA 2L3MA 1CJTA 2BKNA 2L9WA 2MEWA 1T9WA 3TA1A 1GXUA 2FVQA 1HNVA 3M8WA 1DTTB 2QLFB 3IBFB 3MUMP 3HVAA 3MGJA 3GP9A 4PQUB 2BVZA 1S7HA 2IA6A 1RUSA 3PO4A 4FS1A 3G9CA 1QUPA 5FLXY 2FUG9 2DRBA 3V81B 4ZVOB 4JI1F 2LMIA 1R8HA 3RB6A 2BW7A 3TAMA 2HVIA 2GHVC 2DH7A 2KFYA 3SIPB 2R7QA 4I6WA 2WSEC 3A8IA 1M1KT 4PEOA 4N5SA 2BX6A 2DIVA 2YX1A 2E1PA 4NLQA 4U7CA 2QSWA 2UUBJ 4P73A 4DHVA 1KLMB 3WC2A 1LWCA 2BW2A 4FPIA 3H42A 5CYQA 2RE1A 3EZOA 2QEXS 5GADI 3MEGB 2HBZB 3D0IE 4TU9A 3DLKB 2W9CA 3F0NA 2MKYA 4DL4A 3WBZA 1XR7A 4UY85 1VOMA 2RVJA 3DI6B 5LM7E 2LQ5A 2RRNA 1QE1B 2KM8B 3ADAC 4K4VA 5EHHA 3FEYB 4UT4A 1FKOB 4WFNQ 2FC9A 1RI7A 4C7QA 2V94A 2FYXA 3I9ZA 5J2PB 2RILA 2DTJA 2JVOA 4ALZA 3P3DA 2GMLA 2XMAA 1I51B 2ZDPA 3JSYA 2BBEA 1YK9A 1WG5A 4GC7A 4CTAA 1M1HA 2AGQA 1JJHA 2QSFA 3VR1A 2KRRA 2PC6A 3TAPA 5FD1A 3R9LA 1RCOB 2G0JA 1H38A 2LKZA 3FQKA 2UUAJ 2HHPA 2FZCB 3PJWA 5DLFA 2BE7D 3I0SA 4JUZA 4K4UA 4YB7A 4EUVA 2MLZA 1U6BA 5CYMA 3HCXA 3MPWA 4C8ZA 4ZP9A 3LUYA 2XMJA 1T3NA 3L7PA 2RS2A 3MEKA 1UJ5A 3DLBA 3EWGA 3FC9A 3BQ1A 2XM3A 4KKOA 2G4BA 3GZ7A 1VISA 3T3FA 3AT1B 1X4HA 2DKOB 3D1OA 3LQVA 4ATNA 5J2NA 2QN6B 3QZ8A 4CO1A 2ATCB 1QDUB 1KP6A 3C8YA 4PXEA 3TX8A 3PYFA 3NCQA 2GQ2A 1JXEA 1TKXA 2NXJA 3A13A 2HGMA 1C4CA 5HANA 3UN3A 1WKJA 1I1GA 4USTA 2ZH1A 4ZHRB 1OSCA 1X4AA 1TUWA 1AFIA 2HAFA 2PFDA 4JI5F 2ZJRQ 1KHWA 2J7KA 2FIUA 2YKNB 4B9VA 1B7FA 4ZVGA 3KJNB 1KVKA 2EVZA 1VQYA 3T5LA 1RU1A 3ZZOA 1VJQA 4WP3A 1C0TA 5HMXA 4EEYA 2F4FA 1WI8A 1Q95G 4RNOA 1F5CA 4I6YA 5AXLA 3M30A 3I9V9 5AXNA 1PAUB 1LV5A 4JV1A 5D4NA 1LEOA 2E5GA 1SQGA 1SIWB 2J5AA 3G6VA 3PYEA 1DZ5A 2L41A 1RT4B 2SXLA 1FK9A 3FJ2A 3LGNA 2E1AA 2HNDB 4K8RA 3PM9A 5KFOA 2Y3YA 1S1UB 2ZOFA 3I5AA 2HS0A 4DX7A 3M8SA 1VC0A 4ZVUB 1V3ZA 4TQRA 2UXBJ 3HP6A 5HBMA 3U1NA 3HHEA 1HBNA 2CJ9A 2C2ZB 3RAXA 2QC3A 5L1KA 1TL5A 3OFFA 2AP6A 2MB0B 2W4PA 3G8QA 1F60B 2C22A 1RHRB 2BMBA 1P1LA 4ZLLA 4NZ7A 2X3GA 2FLNA 1Y3JA 1J5OA 2BM0A 4AD6A 1LK7A 3G8SA 4KV8B 4NASA 1WELA 3MURP 3G2XA 2FGOA 1U1MA 1MMDA 2YVSA 1TK0A 4YHHF 3K2YA 3JSRA 2AMCB 1WNEA 3LP1B 2RF2A 1FRIA 4H4MA 5IFMA 3ZC4A 1S1XA 3VAJA 4BC7A 4P2XA 1B3TA 2J6TA 2VB6A 3NCPA 1MU2A 3HD2A 3SI8A 2HHQA 1X4FA 3H0PA 4D3GA 4PUOB 3BDEA 4NLGA 4URGA 3M2RB 4JI4F 3M05A 3T6BA 2B7CB 4TXSA 1Q78A 1TVRA 2VC0A 4UOFA 3CCRS 1L3KA 4KFBB 3GV7B 4I2QB 4ZN3A 2GHWA 5LT5A 2ZITA 2ROGA 2VODA 4H4OA 3H5UA 2Y1JA 1TKZA 5J2QB 3GFHA 3FEZA 2H51B 5M2UA 1NCLA 2J9DA 4F4AA 1MSWD 4Y65A 4CLPA 1R8PA 4L74A 4PQAA 1EKSA 1NK5A 3MAQA 3N5BA 2C2NA 3T41A 4IOAQ 4TY8A 2L48A 2VG7B 4LF7J 1KFDA 2C2MB 2KXFA 1UVLA 3UPFA 2J0QD 1F0XA 3V4IA 5CHCB 2YWGA 2FD2A 5IM0A 1EAYC 1JX4A 2C2OB 1C2PA 1EETB 2NYHA 4I69A 3M2UB 1S79A 3FSIA 1RAFB 1KLNA 2CQ1A 4JI7F 3J7A1 1VQ7S 5EN1A 2E29A 4TY9A 3PR4A 5KFFA 4CM2A 