2RNAA

Itk sh3 average minimized
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
GSPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title NMR structure note: murine Itk SH3 domain
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 9
structure length 64
sequence length 64
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rnaA00
1MUZA 3TSZA 1BK2A 2RQVA 1H92A 1UG1A 1YP5A 2ECZA 1CKAA 1U06A 2D8HA 2JM8A 2KYBA 4HCKA 2KRSA 4AFZC 2ED0A 2IIMA 4LNPA 4DEXA 1WFWA 1M30A 1W6XA 4J9BA 4ORZA 1YNZA 1A0NB 2DILA 4JJDA 1B07A 1T0HA 4RTTA 2O9SA 3ULRB 5IH2A 1WXBA 3EG1A 1OV3A 3M0UA 1ARKA 1GCPA 3LH5A 3UA6A 3NMZC 1M3AA 1M3CA 3VS0A 1PNJA 2W10A 2ENMA 2P4RA 1PRMC 1M27C 2RQWA 2OAWA 2CDTA 1QCFA 2GGRA 4RTYA 2A28A 3I9QA 2K6DA 1Y57A 2OJ2A 1J3TA 3M0TA 2RNAA 1B3QA 4RTVA 4OMNA 2JXBA 2HDAA 2LMJA 1YN8A 1U3OA 1HJDA 2HEQA 1FMKA 1ZUUA 2FPDA 3QWXX 3SEMA 1Y0MA 2HCKA 4ZNXA 1W1FA 2D0NA 2EVRA 1SHFA 2AZVA 1X2QA 2DL4A 4OMLA 1OOTA 1E6GA 1NM7A 4AFSC 1AWWA 2RQTA 3O5ZA 4HVUA 2V1RA 2BZ8A 4OMOA 1GCQC 1WYXA 3VS7A 2GBQA 2KBTA 5IHKA 2JW4A 2KEAA 2LQWA 3TVTA 1OPLA 2K7AA 4HVWA 1NEBA 2JS2A 4OMMA 3VS1A 1OPKA 1K1ZA 2DVJA 2YSQA 1UUEA 4Z8AA 1MV0B 2DRKA 1LCKA 2OI3A 4JPBW 2EGCA 2M51A 3H0FA 4RTUA 2DLPA 3EHQA 1NLOC 3C0CA 1X6BA 3QWYA 4D8DA 1RLQC 3I35A 2CT4A 1OEBA 4JJCA 2YUNA 5IHNA 2L3PA 4Z89A 2V1QA 1TG0A 2DNUA 3PVLA 2YUPA 4WCIA 2EYZA 1UHCA 2JM9A 1PHTA 1EFNA 1U5SA 1AWOA 1JQQA 2DL7A 1ABOA 2EKHA 2CUDA 1AWXA 2SRCA 1SEMA 1NYGA 2LNHB 3UA7A 1WIEA 2ROTA 4FSSA 2JTEA 3I5RA 2K9GA 3VRYA 2FG0A 2C0OA 1K76A 4RTXA 2AKKA 1X2KA 2XMFA 1AOJA 2PZ1A 1AD5A 2C0TA 1CSKA 2FPEA 2KRMA 5HCKA 1NLPC 1QLYA 4AFQC 2JMCA 1KIKA 5GJVB 1H3HA 1SRLA 1E6HA 1GFCA 2LP5A 4CC7A 1WI7A 3JV3A 2EQIA 4R0KA 1VYUA 4J9HA 1GBQA 2DYBA 3KFVA 3RBBB 2BTTA 2YUOA 1WXUA 2O9VA 1Z9QA 1X6GA 4K11A 2LJ0A 1CKBA 2ESWA 2K79A 1GCQA 1AZEA 2CH4W 1PKTA 1N5ZA 4OMQA 5FW9A 1UHFA 1AZGB 2HBWA 2W0ZA 4J9FA 2L2PA 3A98A 1GL5A 1PKSA 4IIMA 4M4ZA 2RPNA 1NEGA 2YDLA 4OMPA 5EC7A 1RUWA 2DL3A 2RN8A 1NYFA 4J9GA 2FRWA 3EHRA 5ECAA 3UF4A 2F2WA 1QWFA 2AK5A 2D1XA 3H0HA 2K2MA 1JXMA 1ZUKA 2ED1A 1I07A 1UFFA 2LJ3A 5I11A 3EGUA 5L23A 3GBQA 2KYMA 2AZSA 2DL5A 2ROLA 5IHIA 2A08A 4HXJA 4E6RA 2DL8A 1GBRA 4KRTA 3VRZA 1PRLC 2EYXA 2L0AA 3THKA 3H0IA 3M0PA 1HD3A 2CT3A 1M3BA 3PE0A 2GNCA 3TSWA 3VS3A 3IQLA 1YCSB 1SSHA 3CQTA 1SRMA 4LN2A 2YT6A 2MOXA 4J9DA 1W70A 1JEGA 4LUEA 1KSWA 2FPFA 4RUGA 1X27A 2E5KA 4AG1C 1BB9A 3NGPA 1RI9A 4Z88A 1IO6A 1VYTA 2LQNA 2J05A 2H8HA 4HVVA 1ABQA 1T3LA 4Y92A 1AEYA 1ZUYA 1KJWA 2KXCA 2F2VA 2AKLA 2KE9A 2FRYA 1FYNA 3UATA 2J6KA 2JS0A 2CH4A 2KR3A 2X3WD 3NHNA 2FO0A 2A37A 2DJQA 4CC4B 1S1NA 1ZBJA 2BZYA 1K9AA 1WDXA 3REAB 1BBZA 2VKNA 2J6OA 1T0JA 2F2XA 2J6FA 1I0CA 2O2OA 5FWCA 1GRIA 1UTIA 2VVKA 1WA7A 1HSQA 4ESRA 1QKXA 2CUBA 2KRNA 4F17A 5I22A 5IXFA 5IXBA 4LE9A 2KROA 2EW3A 1SHGA 2PNIA 3VS5A 1JO8A 2O88A 3REBB 1X43A 2B86A 2D8JA 2EPDA 2MIOA 1T3SA 2KGTA 3ZL7C 2DMOA 1MV3A 2DX1A 5FWBA 3EG0A 1SPKA 1WXTA 2DBMA 2EGAA 4CC2A 2NWMA 1G2BA 1AVZC 1X69A 2JMAA 1G83A 2RQUA 1UECA 3M0SA 3VS2A 4CC3A 1PWTA 2EGEA 1UE9A 4JZ3A 1GFDA 3FJ5A 1JU5C 2RMOA 4DEYA 2G6FX 4RTZA 2L3SA 2YUQA 2O31A 2DM1A 3R6NA 2EBPA 2JT4A 4A63B 4GBQA 2DF6A 2FEIA 2SEMA 2VWFA 2QDLA 1JXOA 4X1VA 2J06A 3VS4A 2RQRA 2KT8A 3PVQA 2GTOA 2BZXA 4LUDA 1XOVA 1Z9ZA 2L3QA 2KXDA 1VYVA 1ZLMA 1YWPA 1H8KA 2ABLA 1QWEA 1NG2A 2HSPA 1E7OA 1I1JA 2DRMA 2CSIA 2LX7A 1WLPB 1K0SA 2I0NA 4J9CA 4AG2C 4RTWA 2GQIA 4JZ4A 2LJ1A 4GLMA 1AWJA 2DA9A 3VS6A 2DBKA 1RLPC 2J7IA 3H41A 4JJBA 1KFZA 1ZSGA 3M0QA 2GTJA 4J9EA 2EYYA 3NPFA 4AFUC 4D8KA 2LZ6B 2M0YA 1M8MA 2DE0X 2CREA 1TUDA 1UJYA 3I5SA 1V1CA 2K3BA 2NUZA 2PTKA 4F14A 4QT7A 4J9IA 4F16A 2LCSA 1UDLA 1VA7A 3M0RA 2MCNA 1K4US 1YWOA 1ZX6A 2KT1A 3EG3A 1QKWA 2A36A 2RF0A 3U23A 1UGVA 5GJWB 1K0XA 4IIOA 1UJ0A 1TUCA 2X3XD 2EYWA 2C0IA 1BU1A 1WX6A 3SHWA 3EG2A 2CSQA 2KNBB 3RNJA 4EIKA
