2RN0A

Micelle-embedded integrin beta3 transmembrane segment
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
43
structure length
43
Chain Sequence
PESPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin beta-3
publication title Structure of the Integrin beta3 Transmembrane Segment in Phospholipid Bicelles and Detergent Micelles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 14
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2rn0A00
1PP9D 3PLNA 4D6TD 2KNCB 2L91A 2QJPB 4EDFA 2O3JA 2JWAA 3PTZA 3TGUD 3H1LD 3H1JD 3H1ID 1BE3D 2BCCD 3L72D 3L73D 1SQXD 3PHLA 1L0LD 2Q3EA 3L74D 2Y0DA 5TJHA 1SQQD 2N9YB 3FWLA 3KHUA 5KLVD 3H1HD 1NTKD 2QG4A 2K9JB 5KKZB 1SQPD 1SQVD 3L70D 5KLIB 3H1KD 1P84D 2IBZD 1NTMD 3CX5D 3L71D 1NTZD 1NU1D 3TF5A 4A7PA 1L0ND 2RN0A 2Y0EA 3ITKA 4U3FD 1KYOD 3BCCD 2YIUB 2A06D 3TDKA 2FYNB 2KS1A 1BCCD 2RMZA 1KB9D 3GG2A 1BGYD 4RJTA 3VMAA 2FYUD 1ZRTD 2QJKB 2QJYB 2Y0CA 3GW6A 3L75D 3PRJA 3CWBD 3CXHD 4PD4D 1PPJD 1SQBD 1EZVD
chains in the Genus database with same CATH superfamily
1IFMA 2B87A 2R5BA 2KNCB 3B8EB 1AA0A 2O3JA 5B66E 1SQVG 5KAFE 2POHA 1SQQK 2PGDA 2OTJP 3M91A 1G1IA 1JOCA 3TSIA 2P2UA 1ZOYC 1NU1K 4YTPC 3WU2H 5AW3B 2IBZE 5CCGA 1BE3J 3FWLA 1RF1A 2NPSC 1URQC 1PP9J 5KLIC 4H13B 2Z5HA 5GTIH 3MD0A 4MN4C 2Q3IA 3T97A 4YXDC 1LTJC 1G2CB 5BU5A 3VP9A 3L71J 1RQVA 3EQ2A 2FBWC 1CW5A 2NPSB 1BSHA 1MV8A 1URQB 5KAIH 4OVNF 2E74C 1G1JA 1SQBK 3SWYA 3BVHA 1VDFA 1LTGC 2CPBA 2KZJA 4BRYA 2WPVB 2E74B 2QA4P 3KYQA 3CL3D 1M8OB 5B5EH 3L73G 5KLVE 1NTKE 1JY3P 2YMKA 2HODA 4U3FJ 2M0BA 2LR2A 3HD7C 4D6TD 1SQXK 2E42A 1PGQA 3LW5J 2Q5UA 1ZW0A 1SVFA 3WMM0 1U7MA 1L0NE 3Q5SA 2KUBA 1JY2P 2WSEH 1USEA 2BASA 1KYOI 3H1IG 4LGDE 1ZV8A 5AVTB 3A0HH 2KOGA 2M5AA 2R3CA 1SQPE 4WY4A 2SPZA 5CMZA 1VQLP 4IFFA 3II6A 2K88A 2P10A 2WZ7A 2N9YB 3E1RA 3H1HD 2J59M 3KQGA 3L70D 3E7KA 3Q5RA 2I1KA 1NTZD 4YXWH 3B5NC 1VF5C 1J1DB 1KB9E 2IZ0A 2N1TA 5C39A 2W90A 1FDMA 3LIEA 2WPQA 4UB6H 2P58A 3VP8A 1S3JA 1FZFA 3L75E 1BGYD 3B5NB 1VF5B 3WUVA 1M90Q 2WMMA 1Y47A 3GW6A 5KTBA 1AQTA 5B66H 1W2EA 1YIJP 1N8RQ 1YJWP 1IJDB 4BXLA 2W8ZA 1OFCX 1DEBA 1KD1Q 1L4AD 1HTLC 1TU3F 3HUSB 3PLNA 1SQQG 2JWAA 1KQGB 4IFMA 1RE3C 1L0LE 3AEGC 1WRGA 4O9BA 4GODA 3A5TA 1FZGA 4N78E 1LTTC 3FGAD 3CWBJ 1MFTA 1K73Q 3CPWO 5AVQB 3B71A 5AVRB 1PGPA 1IFDA 1Q2NA 2IBZD 1YJNP 3U59A 1FOSE 1HGVA 1YTZI 3BCCE 2IFNA 4ZNCA 1VQPP 2Y0EA 3L70J 4PD4H 3RGUA 1K9MQ 2KXPB 4EI2A 1GL2C 4I1LA 3A0BE 3TDKA 3SFDC 1EDKA 2O01J 1PPJG 3GG2A 1S9KE 1IC2A 2AXTE 1M1JC 5BVZA 1GMJA 4PJ0E 3G71P 1YHQP 1NH4A 1Q86Q 1GDTA 1IFPA 4BWNA 1GL2B 1DH3A 1BGYJ 4C7RA 5CBNA 2JR8A 3HTKA 2LXCB 4ASWA 3O6QB 1BE3G 4R4LA 3M9HA 3NTNA 4PD4D 1JMBA 2WVRA 3EFGA 1PP9G 3CCRP 1AVYA 1N7SC 1BCCJ 4HKZH 4I2LC 3H1LD 1NO4A 1DD4A 1LT9C 3H1JD 2R5DA 2QSIA 3L71G 1HUCA 2KSJA 2B9BA 5TISE 3A2AA 1KILC 1NTZK 4KT0J 3GHGC 1N7SB 1NJIQ 1KB9H 3H1KE 4HYTB 1T3UA 5TJHA 2A45H 1N73C 1SQPD 1LT9B 1JCDA 1KILB 2Q1KA 3V2RA 2A06E 3GHGB 2WITA 1R8EA 4U3FG 1BDDA 2AEJA 1M1KQ 2WPRA 2WSSH 1N73B 2P7JA 1SP4A 3M0DC 1EZVG 