2RMMA

Solution structure of gb1 a34f mutant
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYFNDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of GB1 A34F mutant
rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
total genus 13
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rmmA00
2PW9A 3GB1A 5JXVA 2IGHA 4IOIE 1IGDA 1K50A 1C9FA 2N7JA 1UWXA 1YNTE 4D2KA 2NMQA 4OZBA 1D4BA 1FD6A 1MVKA 1JMLA 2GB1A 4KGRA 5BMIA 2ZW1A 1K53A 2KWDA 5BMHA 2ONQA 2LGIA 5BMGA 1P7FA 1YMHE 2JWUA 3FILA 2IGDA 1HEZE 1HZ5A 2RMMA 2KACA 1K52A 2LHDA 1FCCC 2K0PA 1ZXHA 1IBXB 1Q10A 4MACA 3MP9A 4HKZE 2N9KA 1EM7A 3UI3A 4IKGA 2KDMA 2IGGA 3FILB 2EELA 4KGTA 2I38A 5HHDG 1XF5L 1PGAA 1MPEA 2JU6X 2OEDA 2QMTA 1F2RC 1IBXA 4WH4A 1QKZA 1HZ6A 2LUMA 2I2YA 5HI1A 2RPVA 3V3XA 2J53A 4OZCA 4GLSC 1XCQL 1MHXA 2PLPA 1KH0A 5HFYA 2ON8A 4KGSA 2KN4A 1P7EA 2JSVX 1PGXA 1XCTL 5HG2A 1MI0A 2PTLA 1F2RI 1FCLA 4HJGE 2ZW0A 1K51A 1PGBA 2JZPA 2KQ4X 1IGCA 1MHHE 4OZAA 1GB4A 1GB1A 2GI9A 2JXTA 2QSDA 2LHEA 2J52A 2N9LA
chains in the Genus database with same CATH superfamily
2MJDA 4FXCA 3GB1A 4XDCA 4PYZA 4HROA 4W9CA 4B0EA 1ACCA 1FPYA 2LXCA 2NBVB 1TS5A 4JWSC 1XEEA 2BGFA 1P1AA 5BMHA 4RH6A 2RR9A 1V97A 1YIWA 1E6EB 4HPPA 4MSQB 2BBCA 3V6CB 3IXSA 1PFDA 4K3BA 4LNFA 3BVZA 2KQSA 2ZPYA 4RGMA 4W9HA 2AQ2B 3T8MA 5JH5C 1KF6B 2FCSA 4AJYB 4RGTA 1C1YB 5CTRC 5KHQA 1WGHA 2Y3AA 3BVMA 1JQ4A 4PS3A 2DWQA 2D10A 2L00B 2KC2A 1UH6A 2L3ZA 1ZXIA 3L4PA 1ZDXA 1V80A 4A6QA 4YL8A 4KSKC 5FR6A 1N5XA 4REZA 3R2TA 5HG2A 4EFOA 1MI0A 3R7QA 1NEKB 1QLBB 4KIKB 3C19A 3ZKJC 4TQ0A 2JZPA 4W9KA 1H8CA 3HHMA 3R3MA 1I35A 1N5WA 2CU3A 4DHJB 2SEBD 1BXTA 2KT7A 2NBWB 2QSDA 4FLHA 1LM8B 2R2QA 1WX9A 2WXMA 3N1YC 4TQ1A 4L2YA 1WXVA 2D3GA 2AX5A 2MP2A 4DWFA 4WJQA 3J9CA 1OGWA 3I5JC 4FHKA 4ANVA 4EE2A 1RLFA 3TEXA 4W9FA 2B3AA 4GSWA 3PVLA 3KW5B 2D3AA 3CF6E 5BMIA 1RAXA 4OHJA 1LQBA 3TL5A 2Y5CA 5FKAC 3PGEA 5AZFA 1S1QB 4YT0B 2KAJA 1UELA 1B1ZA 4RNAA 1GAQB 3R8BA 1QILA 2NTSA 3ZYYX 5EE1A 3NZSA 4Q2JA 1A5RA 4ANWA 2BVCA 2PIAA 2MBOA 4M01A 4NQLB 1FO4A 4N6EB 2WX1A 5IO9A 4P7IA 3SD5A 3I3TB 2MA9B 4EZLA 2D3CA 3EC8A 3ZIMA 1V1OA 1BMLC 1T0SC 1E90A 1HZ6A 2A5UA 1YJ1A 2DENB 3KYCD 2YLMA 2FUG1 2DNFA 3DHGC 1CJEA 1V8CA 3H1UA 4OZCA 2K6DB 2AQ3B 2N9PC 4EOYA 2X38A 1NBFC 4WIPA 4ANUA 1ENFA 2AEHA 1EUVB 2RD0A 5CX3A 3Q14C 1A70A 1ZKHA 1QOBA 3ALBA 1HA5A 4LNKA 1WY8A 5J18A 3ZRCA 3R7RA 3A33B 4OW0A 5IA7A 4OVVA 2V3NA 2PEAA 1B9RA 2JRHA 1ZGUB 2INPE 3A9KA 2L1AA 3ZTDA 2J0KA 1KLUD 2VZKD 2PW9A 2ZCBA 4G0NB 3LJ3A 2X8XX 1K50A 1E7UA 2EMTA 3CWIA 2FNJB 2DX5B 1V5OA 3VFKA 3AE8B 3AE4B 2GBRA 2ZW1A 1WZ0A 3ZDMC 1EF1A 4ASWC 1V6EA 3RNCC 3P4RB 4IWPA 1HTQA 1QF6A 2IO0B 1FNUA 1TY2A 3DQVA 2GOWA 4YSZB 2J0JA 4P6VF 3U4EG 1NI3A 1R4MB 4BOZB 1L4DB 2QJLA 2WGSA 2AL3A 2M56B 3VTVA 3AEGB 2ASQA 2HE7A 2I1KA 4DDGD 5FK9C 5BO4B 3GE8C 4C56C 4W9GA 3SFDB 3MTNB 1FXTB 2KC1A 2NCNA 4ZDVA 1ZP0B 4WQOB 5HI1A 3QHTA 2FE8A 1KLGD 2MLBA 3BZDB 3C8YA 3AU5A 1VJKA 4LK0M 1NVID 2NS5A 1J7AA 1XCTL 2BQQA 1L2NA 1HQRD 2GBNA 2JY6A 2BWES 2PMVA 3Q3FA 3Q8BA 2GMIC 3VHTC 5D6JB 4DXAB 1H4RA 1C3TA 4MGZE 1D5MC 2GI9A 2ZVOA 4CYEA 4US8A 5FR3A 3MHSD 1XQQA 3NS1A 3HRDD 4JPSA 1F52A 3IBEA 3U52E 3U2SC 4CO7A 2JYEA 4M00A 4BBNF 2IPKD 1YNTE 3URYA 4BVUC 2A4ZA 3FC4A 3ZVVA 1J7BA 1TKEA 1F1HA 2IDYA 4R3DA 1FIQA 1MVKA 1N63A 1VR9A 3TJPA 4B9KA 3AH7A 3ZW3A 5BYQA 3MC8A 3E56A 1F0ZA 3MJWA 4G11A 3RNBC 4YTPB 1WJNA 2IGDA 5AUIA 3PRZA 2PE9A 5CHFA 4A55A 4XE0A 3UF8A 2G45B 4EZKA 4C7YA 3N1ZC 3V60A 3X23A 2O6VB 2Z8LA 4E3CA 2W54A 4LJOB 2UYZB 1E8XA 3MP9A 4KDLB 3ZNZB 1QOAA 2K22A 3BY4B 1XF5L 2JVCA 1WX7A 5G5GA 2L76A 3OWEB 4EUTA 2L0FA 1YX6B 2WXIA 3L0WB 2KJ6A 2L32A 2W9NA 2I2YA 2RPVA 5KHOA 4K81A 2MSED 2JYTA 1VZ6A 4ZRQA 3CIRB 4KGSA 2IJ0A 3SFEB 3U8ZA 1WX8A 4HEA1 2K3UA 3ZJTA 2OJWA 3ETRA 3AE1B 1BUIC 4OZAA 2DZJA 4AS1A 3P42A 2KNBA 2O2VB 3W9CB 4ARCA 4C4VA 1ESFA 3PRMB 1JWUD 3QARA 1C4PA 4JE3B 4PS7A 1UF0A 5JXVA 2NPTA 3ZXRA 4MH8A 2LMCA 4MEMA 3PPAA 3BK1A 1D5XC 3IT4B 3H7SA 3OG5A 4EKUA 4HPLB 4BOSC 2BYFA 3ZTCA 4MJSB 2WXHA 3ONSA 1FFUA 5I4DA 2WXJA 3ZJVA 3Q69A 1WMHA 3VDZA 1QZEA 1SE4A 3AECB 2MBHA 3ZQ4A 1N61A 3BIID 3KUCB 4KIKA 3AM9A 5H8YE 1EU3A 1WGYA 1E5WA 5AZHA 4LLGM 1VRAB 2LASA 2KD0A 2FIDA 2KDMA 1XLQA 3FILB 1CQVA 4AOFA 3DBLB 3OJ4B 4BKGA 2BS2B 5EDSA 1E8ZA 3AB5A 1F2RC 4FULA 4JL9A 4M0WB 2KTRA 2CS4A 3AEDB 2WXOA 2QEJC 3DWGC 2J53A 1ET9A 1E8YA 1NDDA 4MGYE 2CHZA 4YTNB 1WJ6A 1GOZA 1C78A 3IT6B 2PLPA 5G55A 2ON8A 2CHXA 1Q0WB 1N62A 3BVGA 2FUHB 3H9DA 1GNUA 3PO0A 3WIMA 2KTRB 1TY0A 2K25A 2PVOD 3B0AA 1IGCA 3KVFB 2MEKA 4G50A 2RGFA 1V2YA 1YN3A 1JRPA 1U4AA 2JXTA 2W82A 4US9A 2ZNVC 3UQBA 1V9JA 2J52A 3DVGX 2WDRB 3NHEB 4HPMB 2DYOA 3PSEB 4WWOA 4WWNA 3WAPA 3M95A 3BINA 4WWMA 2QCZA 2V9HA 2OJRA 1FD6A 1L7YA 4LNIA 2MBBB 3EGRA 1EO6A 1TBEA 4KKIA 4ANXA 2RDGA 1Z5SB 2ZCCA 5E6OA 1ZOYB 5BMGA 4DHZB 1RWSA 4NAMA 4USAA 2RMMA 2KACA 1LXDA 3P4QB 2C7MB 3MJ5A 2C7HA 4JIOU 1ZXHA 1IBXB 2V4LA 1TS4A 2JXXA 3NRZA 2W3SA 4BBNC 3GOEA 1RFAA 2Y5BB 5C23A 3DBSA 1WSPA 3JYUA 2Z59B 5CHWA 1AW7A 4ZRIA 3L16A 1WYWB 1L6VA 1JRUA 3AE6B 1ZUD2 4ZYNA 2K1FA 2PTLA 2G4DB 4C7ZA 3VAWA 2KLCA 3PZDA 3NVWA 1R4MI 3VRBB 3DHHC 1PYWD 4XZ4A 1GB4A 2LJIA 3TMPB 4A20A 3FAHA 2LXAA 2KDFB 1VD2A 2KJHB 1YD8U 3W2DA 1I4PA 2OOBB 3DVNU 2WDTB 3FKYA 5DCNA 1V1PA 1ET6A 3ZLZA 4IUMB 