chains in the Genus database with same CATH superfamily
1PD0A 3JCMc 1MUZA 3TSZA 3G71A 1BK2A 2ZPBB 3MEUA 3FDRA 4M78E 1UG1A 1CKAA 2KYBA 3TU4K 4TVRA 3CPWA 3BDUA 1VQLT 4XU2A 4AFZC 1W2BA 2DXCA 2ED0A 4M77C 4J9BA 4PLIA 2ZAEA 2RI3A 3WVEB 1X6OA 2PVDB 3OS5A 3VYHB 5IH2A 1WXBA 4KUDK 3JCMd 3HSBA 4M7AE 4B9WA 1OU9A 1LOJA 1GCPA 2EYQA 3LH5A 2DIQA 5LJ3e 1M3CA 3SWNA 4C5GA 1FXXA 2RQWA 1M27C 1OU8A 2CDTA 2A28A 4RKUE 3SWNB 3M0TA 4F7UF 2JXBA 3NTIA 1LNXA 1TSFA 2A0FB 2RB6A 3OYMA 3A8OB 3FC3A 5D7UA 3GF5A 4OB3B 3SEMA 3BFMA 3HRSA 4ZNXA 3T9NA 1W1FA 3OYDA 3OW2A 4XTYA 3CPWP 2QEXT 2X4XA 3O5ZA 2DTOA 4HVUA 2D6FA 5L8RE 2V1RA 4EMHA 3QJ6A 5LJ5g 2DTIA 1M5Q1 2CYZB 3QO3A 4IKFA 2WSCE 2K7AA 1NEBA 1VIEA 4OMMA 1N8RR 3VS1A 2DVJA 2D0QB 2YSQA 5FLXE 3X28B 2QTVA 2DRKA 4JPBW 2EGCA 1KHIA 1G5VA 2D9TA 2LT1A 4A53A 1Y07A 3A8MB 2F1LA 3UWNA 3QUIA 3OS0A 3CD6T 2KY9A 3CCLA 4ELZC 3CCEQ 1I81A 1F1BB 4M78D 1VQPQ 1IRXA 1UHCA 3MEVA 2JM9A 1PHTA 2XK0A 1EFNA 2YLBA 1WHGA 1BI1A 1WHKA 2DPPB 1JQQA 4A4GA 2EKHA 1SEMA 3E9FA 3JCMX 1VQKA 4M7AD 1N8RU 2EQKA 3G4SA 2LX9A 2CZ1B 4FL6A 4RTXA 4JUVA 2XD0A 4Y28E 3OYFA 2C0TA 1CSKA 1IGUA 3UPUA 2FPEA 1VQ8A 2RH2A 1NLPC 3CBPA 5HCKA 2B8AA 2JMCA 5CKBA 2RHZA 1N6AA 1GFCA 3WVDB 3JV3A 1BCOA 3CCVA 1VYUA 3KFVA 3M4YA 5C6SA 2DAQA 1X6GA 4PJOD 4KBMB 2P0KA 5LJ3f 1ZSZC 4BI8B 1GCQA 4JS5A 2CH4W 3L2ZA 5GAN4 3CCSQ 1PKTA 4PKCC 1DJ7B 4J9FA 3A98A 2ZPGB 1VQ9A 4CI0C 1QQJA 1IHVA 1YBYA 4BI3A 3OYLA 4OB1B 4IIMA 2JZ2A 4PFPA 2I2LA 2RPNA 3MPUB 2H3JA 4E7IA 5EC7A 2GFAA 3LW5E 2KMTA 1VQOT 3CCQQ 1MMDA 4NS5A 4XU0A 4ZGDB 2AK5A 2DD5A 2EJ9A 3H0HA 1R0BG 1VQ5Q 2ED1A 1YHQQ 1WHHA 1HYOA 3VKIA 2E6NA 1KQSP 1I07A 3LH0A 3CCRT 1IZ6A 3MHXA 4L5GA 3EGUA 1KK7A 1RAHB 2ZPIB 2HNIA 1KC8C 1LPLA 2A08A 4X9DA 4BB7A 2DL8A 1PRLC 4E7SA 2EYXA 1YIJT 2OTLQ 1VQ6T 1UGQB 2CT3A 3DLMA 4J8OA 3TSWA 1N9SA 1YJNA 4DBFA 1OULA 2F5TX 3V7CA 2Y4XA 4PNOA 1I8FA 2FPFA 3M9QA 3JB9F 1X27A 3CC4Q 3NGPA 1UGSB 1YJWT 1ZA2B 2LQ8A 2QA4Q 3LGLA 1WJSA 2H8HA 3MO8A 4KT0E 1ZUYA 3V7SA 2AKLA 5LJ3j 3L2UA 3G6ET 2J6KA 1BI3A 3PIPA 2K2VA 4PJJA 1EIFA 3ER0A 1YITT 4M78G 1RL2A 2P0PA 3QDFA 3OMCA 3CMAQ 2KAFA 2X3WD 4HCCA 2A37A 4XTWA 1S1NA 1ZBJA 4QQ6A 1BI2A 2EWNA 2PVGB 1TUGB 5KYUA 4OB0B 2RJCA 4X9CA 1S72Q 4ME7A 2F2XA 3CCUT 1NBEB 2O2OA 5KYUB 4RG8A 1UTIA 3OMGA 2VVKA 2EJGA 2E3IA 2CP7A 2KRNA 5IXFA 3CCJQ 4C92E 3JB9J 3PNWC 1X01A 1QVGS 3N5BB 3VS5A 1JO8A 3HPWA 2O88A 2P0QA 1I5LA 5FRNA 4RCBA 1T3SA 1TWBA 1V29B 3CXCS 2BUDA 5FWBA 1YI2A 2BKDN 4ANJA 4CC2A 1D0ZA 2NWMA 3DKMA 1AVZC 5D6YA 3JCMP 1OZ3A 5KYXA 4R56A 2M0OA 2QK0A 3PFSA 4HCZA 4J6WA 5KYXB 2RQUA 2QEXA 3VU3C 2V8IA 3M0SA 3O8VA 4CC3A 4LXCA 4KUIA 1PG5B 1WJRA 5GANe 2RI2A 5LJ3h 4XTXA 1PCXA 4DEYA 2G6FX 2VGNA 3D7SB 2O31A 3FLGA 4JS4A 2KQWA 4A63B 2G3RA 3CC7T 4RMOA 1YJ9T 3RKYA 2JTFA 4F7UG 4KGVB 3S3NA 3P8DA 1RAEB 4E47A 3VUZA 3P8HA 4D6WA 1ZQ1A 2GTOA 1BYMA 3L2WA 1XOVA 3CC2Q 3CD6A 2KXDA 3L42A 1QVFA 1YWPA 4XU1A 2HSPA 8ATCB 3JCMb 4ZGEB 2I0NA 4J9CA 3EFOA 2Y4YA 3QKJA 1D3BA 4EMKC 3G1JA 4PJLA 2CGHA 3EFOB 5LJ3d 2GTJA 3QBYA 5KH6A 4B9XA 5KE2A 3JCMJ 1D3BB 2EYYA 2BE7D 2LZ6B 2M0YA 4GY5A 2CREA 3V8LA 3A5ZB 2LCSA 3X24B 5GAMj 4XTVA 5AT1B 1YWOA 2QI2A 1QKWA 5GAOp 4HT8A 1UGVA 4C92D 2X3XD 1MMNA 1BU1A 4J83A 4XAXB 1NZ9A 4EIKA 