1N34J 4MIAA 1K1QA 3KNGA 4ZVEA 1FE4A 3V5RA 5BJRA 2MXYA 3PFEA 4ZPCA 4KSEB 3BBFA 2W9AA 4DR3F 1FJCA 4H4KA 4HT7A 2B43A 3R5JB 1C1CB 1NK7A 1JLEA 2XMMA 4F8RA 2QFJA 1FXDA 4Y00A 3MM5A 3CCUS 2KB2A 2D74B 4A8SA 4OYXA 4U8VA 2OI2A 2UXCF 3U1MA 1VS3A 4F4YA 5EUHA 3WX8A 2VFUA 1LNQA 3QGGA 4KB7A 4LFBF 2CPIA 2QMUB 2JFKA 4C0HA 3MM9A 1NKBA 3VAFA 3C14B 3QMQA 3IWXA 2ZBIA 4KT0C 4EU0A 4MAKA 4RW8B 5FIIA 3LP2B 1YVFA 3GG0A 4N47A 4QPTA 3QSIA 1FJ7A 3CJKA 4WE1B 4OQJA 1MN9A 2UVVA 3HM9A 3D67A 4R5PA 2VBYA 2MLXA 3NBPB 2IMWP 2Z0GA 1S1WA 1KVIA 4B3SJ 3IWNC 4WP8A 1DTTA 2KL8A 3BR9A 1R0AA 4N56A 1SVDA 2EK1A 4C6AA 1FESA 2VJUA 5J1PA 1VQ6S 4ECTA 2VA2A 3BJYA 4ZP6A 3VGUA 3LOUA 4TLQA 5DLGA 3V81A 2AJ4A 4HHHA 2GVZB 4E2FB 1S0MA 4OHWA 2PIIA 3HHDA 3KLFB 3NNHA 3HULA 4KGXB 1JKHB 1UFWA 3OTBA 2ZDOA 4C11B 2WW8A 4DN0A 3PFOA 3P4UB 4CYUB 3I0RA 3NGUA 4KHPF 2G1HA 2FHKA 1MROA 2AGPA 5C7PA 4LFCJ 3TJ8A 4QWAA 1QE1A 3DGPB 4ID5A 3ZZTA 4QOTA 1U49A 4DZDA 2A2CA 4HTIA 5H9FJ 2XGQA 2RKIA 1VRQC 2R7XA 3PRBA 1RT1A 2OPPA 1C0UB 1VGYA 2V69A 1H7WA 2W01A 5D0EA 2XC9A 3OTOF 5IQQA 1D1UA 3AD7C 4FYXB 1U0SA 1E6YA 1NRKA 2UUCJ 4YQWA 1D09B 4OX8A 1FTCA 3M9MB 3AH6A 1MW7A 3KG1A 4W98A 1A0OB 1QTMA 1HNIB 2LXIA 3C6UB 2HNZB 2C2EA 5B0BA 4WTYA 2DRAA 2G13A 4NYPA 4EZ6A 4CH1A 1YBAA 4DJBA 3PEHA 3MM7A 4LF6F 4JP8A 2KYZA 2IY5B 4ER8A 3KK1B 1WI6A 1N4LA 1TL7A 2YBVA 1FWKA 2BE9B 4JV5F 2OEMA 1O8BA 3RB3A 4RW6B 4QWCA 5DRKA 3PO5A 1P6TA 4I1TA 4MJKA 5D0HA 3Q8RB 4LSLB 1X9SA 1U25A 4Y34A 1MMNA 2VU5A 3KHLA 4PWWA 1RTIB 2Z30B 5ETPA 1SKRA 2EI5A 5E7OB 4OYMA 3MMBA 2VPYB 2QFIA 4IO1A 2AJFE 5AE1A 1XTZA 2ROEA 3MAHA 3LAKA 1C1BA 5ETMA 5HROA 1YG0A 4JI3F 4K59A 2CPZA 5IS2A 2Z2LA 2MLYA 4K50A 4DV1J 3JTNA 4K7QA 1NLKL 3ETOA 1LW2A 1RT6B 1R7IA 2GA7A 1B70B 2GAHC 2JZ5A 4AXIA 2YX7A 1AYEA 4ED6A 1PO6A 4LR8A 3UD5A 4QCLA 3QIPA 5E41A 5DG9A 2ZWOA 1ACMB 5C2GA 1JLAB 1FNOA 4QIWD 5E3QA 4DPTA 5T7LA 2NQPA 1N8RT 2DHGA 5HO4A 2VD3A 1IQTA 1TL3B 3HZGA 1WDDA 4WTOB 3KDNA 2VPWB 3CJ8A 2HNDA 3I5BA 3W2WB 1HLWA 1JJ4A 2Q6CA 1PBAA 4C8NA 2FJWA 2GVDB 3GIKA 5D3GA 1FRLA 4E98A 1T11A 1RAJA 3CD5A 4OYOA 3FFIB 2YWWA 2FPHX 4WJBA 3QT6A 2X1AA 4RBVA 3EYZA 4USIA 4YY3F 3KK3A 2VBWA 1RADB 3MEDB 4B02A 2EC0A 1N5TA 2V68A 1Q53A 1FRMA 4KHRA 1RT2A 1DQ9A 2CA9A 1KTVA 1NSAA 5HP1A 1AT1B 3C66A 1GMVA 4G1QB 5B0CA 1KONA 1HHTP 1IBKJ 2CQ2A 3NMAA 2V4JB 3HVTB 2CNKB 3PY8A 3BKFA 4CLWA 5L1LA 5LSLA 4O4RA 4HI2A 1RHKB 5CCMA 2JC1A 2EPIA 5F0WA 2WONB 5RUBA 3M6XA 2JHEA 2AKWB 4DEZA 2BZ2A 4O3SA 2OEJA 2NPFA 4N8OA 3PYGA 2W8LA 2MGZA 1VLOA 1M5HA 2FQQB 1SKUB 3DC2A 3KMSA 4RUHA 4Q44A 1CVJA 4CI0B 3CE8A 5F9NA 2RAQA 3DRPA 3LGHA 1H72C 4IDKA 3PHTA 2I0XA 1SJ4P 2MYFA 5J2QA 2BDPA 5KFKA 4NL5A 4EO6A 1WHXA 2Y8YA 3JQJA 3CF5Q 4ZCLA 4F3MA 3K7RA 2Q43A 4FYWB 4DUTA 1RB0A 