5E6PA 2KXJA 3DBHB 4XDDA 2PPHA 4ICUA 1EU4A 3Q8CA 2CJNA 2WS3B 1PQSA 2KWDA 4AP4C 5J17A 4HCPB 4RGNA 2IO2B 1L0VB 3KWLA 1YJIA 3QK0A 2KKCA 3AU4A 2JWUA 3T9LA 5IN7A 1L0YB 2UU7A 2CJOA 4AUQC 1FCCC 1UD7A 4C00A 1YN4A 4IDIA 1JWBD 4XX5A 1EM7A 1TS3A 3BYYB 2K5PA 2WYQA 4F1SA 2BWFA 3KUDB 5G2NA 4YXDB 4KSLC 1PGAA 2H89B 3ZO5B 3ZRFA 3M3JA 1T5XD 4WH4A 4YSXB 2BTEA 2QILA 4IG7B 1QOGA 2XK5B 3CMMB 3VH3B 4A3OA 2INDC 1MHXA 2KFKA 3QCAA 2INNE 1XLOA 3OJ3A 1JROA 2MHJA 3T3OA 1BT0A 3JVZX 2IO3B 1GUAB 2MH7A 3MFGA 4ICVA 2J0MA 1WYGA 1J19A 2KQ4X 3DOWA 4C80A 2N9EB 2Z0EB 3N32A 1LO5D 2Y5PA 3N20C 1XLPA 3M63B 2DZKA 1P3QU 1OQYA 3ENEA 1FXIA 3P4PB 1MG4A 3U30A 5DPSA 3PZ7A 3IAM1 2EMSA 1HXYD 1YJJA 1WR1A 5GXGB 4MM3B 1TS2A 3NOBA 3Q3NC 2KLGA 1D5ZC 3RZFA 3TCAA 2K8BA 5TSSA 3L10B 1SEBD 4X57B 1V1PB 3RFZB 2G3QB 3KLSX 4DHZE 1E10A 4GDLA 5GMVA 3ZXVA 2B76B 1PUTA 3AEBB 3AXCA 2GBKA 1FNWA 5TR5A 2KDBA 4HLEA 3RI7C 1D3ZA 4I6LB 4RGOS 4WWPA 5MPOA 2R2OA 3APDA 3LYYA 4NJ6A 1WE6A 3UI3A 1WWTA 1MJDA 3A4RA 2XK5A 1TJEA 3BWUD 1WXMA 2LGXA 4URKA 2GBJA 2JPHA 3WANA 2WXKA 4WJPA 2LUMA 2CHWA 3V3XA 3RCZA 2HDEA 3P4SB 1YQ3B 3EFCA 3IVFA 5DPWA 2K8CA 3AV8A 2ZEQA 4N9F4 4ARIA 4W9IA 2LWPA 3TSSA 2AYOB 1SE9A 1T0RC 1SE2A 2D07B 3A9JB 4CHKA 5JZEB 3EUB2 4KVGB 4KZCA 5LXHA 4M8NA 4PYUA 2NPTB 3IFWB 2JF5A 2C7NB 1WGDA 1YN5A 3H6NA 3MC9A 3W1SA 1E0ZA 3QJZA 2N9LA 4A90A 2LFIA 4IOIE 4MGKE 1VZ7A 3WALA 2M0AA 1XO3A 1Z2MA 2M4NA 1N60A 1KM7A 1HE8A 2N0SB 4PS8A 3TBLD 2K6QA 2GB1A 4KGRA 1OQQA 4J6IA 4K7SA 1WJUA 1ZDVA 1WRIA 3K9PB 3MC0B 4FBJB 2QHOA 2O6VD 1VDVA 4XYCA 5EE0A 1TIFA 1JWMD 1P98A 3L54A 3AE3B 4IWQA 3VUXA 2WLBA 5BYRA 3NZ3A 4XWWA 1I4GA 1UNSA 5D94A 3NVYA 1WJ4A 2BKFA 2K8HA 4HDOA 3L17A 2GBMA 3S2AA 2N9KA 1VLBA 2W55A 2N1WA 3Q8EA 4NY0A 3LB8C 1F9JA 2MQJA 3JSVB 2IO1B 5T8IA 2MBEA 3ABVB 1YOVB 3AE9B 4FJYA 4P16A 4JGHB 2KX3A 1OQRA 1V86A 2BT6A 1MFWA 1SGHA 1OEYJ 3PT2B 4P1BC 1KH0A 2KN4A 2C60A 1F2RI 3H8HA 4JLCA 3RZWC 3O13A 3APCA 2C5LC 3DVNV 3UQAA 4NAWA 4QAYA 2CU1A 3P63A 1J7CA 1R7SA 3DBHI 1TYGB 3B08A 2CKHB 3TEZA 4KZ0A 4RF0A 3NZUA 2DLBA 1D6EC 4W9DA 1WE7A 2WU2B 1I42A 3RMKC 2FBWB 1WXQA 1OEYA 3A1QA 5D3DA 2V4IB 3GS2A 2BB5A 3IG3A 4K7UA 4RFBA 3PHWB 1L6UA 3QWZB 1CZPA 3Q3MC 2KX0A 1LGRA 1T3QA 3ZUNA 4ACFA 2HD5B 3A1QB 3DCGA 4WAFA 1P7FA 3RD2A 4GGQA 4DXGA 1HEZE 3PZ8A 1UUPA 1IPGA 1P0RA 1WXSA 1TKGA 3AEEB 3VR9B 2WXLA 2L8JA 2DAFA 3PV1A 3DDCB 1QT9A 1SSNA 3KYDD 1N6ZA 2L7RA 2KFJA 4YWGG 2MJ3A 1UGJA 4WQMA 1XT9B 2WP9B 1WGKA 1KJTA 2D11A 2WXQA 3DVGY 5AEKB 1F77A 4FN2A 2VZKB 1TTNA 2NR2A 2M8SA 4FA6A 3ZJUA 4OVZA 1FRDA 3W1SC 4O1NA 5IP4D 4A3PA 2QDFA 2W3RA 4HJGE 1DOXA 2ZW0A 4HVBA 3NUHB 1GPXA 1JWAD 4E74A 3M62B 2Z0DB 4HJKA 4MH0E 3DPDA 2IYDB 4TKNA 4P1CC 3MHZA 2LJ5A 2G9HD 2V3PA 4DDID 5HKHA 3LDZE 1L0XB 1G6JA 1SF0A 3PRPB 1C9FA 4GDLB 2AWTA 2KMCA 4GIVA 3PLUA 3AN1A 2LVOA 4NJCA 4FJVB 4EEWA 4S0RA 1V81A 1ISNA 3KWVA 2KZRA 1C76A 2GLSA 2BB6A 2WX0A 1YX5B 2M17A 4JWUC 4GOCA 2PJHA 3HUIA 1HZ5A 1XXGA 1T0QC 2WXFA 1T6BX 2LHDA 2K0PA 3L08A 4IWOA 1AWDA 1EWYC 1KRHA 4I6PA 3DBLI 4GU2A 1XD3B 5LNK1 3PTFC 2IGGA 3APFA 1OTRB 2LGDA 2I38A 3I57A 3HIZA 4GMVA 4RM9A 2LGYA 2MRPA 2OEDA 1E9MA 3Q6BA 1M4VA 2RSUA 3QX1A 4B0MA 2BS3B 3GZNB 1V5TA 2VH2A 3SHQA 1L4ZB 4DK5A 1S3SG 2MX2A 3KH0A 5C1ZA 5JHAA 4GDKB 4NAWB 1WXAA 1IP9A 3VXWA 5DPTA 2HTHA 2KK8A 2NVUI 3WAMA 4EZJA 5AUKA 4DHJD 2ZNVB 3AE5B 3AE7B 2IBIB 2LI5A 3ML8A 5J2RA 4KV2A 1FNVA 2REXA 5G5HA 2M19A 1FFVA 2KOXA 3RUIB 2VH1A 4N58A 1C4CA 2KO3A 1RYJA 3WAOA 3QC8B 2BYTA 2ICIA 4HWIB 2JT4B 1WRDB 4LNNA 2NMQA 3Q3JA 1TZ1A 2BYVE 4OZBA 1SJED 4ZRKA 4H2AA 1I4RA 1JMLA 1JALA 3TIXA 2IY0B 3VTUA 2JX5A 1K53A 2AQ1B 2WWZA 4GN1A 1SXTA 2ONQA 3I63C 1XLNA 1SB3C 2RDBC 2ZJDA 4LJPB 4TSSA 5EE9A 3EHVA 1FEHA 2L52A 1DOIA 4DBGA 5LLIA 2DHZA 2KYWA 3O65B 3HVDA 2FAZA 1GC7A 3IHPC 4G3XB 3RNAC 1WH3A 4RF1A 1TKYA 1GC6A 3B2GA 1MG8A 3W5VB 3NVZA 4ZRJA 2K9XA 1SIFA 3B1LX 4RM8A 1MPEA 2JU6X 2WDQB 2MBQA 2DZIA 3Q3OC 3X0WA 3ZNHB 4BKTA 3PHXB 1VCBA 2XEWA 4XGAB 1WR6E 2JQRB 4DXFA 1IUEA 2JSVX 1PGXA 3V6EB 2BF8B 2KDEB 1SIJA 4TUUA 1GJZA 2JZZA 4E71A 4S17A 2CR5A 1FXAA 2RDHA 2KVZA 3SU8X 1NENB 4LDTB 4MJSA 2J4XA 4IC7B 1R4NB 1RM6C 3Q8AA 3C0RB 2DYMA 4FHJA 2E3TA 3IAS1 5IKCM 3N30A 1I7HA 1WF9A 2JWZA 4HK2A 2YEPF 1DOYA 4K1RB 2NBUA 2QIEB 2LRWA 1TZOA 3RT3B 4NQKE 4D2KA 1KTKA 1J8CA 4WJOA 3W5UB 4ZYSA 3UGBB 3NG0A 4AJWA 2DYBA 2JRIB 3P2BA 3PREA 3T3NA 5DPRA 2GRIA 4MDKE 2E6XA 2H88B 1DGJA 1NYQA 1SBBB 3Q8FA 4LCDE 1YMHE 2XBBC 2J42A 5L83A 4K7WA 1T0YA 3W1YA 2XNAC 2R61A 4B95A 1CK1A 2FCQA 4F8CB 3R2IA 3RYTA 2UWQA 2KMMA 1C79A 2N9XA 1C77A 4KGTA 1C4AA 4LNOA 1KOTA 4MT5A 2XN9C 3OLMD 4WAAA 4W9JA 2D5GA 3VVWB 2LUEA 3BYTB 1WIAA 1PDXA 4II2B 1V49A 1QKZA 3AE2B 1CMXB 1I4XA 2FCNA 4II3B 4AWJA 2KJRA 1UWMA 3RNGC 1AARA 1DYQA 2RPQA 4UDUC 3NS8A 2MJEA 3K9OB 3VUYA 3DBRI 3P1MA 2WXPA 1E7PB 2LEKA 2PVGC 1PGBA 5H92C 4FJZA 4WURA 2HJ1A 4BKSD 1GB1A 2BYEA 1STEA 2IY1B 4YTMB 4GXBA 4TMAB 4K3CA 3GP7A 1TGZB 2O6VA 3RN9C 2V1YA 4ZRPA 3ZDTA 4GB9A 2D3BA 3KUZA 5C2TB 3KQ4A 4PT5A 2KFKB 2N7EA 2KHWB 3GZNI 4J3OD 2N1VA 3A9JA 1D4BA 4MELA 3PLVA 4C4VB 3U7DA 2J7QB 3OAWA 4NJ7A 1JCKB 1Y8RC 2LRUA 3N3KB 2LGIA 1UBIA 2SAKA 3PS6A 1ZE3D 1J0GA 4CQNA 2DBYA 2KWCA 3GE3C 3AEAB 2ZVNA 1JW9D 1WGGA 2C9WB 1Q10A 4L1BA 4TV3A 1WI0A 2FIFA 2KWUB 2KN5A 3I9V1 4DQOC 4HKZE 2G1EA 4HKQA 3EFUA 3VR8B 3TEYA 2JZ3B 