3EGXA 1PSEA 2EJFA 2M16A 2RQVA 3LWIA 3QG1A 2K57A 3EGXB 4MMKA 4C8QE 2FL7A 2D8HA 4FYXB 4HCKA 3V8JA 4M78A 1JJ2A 3JCMg 1WNLA 4IUUA 2PUOB 4FT2A 2DZ9A 4M78B 1W6XA 1MMGA 1RACB 1UB4A 1M4ZA 1OYXA 2O9SA 1VQOA 3ULRB 3EG1A 2DERA 2WSFE 2VUBA 1PC0A 2ZCFB 4M7AA 2EFIA 3NMZC 3H6ZA 1M3AA 5FU7C 4PJNA 1PNJA 2W10A 2P4RA 2CP3A 4M7AB 1UGPB 2GGRA 4BY6B 2DKGA 1Y57A 1QP3A 4OGCA 2OJ2A 1U1TA 5GAN5 4BDYA 3TREA 1U3OA 2FZCB 2HEQA 1VQ6A 4GLKA 3QWXX 4M75D 4QW2A 2DVEA 4PJOA 3RDVA 2QGGA 2D0NA 2EVRA 2R5AA 2IVWA 2AZVA 1B7TA 2DL4A 4PJOB 4OMLA 1OOTA 5J3BA 1E6GA 4E7LA 1YJWA 2BZ8A 3M55A 1WYXA 1K8AU 3ZFJA 2KBTA 5IHKA 3CCLQ 4JLGA 3L2QA 3TVTA 4HVWA 3G6EA 1VQ7A 2MPXC 1YITA 1OPKA 2XU8A 4V2SA 2K5FA 5GAN2 2OI3A 4M78F 2M51A 3L1AA 3EHQA 1M2OA 2ZZDA 1EZZB 4RCCA 3CCUA 2C06A 2VV5A 3I35A 1OEBA 2L3PA 1TG0A 5HKCA 1VQ8Q 4M7AF 2YUPA 5CKEA 4WCIA 1RADB 1P92A 2YWWA 1AWOA 4FM4B 2ZGWA 2CUDA 1AWXA 2SRCA 2GF7A 5DLOA 3CCVQ 2JNGA 1IREB 1NJIU 2V8KA 5GANj 1WIEA 4QVZA 5FU6C 4M7DD 2K9GA 3QZ5B 4LDVA 4OVAA 1K76A 2AKKA 1KQ1A 1HXDA 2FVUA 3QDRB 2KRMA 1KIKA 4PJOF 1O9SA 5GJVB 1VOMA 1QVGP 1SRLA 3EH2A 1XTDA 4AMCA 1WI7A 3MEAA 4R0KA 2LCCA 3CXCP 4J9HA 2MWPA 2K3XA 4BE0A 2YUOA 3LYIA 1KG1A 2DJZA 3EFRA 2MWOA 4EMGA 4K11A 2LJ0A 4QVDA 1CKBA 3CC7A 1YJ9A 1QP2A 3PTAA 1LJOA 5CK9A 3RKXA 3SDZA 1AZEA 2X9HA 3CEYA 5KCOA 3CCMA 4OMQA 3CCET 2W0ZA 1GL5A 5CO7A 1VQPT 5D6WA 2KSSA 2E5QA 4PJOE 1BIBA 1H3ZA 2E12A 4N4HA 5KYWA 5CKHA 2RN8A 4JLIA 1NYFA 2CP2A 4J9GA 1WZOA 4NL3A 3EHRA 1VQMA 1QWFA 5KYWB 1YJNQ 1JXMA 2VASA 1ZUKA 4FCYA 1RAIB 2VC8A 2LTOA 5A0GA 1G3WA 1UFFA 4E7KA 2LJ3A 3A8GB 4B6MA 1GXIE 1N27A 2KYMA 3UDCA 3PIOA 2DIGA 3P8BB 5IHIA 2NYSA 4M77D 1G3SA 2L89A 2CZ6B 4N4IA 2QQBA 3VRZA 2JN0A 1TS9A 3H0IA 3OY9A 2KDSA 1HD3A 3C4SA 2OTJA 2GNCA 3VS3A 3IQLA 1YCSB 3M53A 4ZTFA 4IUPA 5CR2A 1VQ4A 1PD1A 3FIFA 1W70A 3GP8A 4RUGA 1ACMB 2E5KA 1Q81R 5CVIA 1RI9A 1MNEA 3CCST 1G3TA 2O4XA 4Y91A 4LDWA 2J05A 4HVVA 4ZTJA 1ABQA 1T3LA 4Y92A 2LQKA 1N8RC 1AEYA 2F2VA 2KE9A 2E1HA 2LRQA 2O4XB 3WXMB 2DZCA 3MP6A 5GANd 4C8QG 3CCQT 2KR3A 3NHNA 1KD1R 2J6OA 1YHQT 1C0MA 1MMAA 1YI2Q 1Q81C 4N0AC 1I0CA 1KQSA 1XNIA 1OZ2A 1I5OB 1QKXA 3A8LB 4F17A 5IXBA 4LE9A 2E70A 4MZMA 2EW3A 1SHGA 2COZA 4OF1A 2OTLT 1Q81U 1KD1C 2HL3A 4C92A 3S6WA 3I56A 4L59A 2RK1A 1EX4A 3OS1A 2VYTA 4LDYA 3URGA 1ZBXA 4E2FB 2DX1A 4C92B 5GAMe 2QYZA 1SPKA 2EGAA 3CC4T 3HRUA 4NOYA 1KD1U 1G83A 3LGFA 2NUPA 2QA4T 4A4EA 1MHNA 3EAEA 1TOVA 3VS2A 2NUPB 1D0XA 4LDXA 2F5KA 3CMAT 3GPLA 1JU5C 1LVKA 4RTZA 2L3SA 3R6NA 4YTLA 4OMFB 4FW2A 2QDYB 1RAAB 2SEMA 2VWFA 1S72T 2JVVA 2YRDA 4E7ZA 4BD3A 3PVQA 2PVOB 2WSEE 3QIIA 5GAOl 2ATCB 3RR6A 3SWNC 3JAME 3CCJT 2K5IA 4C0DB 3DLLA 1Z9ZA 1H641 2E65A 1VYVA 5GAOq 3JSCA 4J5YA 1WHJA 1E7OA 1XJWB 2CKKA 1WLPB 5LJ3g 3HFNA 3JRZA 4AG2C 3OYKA 4M75B 2HQEA 4JZ4A 4RG2A 4BI4A 3BDLA 2DA9A 4MDWA 2HSEB 3VS6A 1RLPC 2J7IA 2R5MA 1KFZA 4C92F 4OGEA 4E7HA 3I5SA 1TUDA 2K5LA 2P84A 1VQLA 4F14A 4ZN1A 2Y90A 2EQJA 3OYIA 3MCAB 3M0RA 3EG3A 2A36A 1UGRB 5DY9A 3J80E 3OYEA 5GJWB 1RI0A 4OB2B 4IIOA 1UJ0A 5CQXA 2EYWA 4KGZB 1Q82R 1PSFA 1KQ2A 3M59A 1K73U 1NPRA 2HMAA 4M7AG 4C0ZA 4JJNK 1YP5A 4KULA 1U06A 4C0FA 2XKOC 4JRPA 2HAXA 3CC2T 2KRSA 1X75C 4C8QA 2QQ9A 3CCEA 4DEXA 1WFWA 4C8QB 4MMLA 1A0NB 4JJDA 1B07A 1T0HA 3TEEA 4HA8A 1VQNQ 2NUTA 4FYVB 5GAMf 2COWA 1OV3A 3HTRA 2X35A 3M0UA 4PJOG 1ARKA 5IAYA 2NUTB 3C94A 2MYSA 3E9GA 4FYYB 2AHJB 1ZA1B 3HKSA 4M75F 1D09B 2OAWA 1Q82U 1QCFA 3BW1A 2XI9A 2K6DA 5AYFA 3ZBDA 2LT4A 3I55Q 1J3TA 2RHUA 1B3QA 5CCAA 4FYWB 2LC4A 1HJDA 1FMKA 2IG0A 4UC4A 1VQ7Q 2WACA 3KBGA 