1KB9D 2WT7A 1GU5A 2E5TA 4U7JA 1T6AA 3VMAA 3RK3E 4WBAA 4L73A 1OVUA 4IL6H 3L75D 1UIIA 4L75A 2P67A 3G9RA 3B4SA 1Q81Q 3IR9A 2JDIH 1FZAA 1EXJA 4YPCA 3S1KA 3H32A 1FAVA 4DT0A 2FXMA 2QVAA 2BCCE 1PIXA 2C9NY 2MJZA 3KZIE 3L74E 5CCGD 5M1BA 3D71A 4JQ0D 1JTHA 3Q1MA 2I1JA 3VMZA 4PD4I 1OWAA 5AVUB 1L0LD 1L4AC 3H1LJ 3H1JJ 4C7NB 2ZXEB 3A0BH 4N78D 4L76A 4GT1A 3AE5C 1NTMD 2FYZA 1WMKA 2AXTH 1OW8A 3PP5A 1EDIA 4PJ0H 1L4AB 1SQPJ 2C0WA 2VRSA 3CCQP 1JY2N 1FS0E 2KZIA 3VMYA 3LIDA 1ZP0C 3BCCD 3GF3A 2YIUC 4GOFA 3CCVP 5APXA 2ZXXA 4OWFA 1VL2A 1LTBC 2OYIB 3KXDA 1LWUC 1SQQJ 3IF4A 3AE7C 2E75C 2KB7P 2DW3A 3HE4A 3CWBG 1DX7A 1NU1J 1EC5A 3V5BA 1KMIZ 5TISH 1M7LA 1LTSC 1SQVE 1KN7A 1FZCA 2E75B 4WB4A 3CX5E 3L70G 2KIKA 1LTJA 1FJPA 1MKMA 1OIPA 1SQPK 4GIFA 1NTZG 4N3YB 1YQ3C 2C9LY 4JF7A 2WTYA 2WWWA 2HPCB 2PFXA 3V6IA 1P84E 4C46A 1OW7A 3FWNA 3OW2O 1YITP 1SQBJ 3CC4P 2R32A 2IZ1A 1RF0C 1RE4C 1BGYG 2N1TD 1L0LJ 3H1KD 1S5LE 4EYYQ 3F89A 3OAKA 2M8RA 4H13C 2Y9ZA 3CC7P 4ZKUA 2H7HA 2L5GB 2RN0A 4OH8B 2AEFA 3ITKA 1NWQA 3HD7A 1NTMJ 3RL0g 1N2DC 2A06D 1BCCG 2IYPA 3CCJP 1SQXJ 1IFIA 3FXEA 1H0TA 2Q6QA 2ZJSE 2OYHC 2GUVA 3L73E 3RK3D 2OTLP 3R2PA 2XDJA 2OQQA 2Q9IA 4JPZB 2B88A 3I5CA 1MFZA 3SWKA 1KZUB 1NAYA 1E5WA 1L0LK 2V4HA 4OGQD 2OYHB 1PFIA 2YXQB 3H1IE 4JYBA 2JWDA 1YI2P 4Y99C 2IBZG 4AUWA 5L8RJ 1NTMK 2BCCD 4DZOA 5CBOA 5CCHC 5AW8B 2ZVNB 3L74D 4Z1MH 3MHVA 2QRXA 2RKLA 3CCUP 5AW1B 1VPCA 1LP1B 4Y99B 3GLMA 1JY3O 3TNUB 1EDLA 1RQUA 1LGHB 3SWFA 2B87B 1SFCA 3M9QA 3MUDA 3CXHI 1EZVI 3D6ZA 1J1DC 2KLUA 4RO0A 1RF1C 3H1KJ 3GF7A 3R4YA 5KJ7A 1GK6A 3BATA 3D6YA 2HYNA 2KK7A 1RE3A 2XU6A 1QGKB 1JCCA 4H0LD 5AVWB 2ZYDA 1FU1A 1RF1B 2ITAA 3H1LG 3H1JG 2QM7A 2V7QH 2RH0A 2KI7B 1XTCC 5AW7B 4UB8E 5AW5B 1JB0J 2LKMA 3T97B 3CMEP 2QJPB 3HUSC 1P84H 1HVVA 1SQPG 5KAFH 2O1JA 1KQFB 2K37A 2NZ2A 1S5LH 3MZWB 4XA4A 2XV5A 3H6PA 5CJ4A 1PGJA 3PH0A 4BRYB 1M1JA 2G3AA 4L74A 1OZHA 4WWIA 2BCCJ 1JO5A 3A7OA 1FDIA 2HODB 1T8ZA 4D6TJ 1KORA 1P84D 2IPPA 3L74J 1NU1G 4WY4C 3AEAC 1JUNA 3HE5A 4W7ZA 3AE2C 1IZNB 3VMXA 2FYUE 4PV1D 2FY8A 2O1KA 2M5AB 4ZKPA 4GOEA 1J1EC 4WY4B 3M9BA 1PGOA 1HF9A 3H1HJ 2N1TC 5AVXB 4I7ZB 2ZAEB 1BE3E 4IOIH 3VOPA 2H88C 3PRJA 1NTZJ 1PP9E 2OTKE 3RL0D 1KQLA 1KQSO 1J2JB 1GU4A 2IFMA 1T2KD 1J1EB 5AVYB 1SQBG 2WSEJ 4WVZA 2K9JA 1KTMA 1IO4A 4DCKA 1L0LG 2XKMA 4Y28J 1U57A 3OJAB 2N1TB 3V2QA 1IK9A 1ZN5A 3SFEC 1X0TA 3L71E 2K3RA 3Q3DA 3Q2YA 3VN0A 1NTMG 1VQ7P 3G6EP 2GUSA 1FZEA 2OGUA 3M0DA 2UWJE 3H1ID 1R5LA 1KC8Q 1SQXG 3RK3C 1FDOA 3O8ZA 3AECC 1AQ5A 3FXDA 5APVA 3KHUA 5KLVD 1NTKD 1CI6A 1Q7YQ 3S4RA 2V7QJ 3KDPB 2YKOA 2KP8A 1AJYA 4ASVA 4U3FE 4TT3H 1KYOE 3RK3B 2JEEA 2ZFCA 3MTUE 3RBXA 1L0ND 2J5UA 2ZT9D 3BRTB 2QJKC 4LC1A 4NPEA 5AVVB 1K8AQ 1EDJA 2YXRB 3AE8C 1LTIC 4R4MA 2KS1A 4UB8H 2O01N 1PZQA 2NPSD 2QJKB 1URQD 3N7NA 5AVSB 5AW4B 1PV3A 2D2CD 2Z4EA 2JJLA 1SQVK 1OMIA 1ZR2A 5DJTB 3M06A 3TK1A 2IBZI 3C8VA 2LXBA 1X79B 1GW4A 1OXZA 5E79E 1FJKA 1OVRA 3NXSA 2GA1A 3H1KG 4DJGA 2KYVA 2H89C 2HLOA 1LWUA 3WU2E 5DJUB 3HTKB 2QIWA 1VQKP 5APUA 4H0LB 2Y0DA 1K04A 3P8MC 2W83C 3HD7D 