1HTOA 3SR6A 2DAJA 5CHVC 1KFYB 3V05A 2KMAA 2L0TA 3SEBA 4HDQA 4XC2A 2YEPB 3SDLC 3H7PB 2Q5WD 1K8RB 2KQ7A 1WZ3A 4BAXA 4MSMB 3QQ8B 3JSVA 4HRSA 2WU5B 1L5PA 4MM3A 3VUWA 3AULA 2PKOA 1TT5B 3VTWA 3NVVA 3WCQA 4M0WA 1YQBA 1WM2A 4YSYB 1UGMA 3B9JA 2WDVB 1WFYA 2IGHA 2BS4B 3D32A 2ZPNA 2WXRA 5E6JA 3V61A 2G4SA 3CSTA 2D2QA 2V3SA 4M02A 5D3IB 1P9DU 3H7PA 3QAQA 4W9LA 2BPSA 5LXIB 1EF5A 1Q1OA 1R4NI 1RRBA 3EA6A 2MW5A 4KX6B 3FILA 1QQRA 5L95C 4HCNB 2KVRA 2LD9A 1K52A 3TEWA 4OVUA 2AL6A 2M1MA 4BKSA 4L23A 1M94A 1FRRA 3AI5A 3DBRB 5E6NA 2EKIA 2BKRB 3QA8A 4I6NB 5AZGA 1Y56A 4IKGA 2TSSA 5C3JB 4MGIE 3B2FA 1LFDA 2EELA 2KTFA 5HHDG 4NPNA 3JW0X 3VRAB 1YQ4B 2VRRB 3R66C 2EKEC 4NNJB 2HJ8A 3UINB 1IBXA 2KWVB 1KLVA 1WM3A 5JHBA 4FADA 1SE3A 2PE6B 3AMZA 2I1JA 1P7EA 2M0XA 4HXDA 3TUOA 4W9EA 1NI2A 2JUOA 4JQWC 2WHIA 4A8XC 1K51A 1OFFA 3VQIA 1MHHE 2ACZB 2DZMA 2V0GA 4JX1C 3VH4B 4KDIC 4AQ7A 2LHEA 2YVCA 2LGSA 1I4QA 1IGDA 4A9AA 3ZGZA 3WA0A 2N4FA 1E7VA 2N7JA 4IM3A 3EECA 1UWXA 2HTME 2LZ6A 3CSFA 2NTTA 3UIOB 2ZZPB 1FMAD 1AYFA 4NZLB 3ZNID 3A9KB 1GG3A 3LXFA 3N9YC 3BK2A 3RULA 2QC8A 1ROEA 4IW0A 2KDIA 3AEFB 1E8WA 1WGRA 3V62A 3ZNGC 3RNEC 3A4SC 5EE3A 4BFRA 4M8MA 2MP2B 3HM3A 1IYFA 1NYRA 1JWSD 3UIPB 2KANA 2L05A 4BZAA 5IOIA 5D7GA 4RMAA 1SJHD 3RNFC 2IZVB 2LVPA 4F7ZA 4XWTA 5BYSA 2WQYB 3HK0A 1VZ8A 1ZPSA 1ZW7A 4PK1A 3ML9A 2MWSB 4ZHPA 2QMTA 2WXGA 4GDKA 1AN8A 4ZHOA 2N7DA 2OHFA 2O2VA 3RPFC 1WMHB 4RCOA 3HM6X 2FCMA 1QOFA 1RFKA 4GLSC 3NJTA 5IAAC 1Q5WB 4WJNA 1XCQL 2L83A 3ECIA 4B6WA 1FM0D 5HFYA 3U7ZA 1I4HA 4LDTD 1X1MA 1FCLA 3NY5A 4KKJA 3QIJA 1UZXB 2WNMA 4IM2A 2WXNA 3E9SA 3DHIC 3L13A 3HVZA 2MCNB 3Q2AC 4IM0A 2K39A 4ZOHC 4N59A 4LTUA 1UBQA 5D2MB 4ITKA 3N1XC 2BW2A 1EWCA 3DWMA 4MACA 2INCC 2LVQA
chains in the Genus database with same CATH topology
2MJDA 4FXCA 3GB1A 2LFIA 4A90A 4XDCA 5JXVA 2YEPF 1DOYA 4IOIE 2QIEB 4MH8A 2LMCA 1VZ7A 1TZOA 3BK1A 2M0AA 4D2KA 1KTKA 4HROA 1XO3A 3W5UB 4B0EA 1N60A 1D5XC 4ZYSA 1ACCA 2N0SB 3IT4B 2GB1A 4KGRA 1OQQA 1TS5A 3T3NA 4JWSC 2GRIA 1XEEA 2E6XA 5BMHA 1ZDVA 2H88B 1WRIA 1DGJA 4RH6A 2WXHA 1FFUA 1NYQA 3MC0B 5I4DA 2WXJA 1SBBB 1V97A 3Q8FA 3ZJVA 1E6EB 1YMHE 1VDVA 3Q69A 5EE0A 1JWMD 2J42A 2BBCA 3IXSA 3AE3B 1PFDA 2WLBA 1SE4A 2XNAC 5BYRA 2R61A 3AECB 3ZQ4A 3NZ3A 1N61A 1CK1A 1I4GA 1UNSA 4XWWA 3BIID 3BVZA 3NVYA 3R2IA 4RGMA 3AM9A 5H8YE 1EU3A 2AQ2B 4LLGM 1VRAB 2KMMA 1C79A 1KF6B 2N9KA 1VLBA 1C77A 2W55A 4RGTA 3Q8EA 2KDMA 1XLQA 3FILB 3LB8C 4KGTA 1CQVA 1C4AA 2BS2B 2Y3AA 4MT5A 3AB5A 2XN9C 3BVMA 1JQ4A 1F2RC 2D5GA 3BYTB 1PDXA 5T8IA 2DWQA 3ABVB 3AE9B 4P16A 3AEDB 1QKZA 2QEJC 2WXOA 1ZXIA 3AE2B 3DWGC 2J53A 1I4XA 1OQRA 3L4PA 1ZDXA 1ET9A 2BT6A 1UWMA 4A6QA 1DYQA 4YTNB 1GOZA 1C78A 3IT6B 1N5XA 4REZA 2PLPA 4UDUC 3R2TA 1KH0A 2ON8A 2KN4A 1N62A 2MJEA 5HG2A 1MI0A 3BVGA 3P1MA 1F2RI 2WXPA 1E7PB 1NEKB 3H8HA 3PO0A 1QLBB 2LEKA 3O13A 1TY0A 2PVGC 1PGBA 2PVOD 5H92C 4TQ0A 2JZPA 1IGCA 4WURA 2MEKA 3P63A 1J7CA 1N5WA 1R7SA 2CU3A 1TYGB 1YN3A 1JRPA 1GB1A 3TEZA 2SEBD 4RF0A 2DLBA 2JXTA 4US9A 2W82A 1STEA 4YTMB 1BXTA 1D6EC 2QSDA 4TMAB 2J52A 2WXMA 2WDRB 3GP7A 2WU2B 4TQ1A 4ZRPA 4L2YA 2DYOA 2FBWB 1WXQA 2AX5A 5C2TB 5D3DA 2V4IB 3GS2A 3J9CA 3KQ4A 4PT5A 4WWMA 2BB5A 4EE2A 4RFBA 4J3OD 1D4BA 3TEXA 1FD6A 1L6UA 1CZPA 3EGRA 1T3QA 5BMIA 4KKIA 4OHJA 1JCKB 2RDGA 2Y5CA 5FKAC 1ZOYB 2LGIA 5BMGA 2SAKA 4YT0B 4WAFA 1P7FA 2KAJA 1RWSA 1ZE3D 4NAMA 1B1ZA 4USAA 4DXGA 1HEZE 3PZ8A 1GAQB 4RNAA 4CQNA 2RMMA 3R8BA 1QILA 2KACA 2DBYA 3P4QB 2NTSA 3AEAB 3MJ5A 3ZYYX 1UUPA 5EE1A 1JW9D 1ZXHA 1TKGA 1IBXB 1Q10A 4L1BA 3AEEB 3VR9B 2WXLA 4Q2JA 1QT9A 1TS4A 3I9V1 1SSNA 4DQOC 4HKZE 2G1EA 3NRZA 4HKQA 2PIAA 1FO4A 2W3SA 4N6EB 3VR8B 4YWGG 3TEYA 2MJ3A 1UGJA 4WQMA 1V1OA 3SR6A 1BMLC 2WP9B 1WGKA 1HZ6A 2WXQA 1WSPA 2FUG1 1F77A 1CJEA 1V8CA 1KFYB 4OZCA 1AW7A 2VZKB 3V05A 2AQ3B 2X38A 4WIPA 3SEBA 1L6VA 3AE6B 3ZJUA 1ENFA 1ZUD2 2YEPB 4OVZA 1FRDA 2PTLA 1A70A 4O1NA 1QOBA 1HA5A 2W3RA 4HJGE 1DOXA 4C7ZA 2Q5WD 2ZW0A 3NUHB 3NVWA 1GPXA 1JWAD 3VRBB 4OW0A 1PYWD 4HRSA 2WU5B 1L5PA 1GB4A 2PKOA 2LJIA 2V3NA 1B9RA 3FAHA 2INPE 3MHZA 2L1AA 3NVVA 3WCQA 4M0WA 2G9HD 2V3PA 1I4PA 3W2DA 4YSYB 1KLUD 2VZKD 3B9JA 1L0XB 2WDVB 2PW9A 1SF0A 2IGHA 1V1PA 1ET6A 1K50A 1C9FA 2BS4B 4GDLB 4XDDA 2WXRA 5E6JA 3CWIA 1EU4A 3AN1A 4NJCA 3Q8CA 2CJNA 3AE4B 3AE8B 2WS3B 5D3IB 2ZW1A 3KWVA 2KWDA 1C76A 2BB6A 3EA6A 3P4RB 1QF6A 4RGNA 1FNUA 1TY2A 1L0VB 4JWUC 3KWLA 1YJIA 4YSZB 2JWUA 4KX6B 3FILA 4P6VF 3U4EG 1QQRA 3HUIA 1L0YB 1HZ5A 1XXGA 2WXFA 1NI3A 1K52A 2CJOA 3TEWA 1T6BX 2LHDA 1FCCC 1L4DB 2K0PA 1YN4A 2QJLA 2M56B 1AWDA 4IDIA 4L23A 1EWYC 1KRHA 1FRRA 1JWBD 3AEGB 2EKIA 1EM7A 1Y56A 5LNK1 1TS3A 3BYYB 5FK9C 4IKGA 2TSSA 5C3JB 2K5PA 3B2FA 2IGGA 2EELA 4C56C 2I38A 3I57A 5HHDG 3SFDB 4YXDB 3VRAB 1PGAA 1YQ4B 2H89B 2OEDA 1E9MA 1M4VA 4B0MA 1IBXA 1T5XD 2BS3B 4WH4A 4YSXB 1ZP0B 2BTEA 1L4ZB 2QILA 5HI1A 1QOGA 2FE8A 1KLGD 1SE3A 3BZDB 3C8YA 1MHXA 1VJKA 4LK0M 1NVID 2INNE 4GDKB 1XLOA 3AMZA 4NAWB 1P7EA 1J7AA 3TUOA 1XCTL 1JROA 5AUKA 3T3OA 1HQRD 4A8XC 3AE5B 3AE7B 2MH7A 1K51A 1OFFA 2PMVA 3MFGA 1WYGA 2KQ4X 3VQIA 3Q8BA 4C80A 1MHHE 2ACZB 1FNVA 1LO5D 5G5HA 2V0GA 2Y5PA 2M19A 1D5MC 2GI9A 1FFVA 4JX1C 1XLPA 4US8A 5FR3A 4AQ7A 1FXIA 3P4PB 2LHEA 4N58A 3PZ7A 3NS1A 3HRDD 1C4CA 3IAM1 1RYJA 4JPSA 1I4QA 2BYTA 3U52E 2ICIA 3U2SC 1IGDA 4A9AA 3ZGZA 