4DQ2A 4FT4A 3RERA 5I2MA 3QXEB 3Q1JA 3CCSA 4M75E 3CPWS 1GCQC 4IUVA 2GBQA 3DB3A 1W2BS 2JW4A 5A0DA 2KEAA 1VUBA 2LQWA 1C6VX 1OPLA 5A2QE 4FSXA 1UEBA 2JS2A 5GAMg 3CMEQ 3CCQA 2V26A 1O75A 1ZHIA 1UUEA 4Z8AA 2M9UA 1LCKA 4C8QF 1JRIA 4RTUA 3G71Q 2DLPA 5I2SA 2E6ZA 3C0CA 1M1KR 1BCMA 2RK2A 3KXTA 2E4HA 3OYCA 1Q95G 1RLQC 2NLUA 2CT4A 2RHYA 3QZ9B 5IHNA 4Z89A 2V1QA 2DNUA 4M7DF 3SD4A 2EYZA 2JTMA 5GMKj 4QQGA 2OTLA 2DO3A 2DETA 1VIFA 1U5SA 2DL7A 3V7RA 2XICA 1ABOA 3MJXA 1U1SA 7AT1B 2MK5A 2QQSA 3M56A 1D1BA 3HHTB 3OW2S 2ROTA 4WTOB 4FSSA 2HZYA 2EQMA 3VRYA 2FG0A 3EG9A 3FB9A 2VXEA 2P4TA 1X2KA 5J26A 4IUQA 4P5NA 1AOJA 2PZ1A 3KUFA 3EG9B 1QLYA 3CCMQ 4OP0A 5GAN3 2QGFB 1H3HA 1V76A 1QCOA 1M1KU 4CC7A 4M7DE 5LL6S 4DBHA 2FZKB 2EQIA 3CMAA 5LJ5e 2LDMA 3BE3A 1K8AR 1GBQA 1IB8A 3EFSA 3RBBB 1D1AA 1VQMQ 2O9VA 4WF2A 2Z0WA 1Q86R 1Y7XA 2X51A 3E1SA 3CCRA 2ESWA 1S72A 4DOVA 1WHMA 5J39A 1RAFB 1IHWA 2F69A 5FW9A 1UHFA 1AZGB 2HBWA 2LVMA 5GAMh 2L2PA 5GANf 2QASA 2DXBA 1AHJB 1RABB 3F70A 3META 1PKSA 5IN1A 1YIJA 1VQ8T 3CCJA 4M4ZA 1NEGA 2YDLA 1RUWA 1K8AC 2DL3A 5GAOr 2FRWA 5ECAA 3CCVT 2OTJQ 4M77F 2LCLA 2BE9B 2CS7A 2K2MA 2EKOA 1Q86C 1VQ4Q 1I4K1 3RMSA 2E64A 3G7ZA 2AZSA 4ATOA 2DL5A 1NJIR 2ROLA 3FEOA 2GQVA 4HXJA 2K3YA 4E6RA 1Q86U 3M58A 1K9MR 4KRTA 3THKA 2L0AA 2EQUA 1QVGA 1WQWA 1M3BA 3PE0A 5IT9E 3CQTA 1WQ7A 3CXCA 2YT6A 2DXUA 1IGQA 2E3HA 5GAMd 2MOXA 3OYNA 4M77E 1VQKQ 2CZ0B 1JEGA 2ZPFB 1KSWA 2CP6A 3OS2A 3G4SQ 4XTUA 2QAZA 1BB9A 2QTXA 1NJIC 5GANg 1VYTA 4J6YA 4JDSA 1QMCA 1K9MC 2LQNA 1KJWA 1R8OB 3CC2A 1FYNA 3UATA 4C92G 2AIRB 2CH4A 2BIVA 2XG8D 3OYJA 5A0LA 4CC4B 3I56Q 1YJNT 1K9AA 2RJEA 3FJPA 1K9MU 1BBZA 1ZSZA 2VGMA 2VKNA 2RHXA 1FWZA 3FRNA 4EPCA 1ZSZB 2J6FA 5FWCA 3X26B 3A8HB 1OI1A 1HSQA 4ESRA 4LD6A 2XDDA 1VQ9Q 2CUBA 4C5HA 5I22A 2M02A 2KROA 2YRVA 3V8KA 2PNIA 2OX7A 4JRIA 4J7FA 1SG5A 3REBB 2B86A 2MIOA 2DEQA 2RO0A 2HQXA 2KGTA 5LJ5f 3ZL7C 1MV3A 2GFUA 3EG0A 2FYKA 1WXTA 3OBYA 2L3RA 2RJDA 4Z02A 4PFOA 1FMVA 4PK4A 3ME9A 5DLQE 5I21A 1NPPA 3RKWA 4HKEA 4FU6A 4A4HA 1UECA 4Q5WA 2DEUA 3JB9H 2EGEA 1UE9A 4MDXA 4JZ3A 2RD1A 1GFDA 2LNVA 3FJ5A 4M78C 2MI6A 4HCBA 2RMOA 4M75G 2DM1A 4FIBA 1OX9A 3H9NA 5GANh 5GAN7 2YLCA 1YI2T 4DOWA 1G8XA 1R0CB 2QDLA 3PGGA 2FB7A 1JXOA 5GAN6 2J06A 3VS4A 2RQRA 2KT8A 3LWHA 4VUBA 3JCMQ 4M7AC 4BY6C 2QXFA 5GMKl 1B34A 2L3QA 1D0YA 1W2BP 1IXDA 1VQLQ 2DTHA 1H8KA 1XQHA 1B34B 1QWEA 1Y96A 1WJQA 3NTKA 2CSIA 5GAOm 4F7UE 1Y96B 3J81E 4MZPA 1Y71A 4RTWA 1AWJA 3C12A 2DBKA 3OYYA 4E7JA 4A4FA 1ZSGA 1RAGB 3M0QA 5LJ5j 4PJOC 4J9EA 1BIAA 2MF2A 2HL5C 4AFUC 2A3LA 2DE0X 2NUZA 2PTKA 1SF9A 2M1HA 4F16A 4J9IA 2ZPHB 3GOXA 1U8RA 1TH7A 4BDZA 1UDLA 1VA7A 2MCNA 2L5QA 2KT1A 1OX8A 2RF0A 3NTHA 3UT1A 4BACA 1VQ5T 1TUCA 2C0IA 4DBQA 3SHWA 3OW2P 2KNBB 1FMWA 4M7DG 3QJYA 1M8VA 1PM3A 3RUXA 3QYHB 4KH1B 1H92A 1YFNA 4IUTA 2ECZA 2QEXQ 4PFZA 4LD9K 2JM8A 4XU3A 1QVFS 4HT9A 2IIMA 4LNPA 4C5EA 3M4GA 1M30A 4ORZA 2VXFA 1YNZA 1OQKA 2DILA 3NFCA 4RTTA 3OYHA 3MKDA 3PMTA 4NL2A 5GMKe 3UA6A 3CPFA 3VS0A 2ENMA 2R57A 1PRMC 1WHLA 5LJ5h 1BI0A 4RTYA 3EH1A 3CD6Q 3I9QA 4QVCA 4MZTA 5KYNA 4F04B 2RNAA 1M9SA 1R77A 4OMNA 4RTVA 5GAN8 2HDAA 3OSVA 4AT1B 1KC8R 5FROA 2LMJA 1YN8A 2YRCA 1ZUUA 2XDBA 2FPDA 5KYYA 4EMKA 1Y0MA 2HCKA 2VB6A 4PJMA 3RMQA 4A54A 3QSUA 1JB0E 5KYYB 4EMKB 1SHFA 1X2QA 4JRQA 4J6XA 1QCNA 1NM7A 4AFSC 4C5IA 3OSSC 2RQTA 1AWWA 4M77G 2COYA 1K73R 1JJ2S 4OMOA 3VS7A 2X4JA 1FX7A 1WPYA 4M75A 5HK0A 3VJPA 1M90R 5GMKi 2JOYA 4O6JA 3QPHA 1K1ZA 1VQNT 3JCMe 5LJ5d 1MV0B 4PL6A 3H0FA 1KC8U 3GNFB 2X4YA 1NLOC 5D6XA 3VUBA 1K73C 