2FYNC 2FFDA 4GKGA 3WUUA 3CCLP 4RESB 1HBWA 3GMAA 1KILE 1QL1A 3AEFC 5CJ0A 5KLVJ 1NTKJ 1LTAC 5CHXA 2WQYC 2KNCA 4H44D 3AEEC 2FYNB 1CSBA 1L0NJ 3N4XA 3AE9C 1GK4A 2IYOA 2IDBA 2OYIC 5GTHE 3CWBE 2FYUD 3AE4C 3QH9A 1VQ5P 1QVGO 1KFMA 3AE1C 1A02J 3CCMP 2BCCG 4JYCA 4DOJA 1UIXA 1T3JA 1M56D 2I8DA 2M3EA 4PV1C 4D6TG 3TGUE 3L70E 3L74G 1PP9D 4KHXA 1S9KD 2WSCH 3BASA 3USSA 3MIWA 2WT7B 3L72E 5KLVK 1RH5B 1NTKK 1G2CA 5BU8B 2GM4A 1H89A 1BSNA 2NPSA 3A0HE 1KYOH 1URQA 1DIPA 4PV1B 2Z5IA 3L75J 4RKUJ 1KB9I 1SFCD 2W6JH 1L0NK 1WT6A 1OVVA 1T2KC 2Q3EA 3G3ZA 3C1LA 4HH2A 2A45I 1BGYE 2FXPA 2ZYGA 3H1HG 5KJ7D 3V4WA 3IAOA 2NRGA 3H32B 3L36A 4A7PA 3U1CA 2JO1A 3E1IA 1BCCE 1HH0A 4U3FD 1KYOD 1ZLLA 1JTHB 3JSVC 3JCUE 2P1JA 4B86A 3VTPC 5CCHA 2W6BA 3QWOC 1D7MA 1VQ4P 5APWA 3RBZA 3C9IA 5E79H 4XE5B 2ZT9C 4W7YA 1HJBA 2R3SA 2FYUJ 1Q90D 3CLQA 1AFOA 1GL2D 2YNYA 5APTA 3I56P 3BCCJ 1Z56A 1U7JA 3JC22 2H43A 2ZT9B 4TLFA 3KZIH 1FZCC 2D2CC 3BRVB 3HE4B 1KFNA 4NPDA 2KLVA 1GD2E 3B5NA 3V4QA 4IL6X 1M57D 2QEXP 1GTWA 2QG4A 5AW9B 3L37A 5KLIB 1N7SD 3G4SP 3AE3C 1FZCB 2D2CB 5GTHH 1LTJB 2FYUK 3L4FA 2R44A 1S72P 4PD4E 2QJYC 1FZBA 3HUSA 1AVOA 1KILD 2WSCJ 1KV4A 1ZRTE 2MKVA 1Y9BA 3SSUA 1Q82Q 1EQ7A 2AXCA 1FC2C 1FBMA 3H1LE 3CC2P 3H1JE 4LLHA 5APQA 2QJYB 2Y0CA 5CCGC 1JY2O 1X8YA 1H88A 2O01H 3CWBD 2XNDH 1S1CX 4HJGH 4H44C 3HD7B 2G8YA 5KLVG 3RK2D 2QJPC 1NTKG 1R5SA 3CX5H 2C0XA 3ZDMA 3PTZA 3TGUD 1H0TB 2HG5D 2PAJA 5H2FE 2N9BA 1QLED 2YO3A 4H44B 2OYOA 1L0NG 1SQQE 3L72D 3UIAA 3EFFK 1ZR4A 1NU1E 2JKVA 1SQVD 2K1AA 1GL2A 1QVFO 3JCUH 3CX5D 3O6QA 2Y9YA 3TF5A 2PRRA 1LNQA 2E76D 1CZQA 2AEMA 1A02F 3ABVC 1SFCC 3K5BA 1LT1A 1QEXA 5APSA 1BCCD 1VQ6P 5K5GB 1NAFA 3MUDC 2A45G 3AE6C 4RJTA 2YKPA 4N6JA 3NFQA 4W80A 4KJMA 5KJ7C 3L75G 4JBZA 4IL6E 5AW0B 4I7ZC 3H25A 1N7SA 1PPJE 1NKNA 1SQBE 3FX0A 1SFCB 1NGMB 3CCEP 1IFJA 1HGZA 4GDOA 1JMMA 1LT9A 2M3BA 2WSFH 1EXIA 1KILA 1NTME 3GHGA 2XNXA 1LJ2A 1H8AA 1SQXE 3IN6A 5KKZC 1N73A 2E75D 1DEEG 4QMAA 3L73D 5AW2B 3TGUJ 3CMAP 3AEBC 1VQ8P 3U1AA 3P8CE 4EOTA 4HB1A 5EFWB 3P7KA 1NKZB 1GW3A 5KKZB 3CCSP 3L72J 1YJ9P 1PL5A 3WUTA 2FYUG 1N86A 1ZXGA 3V2NA 3VYIA 1SQVJ 1NYHA 3BCCG 1SLQA 1N7LA 3PJSK 4OGQC 1YBKA 2KSEA 3CI9A 1M1JB 1FOSF 2E43A 3CX5I 4AYCA 1JM0A 1ZRTD 1SS1A 2YMYA 1FE6A 3CXHE 4H13D 1K05A 1EZVE 4XFJA 4C7NA 3CD6P 1NHLA 4OGQB 5H2FH 3HE5B 3TYYA 1BDCA 3OA7A 2CPSA 2W6AA 4NPFX 2PP6A 1P84I 1W5CE 2H8PD 2HFED 4IFDK 5AW6B 1L4AA 1HJ0A 4I6MC 1YTZT 1MUUA 1ZMEC 4CPGA 1JEKA 2OYIA 2YO2A 2E74D 2K9YA 4EIJA 3I55P 1SQQD 2W27A 4H0LC 2K9JB 4K35A 3L73J 3RK2C 2IX7C 4K3AA 2HR3A 1NOHA 3KPEA 1S4XA 1NU1D 1VQNP 1QX8A 1VQ9P 2WSFJ 3Q5PA 2A06G 3H1IJ 2XZRA 1X22A 5CCHD 3MP7B 1OW6A 2BEZF 3RK2B 4M3LA 2YKQA 2RMZA 2E5YA 1VQOP 1S5LX 5GTIE 5AVZB 3M0AA 1L2PA 1CI6B 2HPCA 1X9VA 2QM8A 2OARA 2QE7H 4D6TE 5KAIE 2BEQD 1DD3A 1NVOA 2E76C 3HRNA 3F5HA 1PPJD 1SQBD 4AQRD 1XTGB 1HWTC 3L35A 1MZ9A 2J58A 1YYCA 2L91A 4EDFA 1YQ4C 2KS1B 2Q7CA 1IFNA 1QL2A 2WPSA 5APYA 1JY3N 3D70A 3B5ND 1VF5D 2JP3A 2E76B 1RHZB 5B5EE 1RF0A 1BE3D 1RE4A 3H1HE 1JNMA 1SQXD 3PHLA 1W2BO 3V2PA 1NTZE 3W67A 3IFMA 1OX3A 3P32A 3P8CD 3EWKA 2B89A 3L71D 2FXOA 3RL0C 3LW5H 3MGNA 3NMDA 3CXHH 2CK3H 2FFDC 2YIUB 4ZMDA 2OYHA 1IK7A 1AV1A 1LWUB 3RL0B 2FKWB 1S2EA 3AEDC 2ZVOB 3A3YB 3S9OA 1USDA 3TGUG 2ZYAA 2FFDB 4WY4D 4UB6E 1RY3A 1VQMP 1E79H 3W68A 1GZLA 1LP1A 3CXHD 3L72G 1Y8AA 3TNUA 1EZVD