4BBYA 3PW0A 2MKCA 4DR2J 1N6QB 4NLYA 2E66A 2JOQA 2OJ3A 1RAGB 3GIMA 2CDRB 3AQOA 3FDSA 3C16B 1S4FA 2HFSA 2DB1A 3HLUA 3B78A 1SH0A 3W1YC 5C24B 2KM8C 3OL7A 1M1GA 4YUDA 4RW4A 4X4NA 2KRBA 4UF4A 2CXEA 2W9BB 4EZ9A 2KXHA 5IOLA 1AUDA 2ZHOA 4DV7F 1KD1T 1FKAF 1LWEB 1HBMB 4QWEA 3THTA 4FP9A 1YHQS 3O2IA 1HFEL 1CS4A 3VQSA 1UTAA 3AB2B 5ITHA 3QGPA 4WBFA 3CO0P 4YR2A 3C15B 2BRLA 2YNIB 1Y5IB 4C8OA 1KSPA 1CQNA 5A0YB 2CUYA 4NLOA 2HLUA 3QJLA 3AXMA 1JLQB 1MMLA 1VRUA 1Y9OA 3LWMA 3ZTOA 2RD5C 1NMEB 3W64A 2MY8A 2Z56B 4C9DA 4U95A 2F4VJ 2ZH2A 4NXNF 3PW2A 1REVB 2QRRA 2M3DA 1T05B 4KO0B 3P45B 4LRBA 1S6PB 2BQ3A 1J2VA 3VV2B 1VQMS 2ZBCA 4BLGA 3DN9A 2YNHA 2Z2YB 3HPOA 3QBCA 3AA9A 1AZSB 3L9ZA 1B99A 2ZD1A 3EZ5A 3OJSA 2LQBA 1U47A 2A6OA 3TZZA 4HT5A 4CP5A 4CCHA 2B5JB 2AJQA 1T94A 3U02A 2Z2ZA 3PRDA 1NK9A 5B0FA 2RNEA 3GJTB 3HFZB 1FFSB 2F1FA 3OR1B 3M2VB 1NAQA 1IBLJ 3TJAA 2PMWA 2E1MC 2WSFC 2H5EA 1UFLA 1M5VC 1HHQA 4PG4A 1SL2A 4DSKA 1FTRA 2RRBA 3N4WA 1QY7A 1HQUB 4DN9A 4Y2CA 2KVIA 1XMOJ 4PG5A 5LL6d 3MCSA 4I2PB 2UVUA 1JLBB 3GV8B 1UVMA 5GVQA 3BM7A 1X60A 4TKTA 3D6TB 2YKOA 4PYAA 1N32F 2H54B 3L7OA 1FFGB 2GJIA 4DS5A 1Q7YT 1JKHA 3EM1A 4B9UA 2O01C 4CNYA 1SL0A 3PCOB 3UD4P 1RSCA 1X4CA 1HBUA 3MAAA 2MQLA 2V63A 4A8XA 1RBOB 2AX0A 1K1SA 1LW0A 1WKKA 3WC0A 3PVXA 1AB8A 4W92B 3DLHA 5E3PA 1BLUA 4LBIA 4YB1P 1X4GA 4LRAA 3MMAA 2BJ3A 1A9NB 4I7FA 2JX2A 3CD7A 2B4OA 3GJQB 1CPZA 1RAEB 2J6SA 4DQSA 1JLFB 4DZ6A 4P2SA 2CZVC 3GV5B 1Q16B 3GJRB 4PXCA 5K20B 3KLVA 3BEGB 2J7UA 3W5ZA 2CG8A 1ZAWA 3K5LA 5T41A 3MECA 1QUVA 2DCUB 3KK2B 5J2MB 1YZ7A 1SV5A 4IG3B 2ZH8A 5B0AA 1M90T 3O6QA 4OI3A 3UVJA 2B4UA 3MCNA 5HN0A 2HHHF 5HSPA 3W2VA 3L09A 5GAEU 4Q8FA 1O6XA 2FVRA 4X4TA 5D4PA 1FDDA 4PXBA 1AFJA 2ZBRA 4DL6A 4ZA1A 3GG1A 2E1RA 4C97A 1UWBA 4O0NA 3AQPA 4OJ1A 2IDLA 4ECZA 3LPEA 4JI1J 3DOKB 1YWXA 4CLLA 1U45A 2FJXA 4JB8B 3OFGA 5HI7A 3HMJG 2OD6A 2J7WA 2DNZA 3LAMA 2G9OA 1FRHA 3OD2A 1FF2A 3CJQA 4OLPA 3UNGC 2IM1A 2HFZA 3ZTPA 1HIYA 1BY9A 1RAOA 4USKA 3TVZA 1WSRA 2VFSA 2AEFA 3DKDA 2P9GA 4IH5A 2W24A 3AAWB 4CLTA 1Y5LB 4JV0A 2LQ9A 2R8KA 5D4OA 2AJ0A 3DRRA 4FYDA 5DZ6A 3HF5A 1ITPA 1FT8A 4WKYA 3DLGB 4RKUC 2D9OA 1X31C 2LEAA 1RT7A 2BE2B 2B6AA 3BO4A 5FJ4A 4RU2A 4NMXA 3TWZA 3RUBL 3MOZA 4KPCA 2ILZA 3QT7A 1T9UA 4MIBA 1IKYA 4DX5A 3ITHB 1OPZA 2HKEA 4KC5A 3VWSA 1D0EA 1Z2ZA 2LP4A 1L3UA 1SUQB 1Q7LB 2RRAA 3RW6A 2OH2A 3CGIA 4ID8A 4ANEA 2GHPA 1WOOA 4MK8A 4ZVHA 2N4DA 2NXCA 1QTNB 3MTKA 4JI2F 1KRPA 1S1VA 2R2UA 4IR1A 4LVOP 3Q8VA 4KH0B 2EBEA 4TN2A 5AXKA 3D6HB 4QIEA 2CDQA 2OPSB 4F04B 3KLIB 4P6QA 3IR7B 3D68A 1W2BR 2D3UA 5KFHA 3P49B 2EG1A 1HA1A 3CDWA 5F8GA 2FY1A 1LWFB 1URRA 2UXDF 2MZRA 4MTPA 4P74A 3EJMA 4ZMMA 1TR0A 4K4WA 2RU3A 1R6VA 4DR7J 2F5GA 2L9NA 1RZMA 3IXQA 2FZGB 3UDEA 