1X6BA 3RESA 4ELYC 3QWYA 4D8DA 3J7AF 3I55T 4JJCA 5EG2A 2YUNA 4CRIA 1M90C 3PVLA 1AT1B 4KH0B 3L2RA 2RM4A 1VQOQ 1VQ7T 2DYIA 3C95A 3HRTA 4J7IA 3SB2A 1NYGA 2LNHB 3UA7A 2JJ9A 2KVQG 4ZN3A 1M90U 2JTEA 2RJFA 3I5RA 5FU7B 1WGSA 3CCRQ 2C0OA 2XMFA 3QHSA 1AD5A 1VQPA 2HBPA 4AFQC 1Q82C 1M1GA 1E6HA 2LP5A 1YIJQ 4L6V5 4X34A 1VQ6Q 3CMET 2DYBA 4M7DA 2BTTA 3OQ5A 3CBOA 1WXUA 1Z9QA 5GAOn 2PQWA 3G71T 4M7DB 2PU9B 2KI7A 2DD4A 2K79A 3HL8A 3LLRA 3JCMV 3S3OA 3M5AA 1YJWQ 1MNDA 1W4SA 2RI5A 4EDUA 1N5ZA 4O5VA 5CIUA 3TQ7P 2DXTA 2EIFA 3R6OA 3PT9A 2IPOB 3G6EQ 4OMPA 1YITQ 2HD0A 5CKDA 3UF4A 2F2WA 2YHTA 4PLLA 2D1XA 4C0GA 4C92C 3X20B 3HP9A 3SFMA 5I11A 4XQ3A 3CCUQ 3MP1A 5L23A 3GBQA 2QQAA 4KGXB 2OAUA 2FHDA 2E10A 3CCMT 1GBRA 4II1A 3OB9A 2AT1B 2R58A 3M0PA 4IURA 3MEWA 3JB9I 4BE2A 1TU0B 3CBMA 4QQDA 1QVPA 1SSHA 1SSFA 1SRMA 3VV0A 3X25B 3JCMf 4LN2A 1VQ5A 3INZA 1YHQA 1VQMT 6AT1B 4J9DA 3GIBA 4LUEA 3L2VA 5FU6B 4XTZA 4AG1C 2CZ7B 4M77A 3M57A 2V8JA 4XK8E 4Z88A 1IO6A 2CP5A 4ZGJB 1SKUB 4M77B 2PUKB 4C0DC 2KXCA 3QYGB 1QW1A 2FRYA 2A7YA 2JS0A 3JB9D 5CAIA 3DB4A 2O01E 4JRKA 2HQHA 2FO0A 2DJQA 2OTJT 1M1KC 2BZYA 1WDXA 3REAB 3CC4A 4M75C 1VQ4T 3CC7Q 1YJ9Q 2H3EB 2XIDA 2XHCA 1T0JA 1GRIA 3CCLT 2QA4A 1WA7A 3ASKA 2MMPA 1QVFP 3BY7A 2L8DA 4DA4A 2DFUA 5CKFA 2JUFA 3JCMW 1X43A 2EPDA 2D8JA 5HK3A 1KHCA 2QG9B 2YXYA 2DMOA 1Q7YR 1TXQA 1VQKT 2DBMA 1D1CA 1G2BA 2EAYA 3G4ST 3OYBA 3A1PA 1BKBA 1X69A 2QQRA 3TCJA 2JMAA 2CP0A 4QKUA 2XDPA 1MGQA 3MP8A 3E2UA 2ZPEB 3OA6A 3EGDA 5GMKh 3ZEHA 1PWTA 2HKQB 2X4WA 3S3MA 3VYGA 3OYAA 4C8QC 5KCHA 4DBRA 5CQYA 3EGDB 1Q7YC 2RHIA 3I56T 2YUQA 1M2VA 8AT1B 1HK9A 2EBPA 2JT4A 4LDUA 4GBQA 1VQNA 2DF6A 5M9OA 1M2VB 2FEIA 3PMIA 2FZGB 2KK4A 2E41A 4X1VA 1KQSS 4BE1A 5FRMA 2GCXA 4FW1A 4BUGA 5KE3A 4M7DC 1Q7YU 1VQ9T 2BZXA 3M54A 1JJ2P 3GNGA 4LUDA 1ZLMA 2K4YA 3OYGA 3I55A 3LX7A 2ABLA 1NE8A 1YCYA 1NG2A 9ATCB 3AT1B 1I1JA 2DRMA 4N4GA 2LX7A 1K0SA 1N9RA 4N0AA 5GMKm 2GQIA 3GLXA 2LJ1A 4GLMA 4F7UA 3H41A 4JJBA 1JBMA 4A4KA 4R55A 3RIRA 1C1AA 3NPFA 4D8KA 3OBWA 4F7UB 1M8MA 3JCMh 3HFOA 1UJYA 1M1FA 1V1CA 2K3BA 4QT7A 5DM7R 1TTHB 1K4US 1ZX6A 3E19A 3U23A 1G3YA 3H8ZA 2MAMA 4C8QD 1K0XA 3JB9G 2DK3A 2HKNA 3CMEA 1WX6A 3EG2A 5C0MA 2CSQA 2RA2A 3RNJA 3AHUA 5HY6A
chains in the Genus database with same CATH topology
1MUZA 3TSZA 1BK2A 2RQVA 1H92A 1UG1A 1YP5A 2ECZA 1CKAA 1U06A 2D8HA 2JM8A 2KYBA 4HCKA 2KRSA 4AFZC 2ED0A 2IIMA 4LNPA 4DEXA 1WFWA 1M30A 1W6XA 4J9BA 4ORZA 1YNZA 1A0NB 2DILA 4JJDA 1B07A 1T0HA 4RTTA 2O9SA 3ULRB 5IH2A 1WXBA 3EG1A 1OV3A 3M0UA 1ARKA 1GCPA 3LH5A 3UA6A 3NMZC 1M3AA 1M3CA 3VS0A 1PNJA 2W10A 2ENMA 2P4RA 1PRMC 1M27C 2RQWA 2OAWA 2CDTA 1QCFA 2GGRA 4RTYA 2A28A 3I9QA 2K6DA 1Y57A 2OJ2A 1J3TA 3M0TA 2RNAA 1B3QA 4RTVA 4OMNA 2JXBA 2HDAA 2LMJA 1YN8A 1U3OA 1HJDA 2HEQA 1FMKA 1ZUUA 2FPDA 3QWXX 3SEMA 1Y0MA 2HCKA 4ZNXA 1W1FA 2D0NA 2EVRA 1SHFA 2AZVA 1X2QA 2DL4A 4OMLA 1OOTA 1E6GA 1NM7A 4AFSC 1AWWA 2RQTA 3O5ZA 4HVUA 2V1RA 2BZ8A 4OMOA 1GCQC 1WYXA 3VS7A 2GBQA 2KBTA 5IHKA 2JW4A 2KEAA 2LQWA 3TVTA 1OPLA 2K7AA 4HVWA 1NEBA 2JS2A 4OMMA 3VS1A 1OPKA 1K1ZA 2DVJA 2YSQA 1UUEA 4Z8AA 1MV0B 2DRKA 1LCKA 2OI3A 4JPBW 2EGCA 2M51A 3H0FA 4RTUA 2DLPA 3EHQA 1NLOC 3C0CA 1X6BA 3QWYA 4D8DA 1RLQC 3I35A 2CT4A 1OEBA 4JJCA 2YUNA 5IHNA 2L3PA 4Z89A 2V1QA 1TG0A 2DNUA 3PVLA 2YUPA 4WCIA 2EYZA 1UHCA 2JM9A 1PHTA 1EFNA 1U5SA 1AWOA 1JQQA 2DL7A 1ABOA 2EKHA 2CUDA 1AWXA 2SRCA 1SEMA 1NYGA 2LNHB 3UA7A 1WIEA 2ROTA 4FSSA 2JTEA 3I5RA 2K9GA 3VRYA 2FG0A 2C0OA 1K76A 4RTXA 2AKKA 1X2KA 2XMFA 1AOJA 2PZ1A 1AD5A 2C0TA 1CSKA 2FPEA 2KRMA 