1HXYD 1YJJA 2JYEA 2N7JA 2IPKD 5GXGB 4MM3B 1TS2A 1UWXA 1YNTE 2HTME 3URYA 2NTTA 3FC4A 1D5ZC 2NMQA 1J7BA 4OZBA 1FMAD 5TSSA 1TKEA 2IDYA 4R3DA 1SJED 1AYFA 4NZLB 1SEBD 4H2AA 1FIQA 1I4RA 1V1PB 3RFZB 1MVKA 1N63A 3LXFA 1JMLA 1JALA 3N9YC 3BK2A 1VR9A 3KLSX 1ROEA 2JX5A 3AH7A 1K53A 2AQ1B 3AEFB 5BYQA 3E56A 1SXTA 2ONQA 1F0ZA 1E10A 1XLNA 1SB3C 4TSSA 5EE9A 4YTPB 2B76B 1PUTA 3AEBB 2IGDA 5EE3A 5AUIA 1FNWA 4A55A 4XE0A 4RGOS 1FEHA 4C7YA 2L52A 5MPOA 1DOIA 1NYRA 1JWSD 2Z8LA 3HVDA 4MACA 2W54A 3LYYA 5D7GA 3MP9A 1SJHD 3UI3A 1WWTA 1TKYA 4RF1A 3B2GA 3W5VB 1QOAA 2K22A 3NVZA 4XWTA 5BYSA 2WQYB 1VZ8A 1ZPSA 2K9XA 1XF5L 1TJEA 3BWUD 1MPEA 2JU6X 2WDQB 4ZHPA 2QMTA 5G5GA 2WXGA 3OWEB 1AN8A 2WXIA 2WXKA 4ZHOA 2L32A 2LUMA 2OHFA 3RPFC 2I2YA 2RPVA 4RCOA 3V3XA 2HDEA 3P4SB 1QOFA 1YQ3B 1RFKA 4GLSC 2JQRB 3AV8A 1XCQL 2L83A 4ARIA 2JYTA 1FM0D 1VZ6A 4ZRQA 4DXFA 5HFYA 3CIRB 1IUEA 4KGSA 3U7ZA 2IJ0A 2JSVX 1I4HA 1PGXA 3SFEB 3TSSA 1FCLA 1SIJA 4KKJA 4HEA1 2WNMA 2K3UA 1SE2A 3ZJTA 2WXNA 3E9SA 3ETRA 3AE1B 3EUB2 3HVZA 1BUIC 4OZAA 1FXAA 4AS1A 2RDHA 3P42A 4ZOHC 1NENB 4LTUA 4N59A 2J4XA 3W9CB 1RM6C 4ARCA 2BW2A 3Q8AA 4ITKA 1EWCA 3DWMA 2DYMA 1ESFA 1YN5A 2E3TA 3IAS1 1JWUD 1C4PA 3W1SA 4JE3B 1E0ZA 2N9LA 1I7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PW9 A;  3GB1 A;  5JXV A;  2IGH A;  4IOI E;  1IGD A;  1K50 A;  1C9F A;  2N7J A;  1UWX A;  1YNT E;  4D2K A;  2NMQ A;  4OZB A;  1D4B A;  1FD6 A;  1MVK A;  1JML A;  2GB1 A;  4KGR A;  5BMI A;  2ZW1 A;  1K53 A;  2KWD A;  5BMH A;  2ONQ A;  2LGI A;  5BMG A;  1P7F A;  1YMH E;  2JWU A;  3FIL A;  2IGD A;  1HEZ E;  1HZ5 A;  2RMM A;  2KAC A;  1K52 A;  2LHD A;  1FCC C;  2K0P A;  1ZXH A;  1IBX B;  1Q10 A;  4MAC A;  3MP9 A;  4HKZ E;  2N9K A;  1EM7 A;  3UI3 A;  4IKG A;  2KDM A;  2IGG A;  3FIL B;  2EEL A;  4KGT A;  2I38 A;  5HHD G;  1XF5 L;  1PGA A;  1MPE A;  2JU6 X;  2OED A;  2QMT A;  1F2R C;  1IBX A;  4WH4 A;  1QKZ A;  1HZ6 A;  2LUM A;  2I2Y A;  5HI1 A;  2RPV A;  3V3X A;  2J53 A;  4OZC A;  4GLS C;  1XCQ L;  1MHX A;  2PLP A;  1KH0 A;  5HFY A;  2ON8 A;  4KGS A;  2KN4 A;  1P7E A;  2JSV X;  1PGX A;  1XCT L;  5HG2 A;  1MI0 A;  2PTL A;  1F2R I;  1FCL A;  4HJG E;  2ZW0 A;  1K51 A;  1PGB A;  2JZP A;  2KQ4 X;  1IGC A;  1MHH E;  4OZA A;  1GB4 A;  1GB1 A;  2GI9 A;  2JXT A;  2QSD A;  2LHE A;  2J52 A;  2N9L A; 
#chains in the Genus database with same CATH topology
 2MJD A;  4FXC A;  3GB1 A;  4XDC A;  4PYZ A;  4HRO A;  4W9C A;  4B0E A;  1ACC A;  1FPY A;  2LXC A;  2NBV B;  1TS5 A;  4JWS C;  1XEE A;  2BGF A;  1P1A A;  5BMH A;  4RH6 A;  2RR9 A;  1V97 A;  1YIW A;  1E6E B;  4HPP A;  4MSQ B;  2BBC A;  3V6C B;  3IXS A;  1PFD A;  4K3B A;  4LNF A;  3BVZ A;  2KQS A;  2ZPY A;  4RGM A;  4W9H A;  2AQ2 B;  3T8M A;  5JH5 C;  1KF6 B;  2FCS A;  4AJY B;  4RGT A;  1C1Y B;  5CTR C;  5KHQ A;  1WGH A;  2Y3A A;  3BVM A;  1JQ4 A;  4PS3 A;  2DWQ A;  2D10 A;  2L00 B;  2KC2 A;  1UH6 A;  2L3Z A;  1ZXI A;  3L4P A;  1ZDX A;  1V80 A;  4A6Q A;  4YL8 A;  4KSK C;  5FR6 A;  1N5X A;  4REZ A;  3R2T A;  5HG2 A;  4EFO A;  1MI0 A;  3R7Q A;  1NEK B;  1QLB B;  4KIK B;  3C19 A;  3ZKJ C;  4TQ0 A;  2JZP A;  4W9K A;  1H8C A;  3HHM A;  3R3M A;  1I35 A;  1N5W A;  2CU3 A;  4DHJ B;  2SEB D;  1BXT A;  2KT7 A;  2NBW B;  2QSD A;  4FLH A;  1LM8 B;  2R2Q A;  1WX9 A;  2WXM A;  3N1Y C;  4TQ1 A;  4L2Y A;  1WXV A;  2D3G A;  2AX5 A;  2MP2 A;  4DWF A;  4WJQ A;  3J9C A;  1OGW A;  3I5J C;  4FHK A;  4ANV A;  4EE2 A;  1RLF A;  3TEX A;  4W9F A;  2B3A A;  4GSW A;  3PVL A;  3KW5 B;  2D3A A;  3CF6 E;  5BMI A;  1RAX A;  4OHJ A;  1LQB A;  3TL5 A;  2Y5C A;  5FKA C;  3PGE A;  5AZF A;  1S1Q B;  4YT0 B;  2KAJ A;  1UEL A;  1B1Z A;  4RNA A;  1GAQ B;  3R8B A;  1QIL A;  2NTS A;  3ZYY X;  5EE1 A;  3NZS A;  4Q2J A;  1A5R A;  4ANW A;  2BVC A;  2PIA A;  2MBO A;  4M01 A;  4NQL B;  1FO4 A;  4N6E B;  2WX1 A;  5IO9 A;  4P7I A;  3SD5 A;  3I3T B;  2MA9 B;  4EZL A;  2D3C A;  3EC8 A;  3ZIM A;  1V1O A;  1BML C;  1T0S C;  1E90 A;  1HZ6 A;  2A5U A;  1YJ1 A;  2DEN B;  3KYC D;  2YLM A;  2FUG 1;  2DNF A;  3DHG C;  1CJE A;  1V8C A;  3H1U A;  4OZC A;  2K6D B;  2AQ3 B;  2N9P C;  4EOY A;  2X38 A;  1NBF C;  4WIP A;  4ANU A;  1ENF A;  2AEH A;  1EUV B;  2RD0 A;  5CX3 A;  3Q14 C;  1A70 A;  1ZKH A;  1QOB A;  3ALB A;  1HA5 A;  4LNK A;  1WY8 A;  5J18 A;  3ZRC A;  3R7R A;  3A33 B;  4OW0 A;  5IA7 A;  4OVV A;  2V3N A;  2PEA A;  1B9R A;  2JRH A;  1ZGU B;  2INP E;  3A9K A;  2L1A A;  3ZTD A;  2J0K A;  1KLU D;  2VZK D;  2PW9 A;  2ZCB A;  4G0N B;  3LJ3 A;  2X8X X;  1K50 A;  1E7U A;  2EMT A;  3CWI A;  2FNJ B;  2DX5 B;  1V5O A;  3VFK A;  3AE8 B;  3AE4 B;  2GBR A;  2ZW1 A;  1WZ0 A;  3ZDM C;  1EF1 A;  4ASW C;  1V6E A;  3RNC C;  3P4R B;  4IWP A;  1HTQ A;  1QF6 A;  2IO0 B;  1FNU A;  1TY2 A;  3DQV A;  2GOW A;  4YSZ B;  2J0J A;  4P6V F;  3U4E G;  1NI3 A;  1R4M B;  4BOZ B;  1L4D B;  2QJL A;  2WGS A;  2AL3 A;  2M56 B;  3VTV A;  3AEG B;  2ASQ A;  2HE7 A;  2I1K A;  4DDG D;  5FK9 C;  5BO4 B;  3GE8 C;  4C56 C;  4W9G A;  3SFD B;  3MTN B;  1FXT B;  2KC1 A;  2NCN A;  4ZDV A;  1ZP0 B;  4WQO B;  5HI1 A;  3QHT A;  2FE8 A;  1KLG D;  2MLB A;  3BZD B;  3C8Y A;  3AU5 A;  1VJK A;  4LK0 M;  1NVI D;  2NS5 A;  1J7A A;  1XCT L;  2BQQ A;  1L2N A;  1HQR D;  