3HT0A 3GR1A 5I3QA 1HBOB 1CQMA 5L9NA 1C4AA 2OLWA 1D9AA 2P6TA 4OMFG 1BWEA 2HQ3A 4OIXA 1IVZA 5KTQA 2WOMB 4U7UK 2B7BB 1JNZB 2QGFB 5B7WA 3BH6B 2V9KA 3SCLE 3POTA 3QZ7A 2FHJA 1RT3B 4JI5J 4PZVA 4PRFA 2XWXA 3E2EA 2UUWA 4QBUA 3TRGA 4GMKA 5LJ3Y 5HQMA 1X5TA 1VIXA 2KKHA 4P72A 2OKQA 4DFPA 2HVEA 4GKKF 2HIQA 3V6DB 2BJEA 1ICEB 1HQ2A 3PIOQ 2ZE2B 2R2RA 3G82A 1VQ9S 2DNYA 4IQXA 3VAGA 5LMUF 3SCIE 1HMVA 3GWCA 1K47A 1FWPA 1TMJA 5E2QA 2DNQA 3CJSA 5ETNA 1IKVA 5H9FK 3K5PA 2IDEA 1M5KC 3KJVB 3CVKA 4DQPA 1IWAA 2EK6A 1TV6A 3SZ2A 4F7VA 5LXYA 1X9MA 1GMUA 2BABA 2HQDA 5AE3A 4ED1A 3LP0A 4HR2A 2LVWA 2AEMA 2HRUA 1IWGA 4CLZA 2W9BA 2MDAA 4J9VA 2HWTA 3MR6A 3VZHA 1EZZB 3ICLA 1FHTA 2ABYA 2NXNA 5B08A 1F2GA 2B9XA 2X1GA 4YHHJ 3IR5B 4WU2A 4DV5J 3QQCD 4DQIA 3GU0A 4DSJA 3AJ2A 3HXMA 1HD0A 1S49A 4I56A 2HHTA 2D7SA 3VF0B 3J81Y 3JAMY 1RP5A 3BGUA 4JI4J 1FXRA 4KE5A 3SDEB 3NWGA 2PO4A 2Y8WA 3RZAA 3A3PB 1RHQB 5CAAA 2AIRB 3C2PA 3J7ZT 2HRTA 2HMIB 4DV2F 2IIHA 1X4DA 4DCJB 2F9DA 3THVA 1MWZA 3JB9k 1QAJA 2XB2D 3EICA 2F3JA 2B9EA 1H2TZ 2KO1A 2RB7A 4ZOSA 2NUHA 3C46A 1T9VA 3SFUA 1ZM2A 4X65F 3LA0A 1HWJA 4RUCA 1QAXA 2XMTA 3D4JA 4CO0A 2X51A 4ED8A 3HD1A 3HDSA 3D6FB 2E7XA 1IUJA 4DCOB 1YJTA 2VQEF 2AD9A 3ZO7A 5A2QY 2DVIA 2HHXA 4DR4F 2JEFA 4JI7J 2EC2A 3B6BA 4OV6A 1LFPA 1NHUA 4DL5A 3HHLA 4NLXA 2IHR1 2N7CA 1CLFA 3EE3A 4LF8F 1UL3A 4K4XA 1I3OB 3UW1A 3BGRB 2ZM6F 5EX3A 3KUEA 1FKPA 2JFDA 1RWXB 4DR3J 3KOAA 4UOHA 4C3KA 2DO4A 2V2QA 2VH7A 3GR0A 5B0DA 4NLPA 2GC8A 4K4YA 2FLPA 4NLWA 2AJ2A 2F65A 4CQ1A 2MSSA 5KT2A 4DF4A 1FJGF 3DM2B 5KFCA 1I94J 4XK8C 2YQ1A 4E8UA 2P9CA 2IM0A 4J90A 2MHEA 2ZNYA 1EKRA 2UXCJ 1IJEB 1SCJB 2V8PA 2ADBA 4UY8T 4ECQA 2VICA 5KG4A 2E5HA 4LFBJ 2RS8A 2GV1A 4BC9A 1RHUB 3SEOA 3IBCB 1HWKA 5U47A 1VRTB 2VL1A 4OHZA 2DGTA 4X66F 1KQKA 2KFZA 1O5JA 3HX9A 3CIZA 2HGLA 1WF1A 3DOLA 3KK2A 1MWYA 3S7RA 1NSQA 4B3TF 5J2MA 4ECWA 1UMJA 2ZWPA 2ZHAA 4OYZA 1XQIA 2C42A 2QZ8A 1JNRB 3MPVA 1F9FA 3DYAB 1UJ6A 3JSMA 2F40A 3K8VA 1UPPA 2IC3A 4DSLA 2M7SA 3K5MA 3SCKE 3U27A 1PYTA 2APOA 4C8LA 3V4MA 1PC5A 4BWMA 2HNYA 4EWTA 3DOKA 4G1PA 3G6XA 2DRDA 4HDHA 1U1LA 5DDQC 4OZ3A 4IQMA 3OVBA 2R8IA 2R9LA 4C8YA 4NZ6A 4QR0A 4ECVA 2CKWA 3MMCA 4NCGB 1GNKA 2IJRA 2F8HA 1VQSA 1BQMB 2H9ZA 1VK8A 4KHPJ 2HG4A 4AL5A 1PCAA 5KFEA 2WCXA 3KJQB 2CQDA 3HSZA 2YKMA 2QE5A 4Q0BB 3ILOA 3BSNA 2ZBPA 2A2DA 3FK4A 3TJ9A 5F8HA 3M1VB 2VBXA 2DH9A 4GVLA 3IAM9 1CJTB 1L3TA 1HNVB 2QIFA 2W7AA 4Z7YA 2HBRB 3OTOJ 3C6TA 2OFGX 4XIUA 3OFEA 3VVUA 1RAHB 3I96A 1FVSA 2J0SD 2G2ZA 3PG9A 3KG0A 3ZNUA 1GTEA 2Q1LA 2IAJA 2C2DA 2GW8A 2CAJA 1ZOTA 1JJCB 5AT1B 4MKBA 5DGBA 1DTQB 5CZXA 2R2SA 4C8MA 4USJC 3W61A 3TAMB 1NPRA 2K1RA 3OSNA 5K8MA 1MWQA 4B9SA 4DSIA 1S99A 4LF6J 3OPKA 2CADA 4IOCQ 4USMA 2QLXA 1XJWB 4GC6A 