chains in the Genus database with same CATH topology
1PP9D 3PLNA 4D6TD 2KNCB 2L91A 2QJPB 4EDFA 2O3JA 2JWAA 3PTZA 3TGUD 3H1LD 3H1JD 3H1ID 1BE3D 2BCCD 3L72D 3L73D 1SQXD 3PHLA 1L0LD 2Q3EA 3L74D 2Y0DA 5TJHA 1SQQD 2N9YB 3FWLA 3KHUA 5KLVD 3H1HD 1NTKD 2QG4A 2K9JB 5KKZB 1SQPD 1SQVD 3L70D 5KLIB 3H1KD 1P84D 2IBZD 1NTMD 3CX5D 3L71D 1NTZD 1NU1D 3TF5A 4A7PA 1L0ND 2RN0A 2Y0EA 3ITKA 4U3FD 1KYOD 3BCCD 2YIUB 2A06D 3TDKA 2FYNB 2KS1A 1BCCD 2RMZA 1KB9D 3GG2A 1BGYD 4RJTA 3VMAA 2FYUD 1ZRTD 2QJKB 2QJYB 2Y0CA 3GW6A 3L75D 3PRJA 3CWBD 3CXHD 4PD4D 1PPJD 1SQBD 1EZVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 D;  3PLN A;  4D6T D;  2KNC B;  2L91 A;  2QJP B;  4EDF A;  2O3J A;  2JWA A;  3PTZ A;  3TGU D;  3H1L D;  3H1J D;  3H1I D;  1BE3 D;  2BCC D;  3L72 D;  3L73 D;  1SQX D;  3PHL A;  1L0L D;  2Q3E A;  3L74 D;  2Y0D A;  5TJH A;  1SQQ D;  2N9Y B;  3FWL A;  3KHU A;  5KLV D;  3H1H D;  1NTK D;  2QG4 A;  2K9J B;  5KKZ B;  1SQP D;  1SQV D;  3L70 D;  5KLI B;  3H1K D;  1P84 D;  2IBZ D;  1NTM D;  3CX5 D;  3L71 D;  1NTZ D;  1NU1 D;  3TF5 A;  4A7P A;  1L0N D;  2RN0 A;  2Y0E A;  3ITK A;  4U3F D;  1KYO D;  3BCC D;  2YIU B;  2A06 D;  3TDK A;  2FYN B;  2KS1 A;  1BCC D;  2RMZ A;  1KB9 D;  3GG2 A;  1BGY D;  4RJT A;  3VMA A;  2FYU D;  1ZRT D;  2QJK B;  2QJY B;  2Y0C A;  3GW6 A;  3L75 D;  3PRJ A;  3CWB D;  3CXH D;  4PD4 D;  1PPJ D;  1SQB D;  1EZV D; 
#chains in the Genus database with same CATH topology
 1IFM A;  2B87 A;  2R5B A;  2KNC B;  3B8E B;  1AA0 A;  2O3J A;  5B66 E;  1SQV G;  5KAF E;  2POH A;  1SQQ K;  2PGD A;  2OTJ P;  3M91 A;  1G1I A;  1JOC A;  3TSI A;  2P2U A;  1ZOY C;  1NU1 K;  4YTP C;  3WU2 H;  5AW3 B;  2IBZ E;  5CCG A;  1BE3 J;  3FWL A;  1RF1 A;  2NPS C;  1URQ C;  1PP9 J;  5KLI C;  4H13 B;  2Z5H A;  5GTI H;  3MD0 A;  4MN4 C;  2Q3I A;  3T97 A;  4YXD C;  1LTJ C;  1G2C B;  5BU5 A;  3VP9 A;  3L71 J;  1RQV A;  3EQ2 A;  2FBW C;  1CW5 A;  2NPS B;  1BSH A;  1MV8 A;  1URQ B;  5KAI H;  4OVN F;  2E74 C;  1G1J A;  1SQB K;  3SWY A;  3BVH A;  1VDF A;  1LTG C;  2CPB A;  2KZJ A;  4BRY A;  2WPV B;  2E74 B;  2QA4 P;  3KYQ A;  3CL3 D;  1M8O B;  5B5E H;  3L73 G;  5KLV E;  1NTK E;  1JY3 P;  2YMK A;  2HOD A;  4U3F J;  2M0B A;  2LR2 A;  3HD7 C;  4D6T D;  1SQX K;  2E42 A;  1PGQ A;  3LW5 J;  2Q5U A;  1ZW0 A;  1SVF A;  3WMM 0;  1U7M A;  1L0N E;  3Q5S A;  2KUB A;  1JY2 P;  2WSE H;  1USE A;  2BAS A;  1KYO I;  3H1I G;  4LGD E;  1ZV8 A;  5AVT B;  3A0H H;  2KOG A;  2M5A A;  2R3C A;  1SQP E;  4WY4 A;  2SPZ A;  5CMZ A;  1VQL P;  4IFF A;  3II6 A;  2K88 A;  2P10 A;  2WZ7 A;  2N9Y B;  3E1R A;  3H1H D;  2J59 M;  3KQG A;  3L70 D;  3E7K A;  3Q5R A;  2I1K A;  1NTZ D;  4YXW H;  3B5N C;  1VF5 C;  1J1D B;  