2GBN A;  2JY6 A;  2BWE S;  2PMV A;  3Q3F A;  3Q8B A;  2GMI C;  3VHT C;  5D6J B;  4DXA B;  1H4R A;  1C3T A;  4MGZ E;  1D5M C;  2GI9 A;  2ZVO A;  4CYE A;  4US8 A;  5FR3 A;  3MHS D;  1XQQ A;  3NS1 A;  3HRD D;  4JPS A;  1F52 A;  3IBE A;  3U52 E;  3U2S C;  4CO7 A;  2JYE A;  4M00 A;  4BBN F;  2IPK D;  1YNT E;  3URY A;  4BVU C;  2A4Z A;  3FC4 A;  3ZVV A;  1J7B A;  1TKE A;  1F1H A;  2IDY A;  4R3D A;  1FIQ A;  1MVK A;  1N63 A;  1VR9 A;  3TJP A;  4B9K A;  3AH7 A;  3ZW3 A;  5BYQ A;  3MC8 A;  3E56 A;  1F0Z A;  3MJW A;  4G11 A;  3RNB C;  4YTP B;  1WJN A;  2IGD A;  5AUI A;  3PRZ A;  2PE9 A;  5CHF A;  4A55 A;  4XE0 A;  3UF8 A;  2G45 B;  4EZK A;  4C7Y A;  3N1Z C;  3V60 A;  3X23 A;  2O6V B;  2Z8L A;  4E3C A;  2W54 A;  4LJO B;  2UYZ B;  1E8X A;  3MP9 A;  4KDL B;  3ZNZ B;  1QOA A;  2K22 A;  3BY4 B;  1XF5 L;  2JVC A;  1WX7 A;  5G5G A;  2L76 A;  3OWE B;  4EUT A;  2L0F A;  1YX6 B;  2WXI A;  3L0W B;  2KJ6 A;  2L32 A;  2W9N A;  2I2Y A;  2RPV A;  5KHO A;  4K81 A;  2MSE D;  2JYT A;  1VZ6 A;  4ZRQ A;  3CIR B;  4KGS A;  2IJ0 A;  3SFE B;  3U8Z A;  1WX8 A;  4HEA 1;  2K3U A;  3ZJT A;  2OJW A;  3ETR A;  3AE1 B;  1BUI C;  4OZA A;  2DZJ A;  4AS1 A;  3P42 A;  2KNB A;  2O2V B;  3W9C B;  4ARC A;  4C4V A;  1ESF A;  3PRM B;  1JWU D;  3QAR A;  1C4P A;  4JE3 B;  4PS7 A;  1UF0 A;  5JXV A;  2NPT A;  3ZXR A;  4MH8 A;  2LMC A;  4MEM A;  3PPA A;  3BK1 A;  1D5X C;  3IT4 B;  3H7S A;  3OG5 A;  4EKU A;  4HPL B;  4BOS C;  2BYF A;  3ZTC A;  4MJS B;  2WXH A;  3ONS A;  1FFU A;  5I4D A;  2WXJ A;  3ZJV A;  3Q69 A;  1WMH A;  3VDZ A;  1QZE A;  1SE4 A;  3AEC B;  2MBH A;  3ZQ4 A;  1N61 A;  3BII D;  3KUC B;  4KIK A;  3AM9 A;  5H8Y E;  1EU3 A;  1WGY A;  1E5W A;  5AZH A;  4LLG M;  1VRA B;  2LAS A;  2KD0 A;  2FID A;  2KDM A;  1XLQ A;  3FIL B;  1CQV A;  4AOF A;  3DBL B;  3OJ4 B;  4BKG A;  2BS2 B;  5EDS A;  1E8Z A;  3AB5 A;  1F2R C;  4FUL A;  4JL9 A;  4M0W B;  2KTR A;  2CS4 A;  3AED B;  2WXO A;  2QEJ C;  3DWG C;  2J53 A;  1ET9 A;  1E8Y A;  1NDD A;  4MGY E;  2CHZ A;  4YTN B;  1WJ6 A;  1GOZ A;  1C78 A;  3IT6 B;  2PLP A;  5G55 A;  2ON8 A;  2CHX A;  1Q0W B;  1N62 A;  3BVG A;  2FUH B;  3H9D A;  1GNU A;  3PO0 A;  3WIM A;  2KTR B;  1TY0 A;  2K25 A;  2PVO D;  3B0A A;  1IGC A;  3KVF B;  2MEK A;  4G50 A;  2RGF A;  1V2Y A;  1YN3 A;  1JRP A;  1U4A A;  2JXT A;  2W82 A;  4US9 A;  2ZNV C;  3UQB A;  1V9J A;  2J52 A;  3DVG X;  2WDR B;  3NHE B;  4HPM B;  2DYO A;  3PSE B;  4WWO A;  4WWN A;  3WAP A;  3M95 A;  3BIN A;  4WWM A;  2QCZ A;  2V9H A;  2OJR A;  1FD6 A;  1L7Y A;  4LNI A;  2MBB B;  3EGR A;  1EO6 A;  1TBE A;  4KKI A;  4ANX A;  2RDG A;  1Z5S B;  2ZCC A;  5E6O A;  1ZOY B;  5BMG A;  4DHZ B;  1RWS A;  4NAM A;  4USA A;  2RMM A;  2KAC A;  1LXD A;  3P4Q B;  2C7M B;  3MJ5 A;  2C7H A;  4JIO U;  1ZXH A;  1IBX B;  2V4L A;  1TS4 A;  2JXX A;  3NRZ A;  2W3S A;  4BBN C;  3GOE A;  1RFA A;  2Y5B B;  5C23 A;  3DBS A;  1WSP A;  3JYU A;  2Z59 B;  5CHW A;  1AW7 A;  4ZRI A;  3L16 A;  1WYW B;  1L6V A;  1JRU A;  3AE6 B;  1ZUD 2;  4ZYN A;  2K1F A;  2PTL A;  2G4D B;  4C7Z A;  3VAW A;  2KLC A;  3PZD A;  3NVW A;  1R4M I;  3VRB B;  3DHH C;  1PYW D;  4XZ4 A;  1GB4 A;  2LJI A;  3TMP B;  4A20 A;  3FAH A;  2LXA A;  2KDF B;  1VD2 A;  2KJH B;  1YD8 U;  3W2D A;  1I4P A;  2OOB B;  3DVN U;  2WDT B;  3FKY A;  5DCN A;  1V1P A;  1ET6 A;  3ZLZ A;  4IUM B;  5E6P A;  2KXJ A;  3DBH B;  4XDD A;  2PPH A;  4ICU A;  1EU4 A;  3Q8C A;  2CJN A;  2WS3 B;  1PQS A;  2KWD A;  4AP4 C;  5J17 A;  4HCP B;  4RGN A;  2IO2 B;  1L0V B;  3KWL A;  1YJI A;  3QK0 A;  2KKC A;  3AU4 A;  2JWU A;  3T9L A;  5IN7 A;  1L0Y B;  2UU7 A;  2CJO A;  4AUQ C;  1FCC C;  1UD7 A;  4C00 A;  1YN4 A;  4IDI A;  1JWB D;  4XX5 A;  1EM7 A;  1TS3 A;  3BYY B;  2K5P A;  2WYQ A;  4F1S A;  2BWF A;  3KUD B;  5G2N A;  4YXD B;  4KSL C;  1PGA A;  2H89 B;  3ZO5 B;  3ZRF A;  3M3J A;  1T5X D;  4WH4 A;  4YSX B;  2BTE A;  2QIL A;  4IG7 B;  1QOG A;  2XK5 B;  3CMM B;  3VH3 B;  4A3O A;  2IND C;  1MHX A;  2KFK A;  3QCA A;  2INN E;  1XLO A;  3OJ3 A;  1JRO A;  2MHJ A;  3T3O A;  1BT0 A;  3JVZ X;  2IO3 B;  1GUA B;  2MH7 A;  3MFG A;  4ICV A;  2J0M A;  1WYG A;  1J19 A;  2KQ4 X;  3DOW A;  4C80 A;  2N9E B;  2Z0E B;  3N32 A;  1LO5 D;  2Y5P A;  3N20 C;  1XLP A;  3M63 B;  2DZK A;  1P3Q U;  1OQY A;  3ENE A;  1FXI A;  3P4P B;  1MG4 A;  3U30 A;  5DPS A;  3PZ7 A;  3IAM 1;  2EMS A;  1HXY D;  1YJJ A;  1WR1 A;  5GXG B;  4MM3 B;  1TS2 A;  3NOB A;  3Q3N C;  2KLG A;  1D5Z C;  3RZF A;  3TCA A;  2K8B A;  5TSS A;  3L10 B;  1SEB D;  4X57 B;  1V1P B;  3RFZ B;  2G3Q B;  3KLS X;  4DHZ E;  1E10 A;  4GDL A;  5GMV A;  3ZXV A;  2B76 B;  1PUT A;  3AEB B;  3AXC A;  2GBK A;  1FNW A;  5TR5 A;  2KDB A;  4HLE A;  3RI7 C;  1D3Z A;  4I6L B;  4RGO S;  4WWP A;  5MPO A;  2R2O A;  3APD A;  3LYY A;  4NJ6 A;  1WE6 A;  3UI3 A;  1WWT A;  1MJD A;  3A4R A;  2XK5 A;  1TJE A;  3BWU D;  1WXM A;  2LGX A;  4URK A;  2GBJ A;  2JPH A;  3WAN A;  2WXK A;  4WJP A;  2LUM A;  2CHW A;  3V3X A;  3RCZ A;  2HDE A;  3P4S B;  1YQ3 B;  3EFC A;  3IVF A;  5DPW A;  2K8C A;  3AV8 A;  2ZEQ A;  4N9F 4;  4ARI A;  4W9I A;  2LWP A;  3TSS A;  2AYO B;  1SE9 A;  1T0R C;  1SE2 A;  2D07 B;  3A9J B;  4CHK A;  5JZE B;  3EUB 2;  4KVG B;  