2DIUA 1OMSA 1LWCB 5IWAF 5CYQB 2XSJA 2W2PP 2QL7B 3EXYA 4JV5J 1YJUA 3TX0A 4ERDA 3HHNB 2ALYB 2HEKA 1R43A 2W9CB 5DS7A 4RBTA 1NJWA 3SCJE 1VDHA 2UU9F 4L75A 4NA1A 5KFYA 2HVDA 2B56A 4DV3F 1WC1A 3DLLQ 2N3LA 5LMNF 4K2JA 4CZCA 4JI3J 2NXEA 3OL8A 1HNWF 2OFHX 3TZXA 3Q22A 5KFRA 1RT3A 1YX2A 3DRYA 2F9JA 4Q5VA 4W4MA 1VJWA 4CTAB 2KZZA 1UVIA 1U48A 2ZH3A 4DV6J 4RR5A 4QYZJ 4UQTA 5J1NA 1HD1A 1VC5A 4DV0J 3MMJA 3R5GA 5A6WA 3RR7A 4ICLA 3I0SB 3OHBA 1ROFA 2EXUA 4QIVA 5CYMB 5G0RA 2ZE2A 3FBFA 1SH3A 1SKSA 3F41A 2ZEJA 2V2VA 3ZZPA 4AFFA 3QRQA 4OYIA 1F3FA 2FVSA 3IRXA 2FTRA 4KKOB 1IR1A 4GKJF 1HR0F 4ILMA 3UR0A 5KAKA 1FDBA 3RBXA 3N01A 1H7XA 2AU0A 1JJ2R 5J2NB 1T7PA 1RACB 3QLHA 2DJWA 3I32A 4YY3J 4NZ0A 3N6LA 2AYGA 1YTYA 4O44A 4USWA 1TKXB 1FRXA 2CIMA 1ZM3A 5L1JA 3GPAA 3QGIA 4FZVA 2GMHA 1QM9A 3DU5A 3HJFA 2AYEA 4I6AA 4RNMA 2MKIA 3QWUA 2B51A 1YRUA 5E3AA 4DPYA 1FD8A 2MY7A 5KOXA 4U9RA 1QSLA 3G6YA 4AQYF 4DG1A 1WC3A 1C0TB 2MKSA 2DD8S 4FKYA 1X5SA 2CQ0A 2J8AA 1CJUB 5DM7Q 1L5UA 1ZZNA 3SDEA 3M30B 1CJVA 3H20A 3RBEA 2XY5A 2R7VA 2BJ9A 3B8HA 3R7BB 4FVCA 4L76A 3RG6A 2A3JA 3GYGA 1FK9B 2PI5A 2XZWA 3ZZYA 4HACA 2OSQA 3TR5A 4C8KA 1RA7A 1UVKA 5HBMB 2DT9A 4PPZA 3R8YA 4WCEQ 3BQ0A 4ZKAA 2FVCA 5DDOC 2HSEB 2VONA 2IM3A 2WSCC 2MHNA 4XAKA 3EMTA 2IM2A 2ERRA 3AHPA 2VZ9A 3E3XA 3FBBA 3UDLA 1ELOA 3MI7X 3CC4S 1J5OB 1WORA 4LRDA 2VC1A 2UUBF 2Y0SD 2KHDA 2JLGA 4YDDB 2N7YA 2VOPA 4OZ1A 5HVFA 1RCXB 1RQ0A 1RWVB 3A8JA 4H4MB 1G1XA 2ZC3A 1S1XB 4R8UA 2B9YA 4NI2A 4DV7J 2DEJA 4HH1A 4NLUA 1MU2B 2NZ4A 3DHXA 1YZ6A 2ZKUA 3MCOA 2XNQA 4DXLA 1RWWB 1TVRB 5D0RA 2YXLA 4P2FA 1NDKA 3Q89A 3CCES 4HYKA 5C25A 4F0HA 1NJXA 1S57A 1VQLS 2XULA 4YFUA 1SJ1A 4GO7X 4NXNJ 4A4JA 2CQCA 2IVYA 4DQQA 2K8GA 1SQEA 6FDRA 2XHCA 3M8QA 4NMLA 4X4OA 1BWVA 1BQXA 4TY8B 2WVBA 2JJ4D 4RW7B 1RAIB 3J80U 2FVPA 4LF4F 2YNGA 5IM0B 2RJZA 2AHOB 3K5NA 2XMUA 2LA4A 4Y2IA 4X2BA 2WVDA 3C3LA 4DPXA 4OJGA 4O3PA 2R8HA 3KFWX 1S0NA 5DQHA 4WPAA 4J9KA 4ZJQA 3ENQA 2AF6A 1RWPB 1CG2A 2IA0A 4BS2A 5KG7A 1LXNA 3TUIC 4V19X 2NUUG 3TZWA 3ZZZA 3AFGA 2BJ8A 5KFNA 3BREA 1JLEB 3SV4A 4OI2A 2Q79A 4LRFA 3FKBA 4OJHA 2CNNB 1AA1B 3OXFA 2J9EA 3KJFB 1VBKA 2C2KB 3MM5B 1Y0HA 5F3ZA 3GYXB 3J7Z5 2MJUA 2ASYA 3EX7B 1E6VA 2ZZTA 3G4SS 1RWOB 2KJWA 4KIAA 4KHMA 1N5QA 1UZDA 3FGVA 3H40A 4YR0A 1N88A 1BQMA 3ELHA 5HMZA 3RYLA 3MM9B 3AJDA 3J7YI 3MDFA 5DJBA 3NGSA 4F67A 5H1SV 2I2YA 3W8PA 3J7YU 4I0WA 3CJKB 3R7NB 1RHMB 4KPYA 5D77A 4TLRA 3EGVA 1EJ7L 1WC0A 4R5PB 2CNLB 4KGMA 5DO2A 5EGYA 1S1WB 1M0SA 2JH3A 1R0AB 4ZP8A 1SJQA 3AA8A 3ISNC 4LREA 1J5EF 3PX6A 3PX4A 4C0BA 2HHHJ 2HZAA 1XMQF 1V6HA 3H2VE 4RX6A 1B0PA 1NKEA 4K0KF 4URSA 4LQ3A 1TKDA 1DTQA 2Z4PA 1U8SA 4F02A 5GAHI 4F4ZA 2RIJA 3UDVA 1FERA 5IXUA 5KFBA 3W8GA 4L73A 4ZJOA 3T19A 3R2CJ 