1KB9 E;  2IZ0 A;  2N1T A;  5C39 A;  2W90 A;  1FDM A;  3LIE A;  2WPQ A;  4UB6 H;  2P58 A;  3VP8 A;  1S3J A;  1FZF A;  3L75 E;  1BGY D;  3B5N B;  1VF5 B;  3WUV A;  1M90 Q;  2WMM A;  1Y47 A;  3GW6 A;  5KTB A;  1AQT A;  5B66 H;  1W2E A;  1YIJ P;  1N8R Q;  1YJW P;  1IJD B;  4BXL A;  2W8Z A;  1OFC X;  1DEB A;  1KD1 Q;  1L4A D;  1HTL C;  1TU3 F;  3HUS B;  3PLN A;  1SQQ G;  2JWA A;  1KQG B;  4IFM A;  1RE3 C;  1L0L E;  3AEG C;  1WRG A;  4O9B A;  4GOD A;  3A5T A;  1FZG A;  4N78 E;  1LTT C;  3FGA D;  3CWB J;  1MFT A;  1K73 Q;  3CPW O;  5AVQ B;  3B71 A;  5AVR B;  1PGP A;  1IFD A;  1Q2N A;  2IBZ D;  1YJN P;  3U59 A;  1FOS E;  1HGV A;  1YTZ I;  3BCC E;  2IFN A;  4ZNC A;  1VQP P;  2Y0E A;  3L70 J;  4PD4 H;  3RGU A;  1K9M Q;  2KXP B;  4EI2 A;  1GL2 C;  4I1L A;  3A0B E;  3TDK A;  3SFD C;  1EDK A;  2O01 J;  1PPJ G;  3GG2 A;  1S9K E;  1IC2 A;  2AXT E;  1M1J C;  5BVZ A;  1GMJ A;  4PJ0 E;  3G71 P;  1YHQ P;  1NH4 A;  1Q86 Q;  1GDT A;  1IFP A;  4BWN A;  1GL2 B;  1DH3 A;  1BGY J;  4C7R A;  5CBN A;  2JR8 A;  3HTK A;  2LXC B;  4ASW A;  3O6Q B;  1BE3 G;  4R4L A;  3M9H A;  3NTN A;  4PD4 D;  1JMB A;  2WVR A;  3EFG A;  1PP9 G;  3CCR P;  1AVY A;  1N7S C;  1BCC J;  4HKZ H;  4I2L C;  3H1L D;  1NO4 A;  1DD4 A;  1LT9 C;  3H1J D;  2R5D A;  2QSI A;  3L71 G;  1HUC A;  2KSJ A;  2B9B A;  5TIS E;  3A2A A;  1KIL C;  1NTZ K;  4KT0 J;  3GHG C;  1N7S B;  1NJI Q;  1KB9 H;  3H1K E;  4HYT B;  1T3U A;  5TJH A;  2A45 H;  1N73 C;  1SQP D;  1LT9 B;  1JCD A;  1KIL B;  2Q1K A;  3V2R A;  2A06 E;  3GHG B;  2WIT A;  1R8E A;  4U3F G;  1BDD A;  2AEJ A;  1M1K Q;  2WPR A;  2WSS H;  1N73 B;  2P7J A;  1SP4 A;  3M0D C;  1EZV G;  1KB9 D;  2WT7 A;  1GU5 A;  2E5T A;  4U7J A;  1T6A A;  3VMA A;  3RK3 E;  4WBA A;  4L73 A;  1OVU A;  4IL6 H;  3L75 D;  1UII A;  4L75 A;  2P67 A;  3G9R A;  3B4S A;  1Q81 Q;  3IR9 A;  2JDI H;  1FZA A;  1EXJ A;  4YPC A;  3S1K A;  3H32 A;  1FAV A;  4DT0 A;  2FXM A;  2QVA A;  2BCC E;  1PIX A;  2C9N Y;  2MJZ A;  3KZI E;  3L74 E;  5CCG D;  5M1B A;  3D71 A;  4JQ0 D;  1JTH A;  3Q1M A;  2I1J A;  3VMZ A;  4PD4 I;  1OWA A;  5AVU B;  1L0L D;  1L4A C;  3H1L J;  3H1J J;  4C7N B;  2ZXE B;  3A0B H;  4N78 D;  4L76 A;  4GT1 A;  3AE5 C;  1NTM D;  2FYZ A;  1WMK A;  2AXT H;  1OW8 A;  3PP5 A;  1EDI A;  4PJ0 H;  1L4A B;  1SQP J;  2C0W A;  2VRS A;  3CCQ P;  1JY2 N;  1FS0 E;  2KZI A;  3VMY A;  3LID A;  1ZP0 C;  3BCC D;  3GF3 A;  2YIU C;  4GOF A;  3CCV P;  5APX A;  2ZXX A;  4OWF A;  1VL2 A;  1LTB C;  2OYI B;  3KXD A;  1LWU C;  1SQQ J;  3IF4 A;  3AE7 C;  2E75 C;  2KB7 P;  2DW3 A;  3HE4 A;  3CWB G;  1DX7 A;  1NU1 J;  1EC5 A;  3V5B A;  1KMI Z;  5TIS H;  1M7L A;  1LTS C;  1SQV E;  1KN7 A;  1FZC A;  2E75 B;  4WB4 A;  3CX5 E;  3L70 G;  2KIK A;  1LTJ A;  1FJP A;  1MKM A;  1OIP A;  1SQP K;  4GIF A;  1NTZ G;  4N3Y B;  1YQ3 C;  2C9L Y;  4JF7 A;  2WTY A;  2WWW A;  2HPC B;  2PFX A;  3V6I A;  1P84 E;  4C46 A;  1OW7 A;  3FWN A;  3OW2 O;  1YIT P;  1SQB J;  3CC4 P;  2R32 A;  2IZ1 A;  1RF0 C;  1RE4 