4KZC A;  5LXH A;  4M8N A;  4PYU A;  2NPT B;  3IFW B;  2JF5 A;  2C7N B;  1WGD A;  1YN5 A;  3H6N A;  3MC9 A;  3W1S A;  1E0Z A;  3QJZ A;  2N9L A;  4A90 A;  2LFI A;  4IOI E;  4MGK E;  1VZ7 A;  3WAL A;  2M0A A;  1XO3 A;  1Z2M A;  2M4N A;  1N60 A;  1KM7 A;  1HE8 A;  2N0S B;  4PS8 A;  3TBL D;  2K6Q A;  2GB1 A;  4KGR A;  1OQQ A;  4J6I A;  4K7S A;  1WJU A;  1ZDV A;  1WRI A;  3K9P B;  3MC0 B;  4FBJ B;  2QHO A;  2O6V D;  1VDV A;  4XYC A;  5EE0 A;  1TIF A;  1JWM D;  1P98 A;  3L54 A;  3AE3 B;  4IWQ A;  3VUX A;  2WLB A;  5BYR A;  3NZ3 A;  4XWW A;  1I4G A;  1UNS A;  5D94 A;  3NVY A;  1WJ4 A;  2BKF A;  2K8H A;  4HDO A;  3L17 A;  2GBM A;  3S2A A;  2N9K A;  1VLB A;  2W55 A;  2N1W A;  3Q8E A;  4NY0 A;  3LB8 C;  1F9J A;  2MQJ A;  3JSV B;  2IO1 B;  5T8I A;  2MBE A;  3ABV B;  1YOV B;  3AE9 B;  4FJY A;  4P16 A;  4JGH B;  2KX3 A;  1OQR A;  1V86 A;  2BT6 A;  1MFW A;  1SGH A;  1OEY J;  3PT2 B;  4P1B C;  1KH0 A;  2KN4 A;  2C60 A;  1F2R I;  3H8H A;  4JLC A;  3RZW C;  3O13 A;  3APC A;  2C5L C;  3DVN V;  3UQA A;  4NAW A;  4QAY A;  2CU1 A;  3P63 A;  1J7C A;  1R7S A;  3DBH I;  1TYG B;  3B08 A;  2CKH B;  3TEZ A;  4KZ0 A;  4RF0 A;  3NZU A;  2DLB A;  1D6E C;  4W9D A;  1WE7 A;  2WU2 B;  1I42 A;  3RMK C;  2FBW B;  1WXQ A;  1OEY A;  3A1Q A;  5D3D A;  2V4I B;  3GS2 A;  2BB5 A;  3IG3 A;  4K7U A;  4RFB A;  3PHW B;  1L6U A;  3QWZ B;  1CZP A;  3Q3M C;  2KX0 A;  1LGR A;  1T3Q A;  3ZUN A;  4ACF A;  2HD5 B;  3A1Q B;  3DCG A;  4WAF A;  1P7F A;  3RD2 A;  4GGQ A;  4DXG A;  1HEZ E;  3PZ8 A;  1UUP A;  1IPG A;  1P0R A;  1WXS A;  1TKG A;  3AEE B;  3VR9 B;  2WXL A;  2L8J A;  2DAF A;  3PV1 A;  3DDC B;  1QT9 A;  1SSN A;  3KYD D;  1N6Z A;  2L7R A;  2KFJ A;  4YWG G;  2MJ3 A;  1UGJ A;  4WQM A;  1XT9 B;  2WP9 B;  1WGK A;  1KJT A;  2D11 A;  2WXQ A;  3DVG Y;  5AEK B;  1F77 A;  4FN2 A;  2VZK B;  1TTN A;  2NR2 A;  2M8S A;  4FA6 A;  3ZJU A;  4OVZ A;  1FRD A;  3W1S C;  4O1N A;  5IP4 D;  4A3P A;  2QDF A;  2W3R A;  4HJG E;  1DOX A;  2ZW0 A;  4HVB A;  3NUH B;  1GPX A;  1JWA D;  4E74 A;  3M62 B;  2Z0D B;  4HJK A;  4MH0 E;  3DPD A;  2IYD B;  4TKN A;  4P1C C;  3MHZ A;  2LJ5 A;  2G9H D;  2V3P A;  4DDI D;  5HKH A;  3LDZ E;  1L0X B;  1G6J A;  1SF0 A;  3PRP B;  1C9F A;  4GDL B;  2AWT A;  2KMC A;  4GIV A;  3PLU A;  3AN1 A;  2LVO A;  4NJC A;  4FJV B;  4EEW A;  4S0R A;  1V81 A;  1ISN A;  3KWV A;  2KZR A;  1C76 A;  2GLS A;  2BB6 A;  2WX0 A;  1YX5 B;  2M17 A;  4JWU C;  4GOC A;  2PJH A;  3HUI A;  1HZ5 A;  1XXG A;  1T0Q C;  2WXF A;  1T6B X;  2LHD A;  2K0P A;  3L08 A;  4IWO A;  1AWD A;  1EWY C;  1KRH A;  4I6P A;  3DBL I;  4GU2 A;  1XD3 B;  5LNK 1;  3PTF C;  2IGG A;  3APF A;  1OTR B;  2LGD A;  2I38 A;  3I57 A;  3HIZ A;  4GMV A;  4RM9 A;  2LGY A;  2MRP A;  2OED A;  1E9M A;  3Q6B A;  1M4V A;  2RSU A;  3QX1 A;  4B0M A;  2BS3 B;  3GZN B;  1V5T A;  2VH2 A;  3SHQ A;  1L4Z B;  4DK5 A;  1S3S G;  2MX2 A;  3KH0 A;  5C1Z A;  5JHA A;  4GDK B;  4NAW B;  1WXA A;  1IP9 A;  3VXW A;  5DPT A;  2HTH A;  2KK8 A;  2NVU I;  3WAM A;  4EZJ A;  5AUK A;  4DHJ D;  2ZNV B;  3AE5 B;  3AE7 B;  2IBI B;  2LI5 A;  3ML8 A;  5J2R A;  4KV2 A;  1FNV A;  2REX A;  5G5H A;  2M19 A;  1FFV A;  2KOX A;  3RUI B;  2VH1 A;  4N58 A;  1C4C A;  2KO3 A;  1RYJ A;  3WAO A;  3QC8 B;  2BYT A;  2ICI A;  4HWI B;  2JT4 B;  1WRD B;  4LNN A;  2NMQ A;  3Q3J A;  1TZ1 A;  2BYV E;  4OZB A;  1SJE D;  4ZRK A;  4H2A A;  1I4R A;  1JML A;  1JAL A;  3TIX A;  2IY0 B;  3VTU A;  2JX5 A;  1K53 A;  2AQ1 B;  2WWZ A;  4GN1 A;  1SXT A;  2ONQ A;  3I63 C;  1XLN A;  1SB3 C;  2RDB C;  2ZJD A;  4LJP B;  4TSS A;  5EE9 A;  3EHV A;  1FEH A;  2L52 A;  1DOI A;  4DBG A;  5LLI A;  2DHZ A;  2KYW A;  3O65 B;  3HVD A;  2FAZ A;  1GC7 A;  3IHP C;  4G3X B;  3RNA C;  1WH3 A;  4RF1 A;  1TKY A;  1GC6 A;  3B2G A;  1MG8 A;  3W5V B;  3NVZ A;  4ZRJ A;  2K9X A;  1SIF A;  3B1L X;  4RM8 A;  1MPE A;  2JU6 X;  2WDQ B;  2MBQ A;  2DZI A;  3Q3O C;  3X0W A;  3ZNH B;  4BKT A;  3PHX B;  1VCB A;  2XEW A;  4XGA B;  1WR6 E;  2JQR B;  4DXF A;  1IUE A;  2JSV X;  1PGX A;  3V6E B;  2BF8 B;  2KDE B;  1SIJ A;  4TUU A;  1GJZ A;  2JZZ A;  4E71 A;  4S17 A;  2CR5 A;  1FXA A;  2RDH A;  2KVZ A;  3SU8 X;  1NEN B;  4LDT B;  4MJS A;  2J4X A;  4IC7 B;  1R4N B;  1RM6 C;  3Q8A A;  3C0R B;  2DYM A;  4FHJ A;  2E3T A;  3IAS 1;  5IKC M;  3N30 A;  1I7H A;  1WF9 A;  2JWZ A;  4HK2 A;  2YEP F;  1DOY A;  4K1R B;  2NBU A;  2QIE B;  2LRW A;  1TZO A;  3RT3 B;  4NQK E;  4D2K A;  1KTK A;  1J8C A;  4WJO A;  3W5U B;  4ZYS A;  3UGB B;  3NG0 A;  4AJW A;  2DYB A;  2JRI B;  3P2B A;  3PRE A;  3T3N A;  5DPR A;  2GRI A;  4MDK E;  2E6X A;  2H88 B;  1DGJ A;  1NYQ A;  1SBB B;  3Q8F A;  4LCD E;  1YMH E;  2XBB C;  2J42 A;  5L83 A;  4K7W A;  1T0Y A;  3W1Y A;  2XNA C;  2R61 A;  4B95 A;  1CK1 A;  2FCQ A;  4F8C B;  3R2I A;  3RYT A;  2UWQ A;  2KMM A;  1C79 A;  2N9X A;  1C77 A;  4KGT A;  1C4A A;  4LNO A;  1KOT A;  4MT5 A;  2XN9 C;  3OLM D;  4WAA A;  4W9J A;  2D5G A;  3VVW B;  2LUE A;  3BYT B;  1WIA A;  1PDX A;  4II2 B;  1V49 A;  1QKZ A;  3AE2 B;  1CMX B;  1I4X A;  2FCN A;  4II3 B;  4AWJ A;  2KJR A;  1UWM A;  3RNG C;  1AAR A;  1DYQ A;  2RPQ A;  4UDU C;  3NS8 A;  2MJE A;  3K9O B;  3VUY A;  3DBR I;  3P1M A;  2WXP A;  