5HCKA 1NLPC 1QLYA 4AFQC 2JMCA 1KIKA 5GJVB 1H3HA 1SRLA 1E6HA 1GFCA 2LP5A 4CC7A 1WI7A 3JV3A 2EQIA 4R0KA 1VYUA 4J9HA 1GBQA 2DYBA 3KFVA 3RBBB 2BTTA 2YUOA 1WXUA 2O9VA 1Z9QA 1X6GA 4K11A 2LJ0A 1CKBA 2ESWA 2K79A 1GCQA 1AZEA 2CH4W 1PKTA 1N5ZA 4OMQA 5FW9A 1UHFA 1AZGB 2HBWA 2W0ZA 4J9FA 2L2PA 3A98A 1GL5A 1PKSA 4IIMA 4M4ZA 2RPNA 1NEGA 2YDLA 4OMPA 5EC7A 1RUWA 2DL3A 2RN8A 1NYFA 4J9GA 2FRWA 3EHRA 5ECAA 3UF4A 2F2WA 1QWFA 2AK5A 2D1XA 3H0HA 2K2MA 1JXMA 1ZUKA 2ED1A 1I07A 1UFFA 2LJ3A 5I11A 3EGUA 5L23A 3GBQA 2KYMA 2AZSA 2DL5A 2ROLA 5IHIA 2A08A 4HXJA 4E6RA 2DL8A 1GBRA 4KRTA 3VRZA 1PRLC 2EYXA 2L0AA 3THKA 3H0IA 3M0PA 1HD3A 2CT3A 1M3BA 3PE0A 2GNCA 3TSWA 3VS3A 3IQLA 1YCSB 1SSHA 3CQTA 1SRMA 4LN2A 2YT6A 2MOXA 4J9DA 1W70A 1JEGA 4LUEA 1KSWA 2FPFA 4RUGA 1X27A 2E5KA 4AG1C 1BB9A 3NGPA 1RI9A 4Z88A 1IO6A 1VYTA 2LQNA 2J05A 2H8HA 4HVVA 1ABQA 1T3LA 4Y92A 1AEYA 1ZUYA 1KJWA 2KXCA 2F2VA 2AKLA 2KE9A 2FRYA 1FYNA 3UATA 2J6KA 2JS0A 2CH4A 2KR3A 2X3WD 3NHNA 2FO0A 2A37A 2DJQA 4CC4B 1S1NA 1ZBJA 2BZYA 1K9AA 1WDXA 3REAB 1BBZA 2VKNA 2J6OA 1T0JA 2F2XA 2J6FA 1I0CA 2O2OA 5FWCA 1GRIA 1UTIA 2VVKA 1WA7A 1HSQA 4ESRA 1QKXA 2CUBA 2KRNA 4F17A 5I22A 5IXFA 5IXBA 4LE9A 2KROA 2EW3A 1SHGA 2PNIA 3VS5A 1JO8A 2O88A 3REBB 1X43A 2B86A 2D8JA 2EPDA 2MIOA 1T3SA 2KGTA 3ZL7C 2DMOA 1MV3A 2DX1A 5FWBA 3EG0A 1SPKA 1WXTA 2DBMA 2EGAA 4CC2A 2NWMA 1G2BA 1AVZC 1X69A 2JMAA 1G83A 2RQUA 1UECA 3M0SA 3VS2A 4CC3A 1PWTA 2EGEA 1UE9A 4JZ3A 1GFDA 3FJ5A 1JU5C 2RMOA 4DEYA 2G6FX 4RTZA 2L3SA 2YUQA 2O31A 2DM1A 3R6NA 2EBPA 2JT4A 4A63B 4GBQA 2DF6A 2FEIA 2SEMA 2VWFA 2QDLA 1JXOA 4X1VA 2J06A 3VS4A 2RQRA 2KT8A 3PVQA 2GTOA 2BZXA 4LUDA 1XOVA 1Z9ZA 2L3QA 2KXDA 1VYVA 1ZLMA 1YWPA 1H8KA 2ABLA 1QWEA 1NG2A 2HSPA 1E7OA 1I1JA 2DRMA 2CSIA 2LX7A 1WLPB 1K0SA 2I0NA 4J9CA 4AG2C 4RTWA 2GQIA 4JZ4A 2LJ1A 4GLMA 1AWJA 2DA9A 3VS6A 2DBKA 1RLPC 2J7IA 3H41A 4JJBA 1KFZA 1ZSGA 3M0QA 2GTJA 4J9EA 2EYYA 3NPFA 4AFUC 4D8KA 2LZ6B 2M0YA 1M8MA 2DE0X 2CREA 1TUDA 1UJYA 3I5SA 1V1CA 2K3BA 2NUZA 2PTKA 4F14A 4QT7A 4J9IA 4F16A 2LCSA 1UDLA 1VA7A 3M0RA 2MCNA 1K4US 1YWOA 1ZX6A 2KT1A 3EG3A 1QKWA 2A36A 2RF0A 3U23A 1UGVA 5GJWB 1K0XA 4IIOA 1UJ0A 1TUCA 2X3XD 2EYWA 2C0IA 1BU1A 1WX6A 3SHWA 3EG2A 2CSQA 2KNBB 3RNJA 4EIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUZ A;  3TSZ A;  1BK2 A;  2RQV A;  1H92 A;  1UG1 A;  1YP5 A;  2ECZ A;  1CKA A;  1U06 A;  2D8H A;  2JM8 A;  2KYB A;  4HCK A;  2KRS A;  4AFZ C;  2ED0 A;  2IIM A;  4LNP A;  4DEX A;  1WFW A;  1M30 A;  1W6X A;  4J9B A;  4ORZ A;  1YNZ A;  1A0N B;  2DIL A;  4JJD A;  1B07 A;  1T0H A;  4RTT A;  2O9S A;  3ULR B;  5IH2 A;  1WXB A;  3EG1 A;  1OV3 A;  3M0U A;  1ARK A;  1GCP A;  3LH5 A;  3UA6 A;  3NMZ C;  1M3A A;  1M3C A;  3VS0 A;  1PNJ A;  2W10 A;  2ENM A;  2P4R A;  1PRM C;  1M27 C;  2RQW A;  2OAW A;  2CDT A;  1QCF A;  2GGR A;  4RTY A;  2A28 A;  3I9Q A;  2K6D A;  1Y57 A;  2OJ2 A;  1J3T A;  3M0T A;  2RNA A;  1B3Q A;  4RTV A;  4OMN A;  2JXB A;  2HDA A;  2LMJ A;  1YN8 A;  1U3O A;  1HJD A;  2HEQ A;  1FMK A;  1ZUU A;  2FPD A;  3QWX X;  3SEM A;  1Y0M A;  2HCK A;  4ZNX A;  1W1F A;  2D0N A;  2EVR A;  1SHF A;  2AZV A;  1X2Q A;  2DL4 A;  4OML A;  1OOT A;  1E6G A;  1NM7 A;  4AFS C;  1AWW A;  2RQT A;  3O5Z A;  4HVU A;  2V1R A;  2BZ8 A;  4OMO A;  1GCQ C;  1WYX A;  3VS7 A;  2GBQ A;  2KBT A;  5IHK A;  2JW4 A;  2KEA A;  2LQW A;  3TVT A;  1OPL A;  2K7A A;  4HVW A;  1NEB A;  2JS2 A;  4OMM A;  3VS1 A;  1OPK A;  1K1Z A;  2DVJ A;  2YSQ A;  1UUE A;  4Z8A A;  1MV0 B;  2DRK A;  1LCK A;  2OI3 