C;  1BGY G;  2N1T D;  1L0L J;  3H1K D;  1S5L E;  4EYY Q;  3F89 A;  3OAK A;  2M8R A;  4H13 C;  2Y9Z A;  3CC7 P;  4ZKU A;  2H7H A;  2L5G B;  2RN0 A;  4OH8 B;  2AEF A;  3ITK A;  1NWQ A;  3HD7 A;  1NTM J;  3RL0 g;  1N2D C;  2A06 D;  1BCC G;  2IYP A;  3CCJ P;  1SQX J;  1IFI A;  3FXE A;  1H0T A;  2Q6Q A;  2ZJS E;  2OYH C;  2GUV A;  3L73 E;  3RK3 D;  2OTL P;  3R2P A;  2XDJ A;  2OQQ A;  2Q9I A;  4JPZ B;  2B88 A;  3I5C A;  1MFZ A;  3SWK A;  1KZU B;  1NAY A;  1E5W A;  1L0L K;  2V4H A;  4OGQ D;  2OYH B;  1PFI A;  2YXQ B;  3H1I E;  4JYB A;  2JWD A;  1YI2 P;  4Y99 C;  2IBZ G;  4AUW A;  5L8R J;  1NTM K;  2BCC D;  4DZO A;  5CBO A;  5CCH C;  5AW8 B;  2ZVN B;  3L74 D;  4Z1M H;  3MHV A;  2QRX A;  2RKL A;  3CCU P;  5AW1 B;  1VPC A;  1LP1 B;  4Y99 B;  3GLM A;  1JY3 O;  3TNU B;  1EDL A;  1RQU A;  1LGH B;  3SWF A;  2B87 B;  1SFC A;  3M9Q A;  3MUD A;  3CXH I;  1EZV I;  3D6Z A;  1J1D C;  2KLU A;  4RO0 A;  1RF1 C;  3H1K J;  3GF7 A;  3R4Y A;  5KJ7 A;  1GK6 A;  3BAT A;  3D6Y A;  2HYN A;  2KK7 A;  1RE3 A;  2XU6 A;  1QGK B;  1JCC A;  4H0L D;  5AVW B;  2ZYD A;  1FU1 A;  1RF1 B;  2ITA A;  3H1L G;  3H1J G;  2QM7 A;  2V7Q H;  2RH0 A;  2KI7 B;  1XTC C;  5AW7 B;  4UB8 E;  5AW5 B;  1JB0 J;  2LKM A;  3T97 B;  3CME P;  2QJP B;  3HUS C;  1P84 H;  1HVV A;  1SQP G;  5KAF H;  2O1J A;  1KQF B;  2K37 A;  2NZ2 A;  1S5L H;  3MZW B;  4XA4 A;  2XV5 A;  3H6P A;  5CJ4 A;  1PGJ A;  3PH0 A;  4BRY B;  1M1J A;  2G3A A;  4L74 A;  1OZH A;  4WWI A;  2BCC J;  1JO5 A;  3A7O A;  1FDI A;  2HOD B;  1T8Z A;  4D6T J;  1KOR A;  1P84 D;  2IPP A;  3L74 J;  1NU1 G;  4WY4 C;  3AEA C;  1JUN A;  3HE5 A;  4W7Z A;  3AE2 C;  1IZN B;  3VMX A;  2FYU E;  4PV1 D;  2FY8 A;  2O1K A;  2M5A B;  4ZKP A;  4GOE A;  1J1E C;  4WY4 B;  3M9B A;  1PGO A;  1HF9 A;  3H1H J;  2N1T C;  5AVX B;  4I7Z B;  2ZAE B;  1BE3 E;  4IOI H;  3VOP A;  2H88 C;  3PRJ A;  1NTZ J;  1PP9 E;  2OTK E;  3RL0 D;  1KQL A;  1KQS O;  1J2J B;  1GU4 A;  2IFM A;  1T2K D;  1J1E B;  5AVY B;  1SQB G;  2WSE J;  4WVZ A;  2K9J A;  1KTM A;  1IO4 A;  4DCK A;  1L0L G;  2XKM A;  4Y28 J;  1U57 A;  3OJA B;  2N1T B;  3V2Q A;  1IK9 A;  1ZN5 A;  3SFE C;  1X0T A;  3L71 E;  2K3R A;  3Q3D A;  3Q2Y A;  3VN0 A;  1NTM G;  1VQ7 P;  3G6E P;  2GUS A;  1FZE A;  2OGU A;  3M0D A;  2UWJ E;  3H1I D;  1R5L A;  1KC8 Q;  1SQX G;  3RK3 C;  1FDO A;  3O8Z A;  3AEC C;  1AQ5 A;  3FXD A;  5APV A;  3KHU A;  5KLV D;  1NTK D;  1CI6 A;  1Q7Y Q;  3S4R A;  2V7Q J;  3KDP B;  2YKO A;  2KP8 A;  1AJY A;  4ASV A;  4U3F E;  4TT3 H;  1KYO E;  3RK3 B;  2JEE A;  2ZFC A;  3MTU E;  3RBX A;  1L0N D;  2J5U A;  2ZT9 D;  3BRT B;  2QJK C;  4LC1 A;  4NPE A;  5AVV B;  1K8A Q;  1EDJ A;  2YXR B;  3AE8 C;  1LTI C;  4R4M A;  2KS1 A;  4UB8 H;  2O01 N;  1PZQ A;  2NPS D;  2QJK B;  1URQ D;  3N7N A;  5AVS B;  5AW4 B;  1PV3 A;  2D2C D;  2Z4E A;  2JJL A;  1SQV K;  1OMI A;  1ZR2 A;  5DJT B;  3M06 A;  3TK1 A;  2IBZ I;  3C8V A;  2LXB A;  1X79 B;  1GW4 A;  1OXZ A;  5E79 E;  1FJK A;  1OVR A;  3NXS A;  2GA1 A;  