1E7P B;  2LEK A;  2PVG C;  1PGB A;  5H92 C;  4FJZ A;  4WUR A;  2HJ1 A;  4BKS D;  1GB1 A;  2BYE A;  1STE A;  2IY1 B;  4YTM B;  4GXB A;  4TMA B;  4K3C A;  3GP7 A;  1TGZ B;  2O6V A;  3RN9 C;  2V1Y A;  4ZRP A;  3ZDT A;  4GB9 A;  2D3B A;  3KUZ A;  5C2T B;  3KQ4 A;  4PT5 A;  2KFK B;  2N7E A;  2KHW B;  3GZN I;  4J3O D;  2N1V A;  3A9J A;  1D4B A;  4MEL A;  3PLV A;  4C4V B;  3U7D A;  2J7Q B;  3OAW A;  4NJ7 A;  1JCK B;  1Y8R C;  2LRU A;  3N3K B;  2LGI A;  1UBI A;  2SAK A;  3PS6 A;  1ZE3 D;  1J0G A;  4CQN A;  2DBY A;  2KWC A;  3GE3 C;  3AEA B;  2ZVN A;  1JW9 D;  1WGG A;  2C9W B;  1Q10 A;  4L1B A;  4TV3 A;  1WI0 A;  2FIF A;  2KWU B;  2KN5 A;  3I9V 1;  4DQO C;  4HKZ E;  2G1E A;  4HKQ A;  3EFU A;  3VR8 B;  3TEY A;  2JZ3 B;  1HTO A;  3SR6 A;  2DAJ A;  5CHV C;  1KFY B;  3V05 A;  2KMA A;  2L0T A;  3SEB A;  4HDQ A;  4XC2 A;  2YEP B;  3SDL C;  3H7P B;  2Q5W D;  1K8R B;  2KQ7 A;  1WZ3 A;  4BAX A;  4MSM B;  3QQ8 B;  3JSV A;  4HRS A;  2WU5 B;  1L5P A;  4MM3 A;  3VUW A;  3AUL A;  2PKO A;  1TT5 B;  3VTW A;  3NVV A;  3WCQ A;  4M0W A;  1YQB A;  1WM2 A;  4YSY B;  1UGM A;  3B9J A;  2WDV B;  1WFY A;  2IGH A;  2BS4 B;  3D32 A;  2ZPN A;  2WXR A;  5E6J A;  3V61 A;  2G4S A;  3CST A;  2D2Q A;  2V3S A;  4M02 A;  5D3I B;  1P9D U;  3H7P A;  3QAQ A;  4W9L A;  2BPS A;  5LXI B;  1EF5 A;  1Q1O A;  1R4N I;  1RRB A;  3EA6 A;  2MW5 A;  4KX6 B;  3FIL A;  1QQR A;  5L95 C;  4HCN B;  2KVR A;  2LD9 A;  1K52 A;  3TEW A;  4OVU A;  2AL6 A;  2M1M A;  4BKS A;  4L23 A;  1M94 A;  1FRR A;  3AI5 A;  3DBR B;  5E6N A;  2EKI A;  2BKR B;  3QA8 A;  4I6N B;  5AZG A;  1Y56 A;  4IKG A;  2TSS A;  5C3J B;  4MGI E;  3B2F A;  1LFD A;  2EEL A;  2KTF A;  5HHD G;  4NPN A;  3JW0 X;  3VRA B;  1YQ4 B;  2VRR B;  3R66 C;  2EKE C;  4NNJ B;  2HJ8 A;  3UIN B;  1IBX A;  2KWV B;  1KLV A;  1WM3 A;  5JHB A;  4FAD A;  1SE3 A;  2PE6 B;  3AMZ A;  2I1J A;  1P7E A;  2M0X A;  4HXD A;  3TUO A;  4W9E A;  1NI2 A;  2JUO A;  4JQW C;  2WHI A;  4A8X C;  1K51 A;  1OFF A;  3VQI A;  1MHH E;  2ACZ B;  2DZM A;  2V0G A;  4JX1 C;  3VH4 B;  4KDI C;  4AQ7 A;  2LHE A;  2YVC A;  2LGS A;  1I4Q A;  1IGD A;  4A9A A;  3ZGZ A;  3WA0 A;  2N4F A;  1E7V A;  2N7J A;  4IM3 A;  3EEC A;  1UWX A;  2HTM E;  2LZ6 A;  3CSF A;  2NTT A;  3UIO B;  2ZZP B;  1FMA D;  1AYF A;  4NZL B;  3ZNI D;  3A9K B;  1GG3 A;  3LXF A;  3N9Y C;  3BK2 A;  3RUL A;  2QC8 A;  1ROE A;  4IW0 A;  2KDI A;  3AEF B;  1E8W A;  1WGR A;  3V62 A;  3ZNG C;  3RNE C;  3A4S C;  5EE3 A;  4BFR A;  4M8M A;  2MP2 B;  3HM3 A;  1IYF A;  1NYR A;  1JWS D;  3UIP B;  2KAN A;  2L05 A;  4BZA A;  5IOI A;  5D7G A;  4RMA A;  1SJH D;  3RNF C;  2IZV B;  2LVP A;  4F7Z A;  4XWT A;  5BYS A;  2WQY B;  3HK0 A;  1VZ8 A;  1ZPS A;  1ZW7 A;  4PK1 A;  3ML9 A;  2MWS B;  4ZHP A;  2QMT A;  2WXG A;  4GDK A;  1AN8 A;  4ZHO A;  2N7D A;  2OHF A;  2O2V A;  3RPF C;  1WMH B;  4RCO A;  3HM6 X;  2FCM A;  1QOF A;  1RFK A;  4GLS C;  3NJT A;  5IAA C;  1Q5W B;  4WJN A;  1XCQ L;  2L83 A;  3ECI A;  4B6W A;  1FM0 D;  5HFY A;  3U7Z A;  1I4H A;  4LDT D;  1X1M A;  1FCL A;  3NY5 A;  4KKJ A;  3QIJ A;  1UZX B;  2WNM A;  4IM2 A;  2WXN A;  3E9S A;  3DHI C;  3L13 A;  3HVZ A;  2MCN B;  3Q2A C;  4IM0 A;  2K39 A;  4ZOH C;  4N59 A;  4LTU A;  1UBQ A;  5D2M B;  4ITK A;  3N1X C;  2BW2 A;  1EWC A;  3DWM A;  4MAC A;  2INC C;  2LVQ A; 
#chains in the Genus database with same CATH homology
 2MJD A;  4FXC A;  3GB1 A;  2LFI A;  4A90 A;  4XDC A;  5JXV A;  2YEP F;  1DOY A;  4IOI E;  2QIE B;  4MH8 A;  2LMC A;  1VZ7 A;  1TZO A;  3BK1 A;  2M0A A;  4D2K A;  1KTK A;  4HRO A;  1XO3 A;  3W5U B;  4B0E A;  1N60 A;  1D5X C;  4ZYS A;  1ACC A;  2N0S B;  3IT4 B;  2GB1 A;  4KGR A;  1OQQ A;  1TS5 A;  3T3N A;  4JWS C;  2GRI A;  1XEE A;  2E6X A;  5BMH A;  1ZDV A;  2H88 B;  1WRI A;  1DGJ A;  4RH6 A;  2WXH A;  1FFU A;  1NYQ A;  3MC0 B;  5I4D A;  2WXJ A;  1SBB B;  1V97 A;  3Q8F A;  3ZJV A;  1E6E B;  1YMH E;  1VDV A;  3Q69 A;  5EE0 A;  1JWM D;  2J42 A;  2BBC A;  3IXS A;  3AE3 B;  1PFD A;  2WLB A;  1SE4 A;  2XNA C;  5BYR A;  2R61 A;  3AEC B;  3ZQ4 A;  3NZ3 A;  1N61 A;  1CK1 A;  1I4G A;  1UNS A;  4XWW A;  3BII D;  3BVZ A;  3NVY A;  3R2I A;  4RGM A;  3AM9 A;  5H8Y E;  1EU3 A;  2AQ2 B;  4LLG M;  1VRA B;  2KMM A;  1C79 A;  1KF6 B;  2N9K A;  1VLB A;  1C77 A;  2W55 A;  4RGT A;  3Q8E A;  2KDM A;  1XLQ A;  3FIL B;  3LB8 C;  4KGT A;  1CQV A;  1C4A A;  2BS2 B;  2Y3A A;  4MT5 A;  3AB5 A;  2XN9 C;  3BVM A;  1JQ4 A;  1F2R C;  2D5G A;  3BYT B;  1PDX A;  5T8I A;  2DWQ A;  3ABV B;  3AE9 B;  4P16 A;  3AED B;  1QKZ A;  2QEJ C;  2WXO A;  1ZXI A;  3AE2 B;  3DWG C;  2J53 A;  1I4X A;  1OQR A;  3L4P A;  1ZDX A;  1ET9 A;  2BT6 A;  1UWM A;  4A6Q A;  1DYQ A;  4YTN B;  1GOZ A;  1C78 A;  3IT6 B;  1N5X A;  4REZ A;  2PLP A;  4UDU C;  3R2T A;  1KH0 A;  2ON8 A;  2KN4 A;  1N62 A;  2MJE A;  5HG2 A;  1MI0 A;  3BVG A;  3P1M A;  1F2R I;  2WXP A;  1E7P B;  1NEK B;  3H8H A;  3PO0 A;  1QLB B;  2LEK A;  3O13 A;  1TY0 A;  2PVG C;  1PGB A;  2PVO D;  5H92 C;  4TQ0 A;  2JZP A;  1IGC A;  4WUR A;  2MEK A;  3P63 A;  1J7C A;  1N5W A;  1R7S A;  2CU3 A;  1TYG B;  1YN3 A;  1JRP A;  1GB1 A;  3TEZ A;  2SEB D;  4RF0 A;  2DLB A;  2JXT A;  4US9 A;  2W82 A;  1STE A;  4YTM