A;  4JPB W;  2EGC A;  2M51 A;  3H0F A;  4RTU A;  2DLP A;  3EHQ A;  1NLO C;  3C0C A;  1X6B A;  3QWY A;  4D8D A;  1RLQ C;  3I35 A;  2CT4 A;  1OEB A;  4JJC A;  2YUN A;  5IHN A;  2L3P A;  4Z89 A;  2V1Q A;  1TG0 A;  2DNU A;  3PVL A;  2YUP A;  4WCI A;  2EYZ A;  1UHC A;  2JM9 A;  1PHT A;  1EFN A;  1U5S A;  1AWO A;  1JQQ A;  2DL7 A;  1ABO A;  2EKH A;  2CUD A;  1AWX A;  2SRC A;  1SEM A;  1NYG A;  2LNH B;  3UA7 A;  1WIE A;  2ROT A;  4FSS A;  2JTE A;  3I5R A;  2K9G A;  3VRY A;  2FG0 A;  2C0O A;  1K76 A;  4RTX A;  2AKK A;  1X2K A;  2XMF A;  1AOJ A;  2PZ1 A;  1AD5 A;  2C0T A;  1CSK A;  2FPE A;  2KRM A;  5HCK A;  1NLP C;  1QLY A;  4AFQ C;  2JMC A;  1KIK A;  5GJV B;  1H3H A;  1SRL A;  1E6H A;  1GFC A;  2LP5 A;  4CC7 A;  1WI7 A;  3JV3 A;  2EQI A;  4R0K A;  1VYU A;  4J9H A;  1GBQ A;  2DYB A;  3KFV A;  3RBB B;  2BTT A;  2YUO A;  1WXU A;  2O9V A;  1Z9Q A;  1X6G A;  4K11 A;  2LJ0 A;  1CKB A;  2ESW A;  2K79 A;  1GCQ A;  1AZE A;  2CH4 W;  1PKT A;  1N5Z A;  4OMQ A;  5FW9 A;  1UHF A;  1AZG B;  2HBW A;  2W0Z A;  4J9F A;  2L2P A;  3A98 A;  1GL5 A;  1PKS A;  4IIM A;  4M4Z A;  2RPN A;  1NEG A;  2YDL A;  4OMP A;  5EC7 A;  1RUW A;  2DL3 A;  2RN8 A;  1NYF A;  4J9G A;  2FRW A;  3EHR A;  5ECA A;  3UF4 A;  2F2W A;  1QWF A;  2AK5 A;  2D1X A;  3H0H A;  2K2M A;  1JXM A;  1ZUK A;  2ED1 A;  1I07 A;  1UFF A;  2LJ3 A;  5I11 A;  3EGU A;  5L23 A;  3GBQ A;  2KYM A;  2AZS A;  2DL5 A;  2ROL A;  5IHI A;  2A08 A;  4HXJ A;  4E6R A;  2DL8 A;  1GBR A;  4KRT A;  3VRZ A;  1PRL C;  2EYX A;  2L0A A;  3THK A;  3H0I A;  3M0P A;  1HD3 A;  2CT3 A;  1M3B A;  3PE0 A;  2GNC A;  3TSW A;  3VS3 A;  3IQL A;  1YCS B;  1SSH A;  3CQT A;  1SRM A;  4LN2 A;  2YT6 A;  2MOX A;  4J9D A;  1W70 A;  1JEG A;  4LUE A;  1KSW A;  2FPF A;  4RUG A;  1X27 A;  2E5K A;  4AG1 C;  1BB9 A;  3NGP A;  1RI9 A;  4Z88 A;  1IO6 A;  1VYT A;  2LQN A;  2J05 A;  2H8H A;  4HVV A;  1ABQ A;  1T3L A;  4Y92 A;  1AEY A;  1ZUY A;  1KJW A;  2KXC A;  2F2V A;  2AKL A;  2KE9 A;  2FRY A;  1FYN A;  3UAT A;  2J6K A;  2JS0 A;  2CH4 A;  2KR3 A;  2X3W D;  3NHN A;  2FO0 A;  2A37 A;  2DJQ A;  4CC4 B;  1S1N A;  1ZBJ A;  2BZY A;  1K9A A;  1WDX A;  3REA B;  1BBZ A;  2VKN A;  2J6O A;  1T0J A;  2F2X A;  2J6F A;  1I0C A;  2O2O A;  5FWC A;  1GRI A;  1UTI A;  2VVK A;  1WA7 A;  1HSQ A;  4ESR A;  1QKX A;  2CUB A;  2KRN A;  4F17 A;  5I22 A;  5IXF A;  5IXB A;  4LE9 A;  2KRO A;  2EW3 A;  1SHG A;  2PNI A;  3VS5 A;  1JO8 A;  2O88 A;  3REB B;  1X43 A;  2B86 A;  2D8J A;  2EPD A;  2MIO A;  1T3S A;  2KGT A;  3ZL7 C;  2DMO A;  1MV3 A;  2DX1 A;  5FWB A;  3EG0 A;  1SPK A;  1WXT A;  2DBM A;  2EGA A;  4CC2 A;  2NWM A;  1G2B A;  1AVZ C;  1X69 A;  2JMA A;  1G83 A;  2RQU A;  1UEC A;  3M0S A;  3VS2 A;  4CC3 A;  1PWT A;  2EGE A;  1UE9 A;  4JZ3 A;  1GFD A;  3FJ5 A;  1JU5 C;  2RMO A;  4DEY A;  2G6F X;  4RTZ A;  2L3S A;  2YUQ A;  2O31 A;  2DM1 A;  3R6N A;  2EBP A;  2JT4 A;  4A63 B;  4GBQ A;  2DF6 A;  2FEI A;  2SEM A;  2VWF A;  2QDL A;  1JXO A;  4X1V A;  2J06 A;  3VS4 A;  2RQR A;  2KT8 A;  3PVQ A;  2GTO A;  2BZX A;  4LUD A;  1XOV A;  1Z9Z A;  2L3Q A;  2KXD A;  1VYV A;  1ZLM A;  1YWP A;  1H8K A;  2ABL A;  1QWE A;  1NG2 A;  2HSP A;  1E7O A;  1I1J A;  2DRM A;  2CSI A;  2LX7 A;  1WLP B;  1K0S A;  2I0N A;  4J9C A;  4AG2 C;  4RTW A;  2GQI A;  4JZ4 A;  2LJ1 A;  4GLM A;  1AWJ A;  2DA9 A;  3VS6 A;  2DBK A;  1RLP C;  2J7I A;  3H41 A;  4JJB A;  1KFZ A;  1ZSG A;  3M0Q A;  2GTJ A;  4J9E A;  2EYY A;  3NPF A;  4AFU C;  4D8K A;  2LZ6 B;  2M0Y A;  1M8M A;  2DE0 X;  2CRE A;  1TUD A;  1UJY A;  3I5S A;  1V1C A;  2K3B A;  2NUZ A;  2PTK A;  4F14 A;  4QT7 A;  4J9I A;  4F16 A;  2LCS A;  1UDL A;  1VA7 A;  3M0R A;  2MCN A;  1K4U S;  1YWO A;  1ZX6 A;  2KT1 A;  3EG3 A;  1QKW A;  2A36 A;  2RF0 A;  3U23 A;  1UGV A;  5GJW B;  1K0X A;  4IIO A;  1UJ0 A;  1TUC A;  2X3X D;  2EYW A;  2C0I A;  1BU1 A;  1WX6 A;  3SHW A;  3EG2 A;  2CSQ A;  2KNB B;  3RNJ A;  4EIK A; 