1WWHA 3FSXA 1RYSA 4M5KA 2HURA 4WFBQ 2V67A 2OD4A 3TA0A 2DO0A 5FLXU 5HVHA 3AJ1A 3CCTA 4MYUA 3RB4A 1NH8A 2ZH7A 2XZTB 3I0RB 4DPOA 3BR8A 1XR6A 5GADU 5E0OA 2HHSA 1MROB 3CPWR 2COLA 2XQCA 4ID5B 2W1BA 3W3SA 2XZDB 2E7VA 2V9WA 2RKIB 1SH2A 1XBWA 2LU2A 1RT1B 2OPPB 1IKWA 3P8BB 4LSNA 2I38A 4HDGA 1UETA 4Y2KA 5K14A 4CO3A 3JTOA 3K59A 1GTHA 5BYRA 1E6YB 1ZTWA 4YMEA 2XS7A 1S7IA 1PC4A 3P96A 5C42A 3OR2A 3EVMA 4DR5F 2QV6A 1UVJA 3TEHB 3CCQS 1U09A 2BUNA 3LTOA 2HFVA 3G6ES 2B3TB 1UKUA 3KG4A 2DGVA 3OBIA 1XNQF 3MM7B 4U67Q 4XPEA 2WBMA 3MUVP 4ELVA 2MQNA 3TEGA 4JI2J 1TL7B 4Q43A 1I5OB 4PG7A 4DPWA 3SXLA 2P2CB 3QPIA 2BA9A 1Q8BA 1JMTA 4PAAA 1BQNA 4QR1A 1W7WA 3PZPA 3GCXP 2EFOA 2XYPB 2EWHA 3BGLA 3MMBB 2ILYA 2UXDJ 3DMJA 1JLGA 1SC1B 1NJZA 3CJ4A 3SQGB 3BV8A 2OIHA 1C1BB 1HPZA 4JOUA 5HROB 3OHAA 1S0VA 4FXDA 2PEHA 4EYHB 3H98A 2OMOA 3K89A 5D8HB 3BO3A 2MZSA 4U6PA 3IM8A 1CULA 1UAWA 1XEZA 4IH7A 1T9YA 1LW2B 3AOCA 1TAUA 4C3LA 1B64A 3SSSA 2B4PA 4FBUA 1QAIA 1WC6A 4DV4F 3QIPB 2G2YA 1CJUA 2R7RA 3GJSB 3NNAA 4WXWA 3TI0A 3DFEA 5T7LB 3W5YA 5EWFA 3B54A 4L3KA
chains in the Genus database with same CATH topology
2VASA 2W4CA 3GG1A 2DNNA 2E1RA 4C97A 3PV8A 1D9FA 4B17A 1UWBA 3Q0AA 2IRXA 3AQPA 2RF2B 4OJ1A 2YWHA 5HLFA 1SI9A 3CEDA 3MHYA 5HQ8A 1VQ5S 4ECZA 3DOKB 2YKNA 4MFBA 4LF5F 4RZRA 3DNCA 1YWXA 2I5JB 2OSRA 3BGRA 3R5CA 1LQ9A 4F50A 1U45A 2KG0A 4X4RA 1N56A 2FJXA 3FVYA 3OFGA 3M8QB 5D3GB 5HI7A 3HMJG 2OD6A 4XPCA 5KT6A 1YRXA 2J7WA 3RU0A 3M9OB 1ZETA 2DNZA 3M8PB 4LQ9A 4DV6F 3LAMA 5HMYA 2E5IA 4Q45A 2G9OA 3IFEA 5J1EB 2WRMA 2CPFA 2LDIA 1FRHA 3JTPA 3HVWA 2B0GA 1FF2A 2WB1D 3X1LB 4OLPA 3UNGC 2F4VF 4AYBD 4DV0F 2PFFB 2EKYA 3VAKA 2B9WA 3NS5A 1X8DA 2FLLA 4F25A 4ZPDA 2DNLA 2IM1A 1RYRA 2HFZA 1S6QB 2LCWA 3BN4A 3KK3B 4ECSA 5KT4A 1SJRA 2YWKA 1K9MT 1ULRA 2JRSA 3DM2A 3DU6A 2YNGB 1BY9A 3TVZA 2AJ1A 2KT2A 2YWEA 3UD3P 2VFSA 1IR0A 2CZ4A 5FDLB 2P9GA 2V2KA 4ZPWR 2M70A 2W25A 4IH5A 3R1HA 2W24A 3AAWB 4Y3CA 4H4OB 1Y5LB 2HYIB 2X1BA 1RT2B 5JVGQ 5F8IA 1RT4A 1TKZB 2O5DA 3KHGA 1HI8A 1NJIT 2WAQD 4JV0A 4BDPA 5HP1B 4H54A 2LQ9A 3E8OA 2R8KA 5D4OA 2AJ0A 3DRRA 1BD6A 2MMYA 4FYDA 2VPZB 3RBDA 2POKA 4FBTA 3HF5A 4WFZA 1KOHA 5D6GA 4J9PA 1S0OA 4ZLPA 1S1UA 4UW2A 4OI4A 2XGPA 1FT8A 4WKYA 3RAMA 2Z8QA 3DLGB 4RKUC 2D9OA 6FD1A 3T9ZA 3OFHA 4XDDA 5E3RA 4A8WA 2LEAA 3GFZA 3CD6S 1RT7A 2BE2B 4PG6A 5GAGI 2RUGA 3M9NB 3KLHA 1RKJA 2B6AA 1N52B 1VRTA 3PIPQ 4X4PA 2IBKA 3CULA 1Y3KA 4MYTA 1GQEA 2NPIA 3CDUA 3BO4A 3VAMA 5FJ4A 4RU2A 2M5YA 2XHWA 1XC9A 5AJ3F 3PW5A 3TOQA 3MOZA 5BR8F 3SSRA 1WEXA 2KZMA 2ILZA 3HI9A 2G0CA 4I68A 3V6JA 1GX6A 3TQ1A 2P6SA 1IBLF 3Q8QB 4TQSA 3V4IB 3ZZUA 2OMLA 1IJFB 3O44A 2EFPA 4MIBA 1IKYA 4EBDA 3NL0A 4ED3A 3T5HA 1U6ZA 4M95A 3KWMA 2D9PA 3ITHB 4L72B 1OPZA 