B;  1BXT A;  1D6E C;  2QSD A;  4TMA B;  2J52 A;  2WXM A;  2WDR B;  3GP7 A;  2WU2 B;  4TQ1 A;  4ZRP A;  4L2Y A;  2DYO A;  2FBW B;  1WXQ A;  2AX5 A;  5C2T B;  5D3D A;  2V4I B;  3GS2 A;  3J9C A;  3KQ4 A;  4PT5 A;  4WWM A;  2BB5 A;  4EE2 A;  4RFB A;  4J3O D;  1D4B A;  3TEX A;  1FD6 A;  1L6U A;  1CZP A;  3EGR A;  1T3Q A;  5BMI A;  4KKI A;  4OHJ A;  1JCK B;  2RDG A;  2Y5C A;  5FKA C;  1ZOY B;  2LGI A;  5BMG A;  2SAK A;  4YT0 B;  4WAF A;  1P7F A;  2KAJ A;  1RWS A;  1ZE3 D;  4NAM A;  1B1Z A;  4USA A;  4DXG A;  1HEZ E;  3PZ8 A;  1GAQ B;  4RNA A;  4CQN A;  2RMM A;  3R8B A;  1QIL A;  2KAC A;  2DBY A;  3P4Q B;  2NTS A;  3AEA B;  3MJ5 A;  3ZYY X;  1UUP A;  5EE1 A;  1JW9 D;  1ZXH A;  1TKG A;  1IBX B;  1Q10 A;  4L1B A;  3AEE B;  3VR9 B;  2WXL A;  4Q2J A;  1QT9 A;  1TS4 A;  3I9V 1;  1SSN A;  4DQO C;  4HKZ E;  2G1E A;  3NRZ A;  4HKQ A;  2PIA A;  1FO4 A;  2W3S A;  4N6E B;  3VR8 B;  4YWG G;  3TEY A;  2MJ3 A;  1UGJ A;  4WQM A;  1V1O A;  3SR6 A;  1BML C;  2WP9 B;  1WGK A;  1HZ6 A;  2WXQ A;  1WSP A;  2FUG 1;  1F77 A;  1CJE A;  1V8C A;  1KFY B;  4OZC A;  1AW7 A;  2VZK B;  3V05 A;  2AQ3 B;  2X38 A;  4WIP A;  3SEB A;  1L6V A;  3AE6 B;  3ZJU A;  1ENF A;  1ZUD 2;  2YEP B;  4OVZ A;  1FRD A;  2PTL A;  1A70 A;  4O1N A;  1QOB A;  1HA5 A;  2W3R A;  4HJG E;  1DOX A;  4C7Z A;  2Q5W D;  2ZW0 A;  3NUH B;  3NVW A;  1GPX A;  1JWA D;  3VRB B;  4OW0 A;  1PYW D;  4HRS A;  2WU5 B;  1L5P A;  1GB4 A;  2PKO A;  2LJI A;  2V3N A;  1B9R A;  3FAH A;  2INP E;  3MHZ A;  2L1A A;  3NVV A;  3WCQ A;  4M0W A;  2G9H D;  2V3P A;  1I4P A;  3W2D A;  4YSY B;  1KLU D;  2VZK D;  3B9J A;  1L0X B;  2WDV B;  2PW9 A;  1SF0 A;  2IGH A;  1V1P A;  1ET6 A;  1K50 A;  1C9F A;  2BS4 B;  4GDL B;  4XDD A;  2WXR A;  5E6J A;  3CWI A;  1EU4 A;  3AN1 A;  4NJC A;  3Q8C A;  2CJN A;  3AE4 B;  3AE8 B;  2WS3 B;  5D3I B;  2ZW1 A;  3KWV A;  2KWD A;  1C76 A;  2BB6 A;  3EA6 A;  3P4R B;  1QF6 A;  4RGN A;  1FNU A;  1TY2 A;  1L0V B;  4JWU C;  3KWL A;  1YJI A;  4YSZ B;  2JWU A;  4KX6 B;  3FIL A;  4P6V F;  3U4E G;  1QQR A;  3HUI A;  1L0Y B;  1HZ5 A;  1XXG A;  2WXF A;  1NI3 A;  1K52 A;  2CJO A;  3TEW A;  1T6B X;  2LHD A;  1FCC C;  1L4D B;  2K0P A;  1YN4 A;  2QJL A;  2M56 B;  1AWD A;  4IDI A;  4L23 A;  1EWY C;  1KRH A;  1FRR A;  1JWB D;  3AEG B;  2EKI A;  1EM7 A;  1Y56 A;  5LNK 1;  1TS3 A;  3BYY B;  5FK9 C;  4IKG A;  2TSS A;  5C3J B;  2K5P A;  3B2F A;  2IGG A;  2EEL A;  4C56 C;  2I38 A;  3I57 A;  5HHD G;  3SFD B;  4YXD B;  3VRA B;  1PGA A;  1YQ4 B;  2H89 B;  2OED A;  1E9M A;  1M4V A;  4B0M A;  1IBX A;  1T5X D;  2BS3 B;  4WH4 A;  4YSX B;  1ZP0 B;  2BTE A;  1L4Z B;  2QIL A;  5HI1 A;  1QOG A;  2FE8 A;  1KLG D;  1SE3 A;  3BZD B;  3C8Y A;  1MHX A;  1VJK A;  4LK0 M;  1NVI D;  2INN E;  4GDK B;  1XLO A;  3AMZ A;  4NAW B;  1P7E A;  1J7A A;  3TUO A;  1XCT L;  1JRO A;  5AUK A;  3T3O A;  1HQR D;  4A8X C;  3AE5 B;  3AE7 B;  2MH7 A;  1K51 A;  1OFF A;  2PMV A;  3MFG A;  1WYG A;  2KQ4 X;  3VQI A;  3Q8B A;  4C80 A;  1MHH E;  2ACZ B;  1FNV A;  1LO5 D;  5G5H A;  2V0G A;  2Y5P A;  2M19 A;  1D5M C;  2GI9 A;  1FFV A;  4JX1 C;  1XLP A;  4US8 A;  5FR3 A;  4AQ7 A;  1FXI A;  3P4P B;  2LHE A;  4N58 A;  3PZ7 A;  3NS1 A;  3HRD D;  1C4C A;  3IAM 1;  1RYJ A;  4JPS A;  1I4Q A;  2BYT A;  3U52 E;  2ICI A;  3U2S C;  1IGD A;  4A9A A;  3ZGZ A;  1HXY D;  1YJJ A;  2JYE A;  2N7J A;  2IPK D;  5GXG B;  4MM3 B;  1TS2 A;  1UWX A;  1YNT E;  2HTM E;  3URY A;  2NTT A;  3FC4 A;  1D5Z C;  2NMQ A;  1J7B A;  4OZB A;  1FMA D;  5TSS A;  1TKE A;  2IDY A;  4R3D A;  1SJE D;  1AYF A;  4NZL B;  1SEB D;  4H2A A;  1FIQ A;  1I4R A;  1V1P B;  3RFZ B;  1MVK A;  1N63 A;  3LXF A;  1JML A;  1JAL A;  3N9Y C;  3BK2 A;  1VR9 A;  3KLS X;  1ROE A;  2JX5 A;  3AH7 A;  1K53 A;  2AQ1 B;  3AEF B;  5BYQ A;  3E56 A;  1SXT A;  2ONQ A;  1F0Z A;  1E10 A;  1XLN A;  1SB3 C;  4TSS A;  5EE9 A;  4YTP B;  2B76 B;  1PUT A;  3AEB B;  2IGD A;  5EE3 A;  5AUI A;  1FNW A;  4A55 A;  4XE0 A;  4RGO S;  1FEH A;  4C7Y A;  2L52 A;  5MPO A;  1DOI A;  1NYR A;  1JWS D;  2Z8L A;  3HVD A;  4MAC A;  2W54 A;  3LYY A;  5D7G A;  3MP9 A;  1SJH D;  3UI3 A;  1WWT A;  1TKY A;  4RF1 A;  3B2G A;  3W5V B;  1QOA A;  2K22 A;  3NVZ A;  4XWT A;  5BYS A;  2WQY B;  1VZ8 A;  1ZPS A;  2K9X A;  1XF5 L;  1TJE A;  3BWU D;  1MPE A;  2JU6 X;  2WDQ B;  4ZHP A;  2QMT A;  5G5G A;  2WXG A;  3OWE B;  1AN8 A;  2WXI A;  2WXK A;  4ZHO A;  2L32 A;  2LUM A;  2OHF A;  3RPF C;  2I2Y A;  2RPV A;  4RCO A;  3V3X A;  2HDE A;  3P4S B;  1QOF A;  1YQ3 B;  1RFK A;  4GLS C;  2JQR B;  3AV8 A;  1XCQ L;  2L83 A;  4ARI A;  2JYT A;  1FM0 D;  1VZ6 A;  4ZRQ A;  4DXF A;  5HFY A;  3CIR B;  1IUE A;  4KGS A;  3U7Z A;  2IJ0 A;  2JSV X;  1I4H A;  1PGX A;  3SFE B;  3TSS A;  1FCL A;  1SIJ A;  4KKJ A;  4HEA 1;  2WNM A;  2K3U A;  1SE2 A;  3ZJT A;  2WXN A;  3E9S A;  3ETR A;  3AE1 B;  3EUB 2;  3HVZ A;  1BUI C;  4OZA A;  1FXA A;  4AS1 A;  2RDH A;  3P42 A;  4ZOH C;  1NEN B;  4LTU A;  4N59 A;  2J4X A;  3W9C B;  1RM6 C;  4ARC A;  2BW2 A;  3Q8A A;  4ITK A;  1EWC A;  3DWM A;  2DYM A;  1ESF A;  1YN5 A;  2E3T A;  3IAS 1;  1JWU D;  1C4P A;  3W1S A;  4JE3 B;  1E0Z A;  2N9L A;  1I7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...