3H1K G;  4DJG A;  2KYV A;  2H89 C;  2HLO A;  1LWU A;  3WU2 E;  5DJU B;  3HTK B;  2QIW A;  1VQK P;  5APU A;  4H0L B;  2Y0D A;  1K04 A;  3P8M C;  2W83 C;  3HD7 D;  2FYN C;  2FFD A;  4GKG A;  3WUU A;  3CCL P;  4RES B;  1HBW A;  3GMA A;  1KIL E;  1QL1 A;  3AEF C;  5CJ0 A;  5KLV J;  1NTK J;  1LTA C;  5CHX A;  2WQY C;  2KNC A;  4H44 D;  3AEE C;  2FYN B;  1CSB A;  1L0N J;  3N4X A;  3AE9 C;  1GK4 A;  2IYO A;  2IDB A;  2OYI C;  5GTH E;  3CWB E;  2FYU D;  3AE4 C;  3QH9 A;  1VQ5 P;  1QVG O;  1KFM A;  3AE1 C;  1A02 J;  3CCM P;  2BCC G;  4JYC A;  4DOJ A;  1UIX A;  1T3J A;  1M56 D;  2I8D A;  2M3E A;  4PV1 C;  4D6T G;  3TGU E;  3L70 E;  3L74 G;  1PP9 D;  4KHX A;  1S9K D;  2WSC H;  3BAS A;  3USS A;  3MIW A;  2WT7 B;  3L72 E;  5KLV K;  1RH5 B;  1NTK K;  1G2C A;  5BU8 B;  2GM4 A;  1H89 A;  1BSN A;  2NPS A;  3A0H E;  1KYO H;  1URQ A;  1DIP A;  4PV1 B;  2Z5I A;  3L75 J;  4RKU J;  1KB9 I;  1SFC D;  2W6J H;  1L0N K;  1WT6 A;  1OVV A;  1T2K C;  2Q3E A;  3G3Z A;  3C1L A;  4HH2 A;  2A45 I;  1BGY E;  2FXP A;  2ZYG A;  3H1H G;  5KJ7 D;  3V4W A;  3IAO A;  2NRG A;  3H32 B;  3L36 A;  4A7P A;  3U1C A;  2JO1 A;  3E1I A;  1BCC E;  1HH0 A;  4U3F D;  1KYO D;  1ZLL A;  1JTH B;  3JSV C;  3JCU E;  2P1J A;  4B86 A;  3VTP C;  5CCH A;  2W6B A;  3QWO C;  1D7M A;  1VQ4 P;  5APW A;  3RBZ A;  3C9I A;  5E79 H;  4XE5 B;  2ZT9 C;  4W7Y A;  1HJB A;  2R3S A;  2FYU J;  1Q90 D;  3CLQ A;  1AFO A;  1GL2 D;  2YNY A;  5APT A;  3I56 P;  3BCC J;  1Z56 A;  1U7J A;  3JC2 2;  2H43 A;  2ZT9 B;  4TLF A;  3KZI H;  1FZC C;  2D2C C;  3BRV B;  3HE4 B;  1KFN A;  4NPD A;  2KLV A;  1GD2 E;  3B5N A;  3V4Q A;  4IL6 X;  1M57 D;  2QEX P;  1GTW A;  2QG4 A;  5AW9 B;  3L37 A;  5KLI B;  1N7S D;  3G4S P;  3AE3 C;  1FZC B;  2D2C B;  5GTH H;  1LTJ B;  2FYU K;  3L4F A;  2R44 A;  1S72 P;  4PD4 E;  2QJY C;  1FZB A;  3HUS A;  1AVO A;  1KIL D;  2WSC J;  1KV4 A;  1ZRT E;  2MKV A;  1Y9B A;  3SSU A;  1Q82 Q;  1EQ7 A;  2AXC A;  1FC2 C;  1FBM A;  3H1L E;  3CC2 P;  3H1J E;  4LLH A;  5APQ A;  2QJY B;  2Y0C A;  5CCG C;  1JY2 O;  1X8Y A;  1H88 A;  2O01 H;  3CWB D;  2XND H;  1S1C X;  4HJG H;  4H44 C;  3HD7 B;  2G8Y A;  5KLV G;  3RK2 D;  2QJP C;  1NTK G;  1R5S A;  3CX5 H;  2C0X A;  3ZDM A;  3PTZ A;  3TGU D;  1H0T B;  2HG5 D;  2PAJ A;  5H2F E;  2N9B A;  1QLE D;  2YO3 A;  4H44 B;  2OYO A;  1L0N G;  1SQQ E;  3L72 D;  3UIA A;  3EFF K;  1ZR4 A;  1NU1 E;  2JKV A;  1SQV D;  2K1A A;  1GL2 A;  1QVF O;  3JCU H;  3CX5 D;  3O6Q A;  2Y9Y A;  3TF5 A;  2PRR A;  1LNQ A;  2E76 D;  1CZQ A;  2AEM A;  1A02 F;  3ABV C;  1SFC C;  3K5B A;  1LT1 A;  1QEX A;  5APS A;  1BCC D;  1VQ6 P;  5K5G B;  1NAF A;  3MUD C;  2A45 G;  3AE6 C;  4RJT A;  2YKP A;  4N6J A;  3NFQ A;  4W80 A;  4KJM A;  5KJ7 C;  3L75 G;  4JBZ A;  4IL6 E;  5AW0 B;  4I7Z C;  3H25 A;  1N7S A;  1PPJ E;  1NKN A;  1SQB E;  3FX0 A;  1SFC B;  1NGM B;  3CCE P;  1IFJ A;  1HGZ A;  4GDO A;  1JMM A;  1LT9 A;  2M3B A;  2WSF H;  1EXI A;  1KIL A;  1NTM E;  3GHG A;  2XNX A;  1LJ2 A;  1H8A