2MGZB 2CJQA 4KC5A 4HKQA 3MD3A 4Y2MA 4HHJA 3VWSA 1D0EA 3DYAA 4FF2A 1Z2ZA 4WYWA 2MKJA 1TL4A 1HW8A 4HTJA 1XR5A 4LJMA 1XMOF 3ONQA 4J9SA 1QJHA 2RH3A 1U24A 1MNEA 1SUQB 3DRPB 1L3UA 2F7VA 1Q7LB 2JSXA 2RRAA 1E6VB 3MM8A 4X4SA 3RW6A 4IH6A 3V2UC 4V19J 1Y4ZB 3QIDA 4IDKB 4UOCA 4KV8A 2OH2A 2ATLA 2JEIA 3EGWB 1DAXA 3G86A 3CC2S 3CGIA 3LH2S 4ID8A 5DG7A 2J76E 2GHPA 4DL0C 3G71S 1Q8LA 3HHKA 5JUMA 4MK8A 4ZVHA 1V3RA 4PR6A 2N4DA 2CQ3A 1UP1A 1HW9A 2RSQA 3LP1A 3NCRA 3MTKA 1DFDA 5KFWA 2WB4A 1N0UA 1UEUA 1ZAVA 3PX0A 4JI2F 1X0FA 2HQIA 2C3UA 1KRPA 3RTVA 1S1VA 5EDWA 2QA1A 2R2UA 4IR1A 2HFNA 4LVOP 4WYLA 3MFHA 1JLCB 3B4MA 2EBEA 2KG1A 3U7JA 4TN2A 5AXKA 1M5PC 2XBPA 4QIEA 1RTHB 4PUOA 2CDQA 3GSDA 3WDOA 2OPSB 3IG1A 3M2RA 1SL1A 4CO2A 4R0JA 4UQGA 3KLIB 2LDYA 4K5RA 4P6QA 4EGLA 2E5LF 3IR7B 3EGZA 1W2BR 2A18A 3N9UC 2CQ4A 4RW7A 4OZNA 4M1KA 4DSEA 2D3UA 5KFHA 4J5OA 3H4DA 5JVHQ 1ZTTA 1YIJS 2QA4S 4AL6A 4KFBA 3M6WA 4J9OA 2XS5A 3P49B 2EG1A 1HA1A 3CDWA 5F8GA 4I2QA 3TO8A 4OZ5A 1KEKA 1FNXH 2FY1A 1LWFB 4NCGA 2R7UA 1URRA 1YQHA 5IT4A 2UXDF 4RU9A 4WZQA 2MZRA 3P5TL 4IFVB 4MTPA 1P27B 4CIOA 3IWLA 3B82A 1T8EA 3R27A 4KRWA 4ZMMA 3H5SA 1WHVA 5F41A 2A1BA 3ENVA 1VQKS 3MFIA 1S48A 2CQIA 4OJ3A 2KTQA 2CPXA 1LKZA 1TR0A 4K4WA 1RWUA 2RU3A 3DLJA 3QAEA 2NXUA 1IKXB 2NSCA 2K7KA 1WHYA 1FEEA 2HLTA 3TUZC 3BZQA 1N5SA 3KHRA 1S6OA 2L9NA 2VUGA 1KFSA 4RW4B 2XLKA 2EFNA 3IXQA 1S1TA 1FE0A 1QSSA 2XMWA 3OUYA 1R8CA 3GR1A 4ZS6A 5I3QA 4Q0BA 3AY0A 2VV5A 5KFIA 3SMZA 1HBOB 1CQMA 1UVNA 5KFXA 5L9NA 2ZH9A 1C4AA 1X0PA 2OLWA 3BS9A 1D9AA 1UEVA 2VG7A 5JXSA 2P6TA 4Q2MA 2XCAA 4DL7A 1PGZA 2LU1A 4OMFG 3Q8PB 2HQ3A 4OIXA 4Z37A 1BWEA 5KTQA 1HHSA 2WOMB 2O66A 3A8EA 4U7UK 2ALZA 2B7BB 1DHMA 2KI2A 1JNZB 1GX5A 2Z2MA 3M1VA 3TYTA 5B7WA 5SZTA 2VG5B 4DUYF 5DGAA 4QJVA 2M8DB 3DLEB 4XDCA 2V9KA 3SCLE 4YP3A 3IRWP 2XY6A 3POTA 2R7TA 3QZ7A 4OFZA 2FHJA 3FCHA 3H8YA 4ECYA 5KFMA 1RT3B 3HZEA 1RJJA 3TARA 2VOOA 2L3MA 2RQ4A 4RW9A 2IBOA 2L9WA 3TA1A 4FNIA 4ETZA 4DLGA 4PRFA 1GXUA 2FVQA 1HNVA 1WF0A 2X1FA 1EETA 1YI2S 2XWXA 3E2EA 4KAIA 1DTTB 2UUWA 3CCWA 3M2UA 2GO8A 4QZVB 4QBUA 2OP5A 2MQPA 3TRGA 1NK6A 5LXRA 3CWJA 3MUMP 4GMKA 1VRUB 3KMQA 3HVAA 3MGJA 5LJ3Y 2ZZNA 4PQUB 1NKCA 1X5TA 2BVZA 1S7HA 5CA5A 2IA6A 3PO4A 4O4GA 4FS1A 1VIXA 3UCZP 1WTBA 2KKHA 3G9CA 1QUPA 4PWDA 5FLXY 3HVRA 2IVFB 3RAQA 2OKQA 4DFPA 2FUG9 4GKKF 2DRBA 3V81B 2K3IA 2HIQA 3V6DB 4JI1F 1U1KA 4OI1A 2D1CA 2LMIA 1R8HA 1T02A 4FVMA 2BJEA 4WFYA 3RB6A 4QWDA 1NU4A 3NRBA 4TNOA 3TAMA 4DDFA 2LXUA 2GHVC 2DH7A 2PD1A 3DHWC 4C3MA 3PIOQ 2HVIA 4B9NA 2GIQA 2ZE2B 2KFYA 2R2RA 2R7QA 2YNHB 1VQ9S 1Y7PA 4N76A 2O1PA 1RTDA 2DNYA 4I6WA 2WSEC 4IQXA 3DOMA 3VAGA 5LMUF 3SCIE 3CD0A 1M1KT 4N5SA 1HMVA 2P9EA 3GWCA 3P6YC 2ZD1B 5KG2A 2Q66A 2K7JA 3S1TA 