A;  1SQX E;  3IN6 A;  5KKZ C;  1N73 A;  2E75 D;  1DEE G;  4QMA A;  3L73 D;  5AW2 B;  3TGU J;  3CMA P;  3AEB C;  1VQ8 P;  3U1A A;  3P8C E;  4EOT A;  4HB1 A;  5EFW B;  3P7K A;  1NKZ B;  1GW3 A;  5KKZ B;  3CCS P;  3L72 J;  1YJ9 P;  1PL5 A;  3WUT A;  2FYU G;  1N86 A;  1ZXG A;  3V2N A;  3VYI A;  1SQV J;  1NYH A;  3BCC G;  1SLQ A;  1N7L A;  3PJS K;  4OGQ C;  1YBK A;  2KSE A;  3CI9 A;  1M1J B;  1FOS F;  2E43 A;  3CX5 I;  4AYC A;  1JM0 A;  1ZRT D;  1SS1 A;  2YMY A;  1FE6 A;  3CXH E;  4H13 D;  1K05 A;  1EZV E;  4XFJ A;  4C7N A;  3CD6 P;  1NHL A;  4OGQ B;  5H2F H;  3HE5 B;  3TYY A;  1BDC A;  3OA7 A;  2CPS A;  2W6A A;  4NPF X;  2PP6 A;  1P84 I;  1W5C E;  2H8P D;  2HFE D;  4IFD K;  5AW6 B;  1L4A A;  1HJ0 A;  4I6M C;  1YTZ T;  1MUU A;  1ZME C;  4CPG A;  1JEK A;  2OYI A;  2YO2 A;  2E74 D;  2K9Y A;  4EIJ A;  3I55 P;  1SQQ D;  2W27 A;  4H0L C;  2K9J B;  4K35 A;  3L73 J;  3RK2 C;  2IX7 C;  4K3A A;  2HR3 A;  1NOH A;  3KPE A;  1S4X A;  1NU1 D;  1VQN P;  1QX8 A;  1VQ9 P;  2WSF J;  3Q5P A;  2A06 G;  3H1I J;  2XZR A;  1X22 A;  5CCH D;  3MP7 B;  1OW6 A;  2BEZ F;  3RK2 B;  4M3L A;  2YKQ A;  2RMZ A;  2E5Y A;  1VQO P;  1S5L X;  5GTI E;  5AVZ B;  3M0A A;  1L2P A;  1CI6 B;  2HPC A;  1X9V A;  2QM8 A;  2OAR A;  2QE7 H;  4D6T E;  5KAI E;  2BEQ D;  1DD3 A;  1NVO A;  2E76 C;  3HRN A;  3F5H A;  1PPJ D;  1SQB D;  4AQR D;  1XTG B;  1HWT C;  3L35 A;  1MZ9 A;  2J58 A;  1YYC A;  2L91 A;  4EDF A;  1YQ4 C;  2KS1 B;  2Q7C A;  1IFN A;  1QL2 A;  2WPS A;  5APY A;  1JY3 N;  3D70 A;  3B5N D;  1VF5 D;  2JP3 A;  2E76 B;  1RHZ B;  5B5E E;  1RF0 A;  1BE3 D;  1RE4 A;  3H1H E;  1JNM A;  1SQX D;  3PHL A;  1W2B O;  3V2P A;  1NTZ E;  3W67 A;  3IFM A;  1OX3 A;  3P32 A;  3P8C D;  3EWK A;  2B89 A;  3L71 D;  2FXO A;  3RL0 C;  3LW5 H;  3MGN A;  3NMD A;  3CXH H;  2CK3 H;  2FFD C;  2YIU B;  4ZMD A;  2OYH A;  1IK7 A;  1AV1 A;  1LWU B;  3RL0 B;  2FKW B;  1S2E A;  3AED C;  2ZVO B;  3A3Y B;  3S9O A;  1USD A;  3TGU G;  2ZYA A;  2FFD B;  4WY4 D;  4UB6 E;  1RY3 A;  1VQM P;  1E79 H;  3W68 A;  1GZL A;  1LP1 A;  3CXH D;  3L72 G;  1Y8A A;  3TNU A;  1EZV D; 
#chains in the Genus database with same CATH homology
 1PP9 D;  3PLN A;  4D6T D;  2KNC B;  2L91 A;  2QJP B;  4EDF A;  2O3J A;  2JWA A;  3PTZ A;  3TGU D;  3H1L D;  3H1J D;  3H1I D;  1BE3 D;  2BCC D;  3L72 D;  3L73 D;  1SQX D;  3PHL A;  1L0L D;  2Q3E A;  3L74 D;  2Y0D A;  5TJH A;  1SQQ D;  2N9Y B;  3FWL A;  3KHU A;  5KLV D;  3H1H D;  1NTK D;  2QG4 A;  2K9J B;  5KKZ B;  1SQP D;  1SQV D;  3L70 D;  5KLI B;  3H1K D;  1P84 D;  2IBZ D;  1NTM D;  3CX5 D;  3L71 D;  1NTZ D;  1NU1 D;  3TF5 A;  4A7P A;  1L0N D;  2RN0 A;  2Y0E A;  3ITK A;  4U3F D;  1KYO D;  3BCC D;  2YIU B;  2A06 D;  3TDK A;  2FYN B;  2KS1 A;  1BCC D;  2RMZ A;  1KB9 D;  3GG2 A;  1BGY D;  4RJT A;  3VMA A;  2FYU D;  1ZRT D;  2QJK B;  2QJY B;  2Y0C A;  3GW6 A;  3L75 D;  3PRJ A;  3CWB D;  3CXH D;  4PD4 D;  1PPJ D;  1SQB D;  1EZV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...