2DIVA 3MZIA 1C1CA 2YX1A 3NKYA 4NLQA 5AE2A 2QSWA 4U7CA 5E2QA 4DHVA 2DNQA 3FZ2A 4DFKA 1IKWB 1IKVA 1KLMB 3WC2A 1P8GA 1LWCA 2BW2A 4CH7A 3K5PA 5HMWA 5KFJA 1M5KC 1A7GE 3KJVB 5CYQA 2RE1A 3A1YG 3QYYA 2QEXS 3CVKA 4LSNB 4DQPA 5GADI 2EK6A 1URNA 4YB5A 1TV6A 4EO8A 5K14B 3MEGB 3FEXB 3SZ2A 1DLOA 4RWXA 1U7LA 3D0IE 5LXYA 4HEA9 3NGKA 2OTLS 4TU9A 3DLKB 3MUTP 2GQQA 2W9CA 1X9MA 2ACYA 1Z1ZA 1H2UX 2KXNB 2OPRA 4DL4A 3WBZA 4LIRA 4C4WA 2C3PA 1XR7A 2BABA 3R5AA 4UY85 5T14A 1VOMA 2LXFA 2RVJA 3DI6B 5AE3A 2LQ5A 3LP0A 4ED1A 5C42B 3D1HA 3K58A 3OR2B 3D5MA 4N8NA 2RRNA 1QE1B 2KM8B 2LVWA 2HRUA 4K4VA 5EHHA 5IT9Y 2W9BA 2MDAA 1G6BA 4RNHA 2BYCA 5KT3A 3FEYB 1VQPS 2RMLA 2HWTA 1S72S 4RW8A 3LP2A 3MR6A 1FKOB 1KS2A 3HHLC 2FC9A 4YB6A 3DXSX 1RI7A 3VZHA 4WFNQ 3BO2A 3EZUA 2VA3A 4C7QA 2NR0A 2V94A 2YKQA 3ICLA 5KFLA 1FHTA 1U1NA 3LGMA 1W2IA 2ABYA 2HHUA 2L9DA 3PW7A 4WE1A 5B08A 1F2GA 2B9XA 2X1GA 2CQPA 3I9ZA 1U26A 3E01A 3IR5B 2BXJA 2RILA 5J2PB 4WU2A 3EPGA 2DTJA 4QU7A 4WKRA 2BRKA 2JVOA 4ALZA 3P3DA 2GMLA 4DQIA 1B0TA 2CPEA 2ZDPA 3JSYA 2BBEA 3T5KA 3NBPA 4DSJA 4GC7A 1WG5A 3AJ2A 3M4XA 4ZK7M 5KFVA 4CTAA 3QWPA 2ZKTA 1O0PA 1YJRA 3HXMA 2AGQA 1JJHA 2QSFA 3VR1A 4KQZA 5CD4H 1HD0A 1S49A 2KRRA 2PC6A 4I56A 3MOJB 2HHTA 2D7SA 2E7WA 3VF0B 3RRGA 3TAPA 4WK1A 3T1YF 1IBKF 2ZH5A 5FD1A 1U1RA 3J81Y 2YH0A 3JAMY 1RP5A 4QW8A 2DH8A 3VAIA 1GH8A 3BGUA 1FXRA 4KE5A 3SDEB 1H38A 3DRXA 2LKZA 2IYIA 1BQNB 3NWGA 2PO4A 1HBUB 3FQKA 3RZAA 2GIRA 4DL2A 3JYTA 4DFJA 2HHPA 3I5CA 2DR7A 3PJWA 5DLFA 3C2PA 2ZH6A 3J7ZT 2HMIB 2ZUGA 4DV2F 3TANA 2LA6A 3I0SA 4LVNP 4JUZA 5EWGA 1LW0B 1X4DA 4K4UA 4YB7A 4EUVA 1U6BA 3TP2A 5CYMA 4IR9A 2F9DA 3THVA 3DMJB 1JLGB 1MWZA 3FQLA 3I6PA 3MPWA 1S97A 5A8WA 4IO9Q 4C8ZA 2ASLA 4QW9A 3KLFA 3JB9k 4ZP9A 1QAJA 3LUYA 1HPZB 2XMJA 4NCAA 1T3NA 2XB2D 2ZVSA 3L7PA 3MMAB 2RS2A 3I56S 4OL8A 4A47A 2F3JA 3L95X 3MEKA 1U1PA 2KO1A 1H2TZ 2RB7A 4ZOSA 5A8RA 1UJ5A 4I7FB 4JI0F 3DLBA 2NUHA 3C46A 4R0EA 3BQ1A 4PXDA 4C11A 4KKOA 5DQGA 2DBBA 2G4BA 1CC7A 3GZ7A 4NLVA 3SFUA 4J9NA 1ZM2A 3R1LA 5K8PA 4NX9A 1PILA 5DG8A 5F8MA 4X65F 3K5OA 3T3FA 1X4HA 2XLJA 1HWJA 3D1OA 3AB4B 3LQVA 2RDIA 4ATNA 5J2NA 4RUCA 3QZ8A 4X4QA 1QAXA 4CO1A 3Q8SB 2XMTA 2I9SA 3JSBA 4F4WA 4CO0A 3MECB 1N33F 2X51A 1B0VA 3C8YA 4P7VA 1FRKA 4PXEA 4JI8F 2C28A 4ED8A 3TX8A 1SV5B 1TL1A 2K2PA 3NCQA 2GQ2A 1Z4UA 1KTQA 3VZIA 1JXEA 3HDSA 1TKXA 2E7XA 3IS9A 3W2VB 2HGMA 4IG0A 1IUJA 1C4CA 2RQMA 5I4MA 1YJTA 3DGPA 2VQEF 2AD9A 3RB0A 5A8KA 5DETA 5DQIA 5A2QY 2MZJA 2DVIA 1I1GA 3PACA 2PMHA 5K8OA 2HHXA 2ZH1A 4ZHRB 2JEFA 4DR4F 1WHWA 3D0HE 1OSCA 1VK3A 1X4AA 1AFIA 2MQQA 4OX6A 4IRDA 1LFPA 1C0UA 2JWNA 1NHUA 3RRKA 4DL5A 3HHLA 1UWBB 4NLXA 4NXMF 1KN6A 4JI5F 2IHR1 4OZ0A 2N7CA 2ZH4A 5L1IA 2BACA 1KHWA 2ZJRQ 2J7KA 1CLFA