#chains in the Genus database with same CATH topology
 1PD0 A;  3JCM c;  1MUZ A;  3TSZ A;  3G71 A;  1BK2 A;  2ZPB B;  3MEU A;  3FDR A;  4M78 E;  1UG1 A;  1CKA A;  2KYB A;  3TU4 K;  4TVR A;  3CPW A;  3BDU A;  1VQL T;  4XU2 A;  4AFZ C;  1W2B A;  2DXC A;  2ED0 A;  4M77 C;  4J9B A;  4PLI A;  2ZAE A;  2RI3 A;  3WVE B;  1X6O A;  2PVD B;  3OS5 A;  3VYH B;  5IH2 A;  1WXB A;  4KUD K;  3JCM d;  3HSB A;  4M7A E;  4B9W A;  1OU9 A;  1LOJ A;  1GCP A;  2EYQ A;  3LH5 A;  2DIQ A;  5LJ3 e;  1M3C A;  3SWN A;  4C5G A;  1FXX A;  2RQW A;  1M27 C;  1OU8 A;  2CDT A;  2A28 A;  4RKU E;  3SWN B;  3M0T A;  4F7U F;  2JXB A;  3NTI A;  1LNX A;  1TSF A;  2A0F B;  2RB6 A;  3OYM A;  3A8O B;  3FC3 A;  5D7U A;  3GF5 A;  4OB3 B;  3SEM A;  3BFM A;  3HRS A;  4ZNX A;  3T9N A;  1W1F A;  3OYD A;  3OW2 A;  4XTY A;  3CPW P;  2QEX T;  2X4X A;  3O5Z A;  2DTO A;  4HVU A;  2D6F A;  5L8R E;  2V1R A;  4EMH A;  3QJ6 A;  5LJ5 g;  2DTI A;  1M5Q 1;  2CYZ B;  3QO3 A;  4IKF A;  2WSC E;  2K7A A;  1NEB A;  1VIE A;  4OMM A;  1N8R R;  3VS1 A;  2DVJ A;  2D0Q B;  2YSQ A;  5FLX E;  3X28 B;  2QTV A;  2DRK A;  4JPB W;  2EGC A;  1KHI A;  1G5V A;  2D9T A;  2LT1 A;  4A53 A;  1Y07 A;  3A8M B;  2F1L A;  3UWN A;  3QUI A;  3OS0 A;  3CD6 T;  2KY9 A;  3CCL A;  4ELZ C;  3CCE Q;  1I81 A;  1F1B B;  4M78 D;  1VQP Q;  1IRX A;  1UHC A;  3MEV A;  2JM9 A;  1PHT A;  2XK0 A;  1EFN A;  2YLB A;  1WHG A;  1BI1 A;  1WHK A;  2DPP B;  1JQQ A;  4A4G A;  2EKH A;  1SEM A;  3E9F A;  3JCM X;  1VQK A;  4M7A D;  1N8R U;  2EQK A;  3G4S A;  2LX9 A;  2CZ1 B;  4FL6 A;  4RTX A;  4JUV A;  2XD0 A;  4Y28 E;  3OYF A;  2C0T A;  1CSK A;  1IGU A;  3UPU A;  2FPE A;  1VQ8 A;  2RH2 A;  1NLP C;  3CBP A;  5HCK A;  2B8A A;  2JMC A;  5CKB A;  2RHZ A;  1N6A A;  1GFC A;  3WVD B;  3JV3 A;  1BCO A;  3CCV A;  1VYU A;  3KFV A;  3M4Y A;  5C6S A;  2DAQ A;  1X6G A;  4PJO D;  4KBM B;  2P0K A;  5LJ3 f;  1ZSZ C;  4BI8 B;  1GCQ A;  4JS5 A;  2CH4 W;  3L2Z A;  5GAN 4;  3CCS Q;  1PKT A;  4PKC C;  1DJ7 B;  4J9F A;  3A98 A;  2ZPG B;  1VQ9 A;  4CI0 C;  1QQJ A;  1IHV A;  1YBY A;  4BI3 A;  3OYL A;  4OB1 B;  4IIM A;  2JZ2 A;  4PFP A;  2I2L A;  2RPN A;  3MPU B;  2H3J A;  4E7I A;  5EC7 A;  2GFA A;  3LW5 E;  2KMT A;  1VQO T;  3CCQ Q;  1MMD A;  4NS5 A;  4XU0 A;  4ZGD B;  2AK5 A;  2DD5 A;  2EJ9 A;  3H0H A;  1R0B G;  1VQ5 Q;  2ED1 A;  1YHQ Q;  1WHH A;  1HYO A;  3VKI A;  2E6N A;  1KQS P;  1I07 A;  3LH0 A;  3CCR T;  1IZ6 A;  3MHX A;  4L5G A;  3EGU A;  1KK7 A;  1RAH B;  2ZPI B;  2HNI A;  1KC8 C;  1LPL A;  2A08 A;  4X9D A;  4BB7 A;  2DL8 A;  1PRL C;  4E7S A;  2EYX A;  1YIJ T;  2OTL Q;  1VQ6 T;  1UGQ B;  2CT3 A;  3DLM A;  4J8O A;  3TSW A;  1N9S A;  1YJN A;  4DBF A;  1OUL A;  2F5T X;  3V7C A;  2Y4X A;  4PNO A;  1I8F A;  2FPF A;  3M9Q A;  3JB9 F;  1X27 A;  3CC4 Q;  3NGP A;  1UGS B;  1YJW T;  1ZA2 B;  2LQ8 A;  2QA4 Q;  3LGL A;  1WJS A;  2H8H A;  3MO8 A;  4KT0 E;  1ZUY A;  3V7S A;  2AKL A;  5LJ3 j;  3L2U A;  3G6E T;  2J6K A;  1BI3 A;  3PIP A;  2K2V A;  4PJJ A;  1EIF A;  3ER0 A;  1YIT T;  4M78 G;  1RL2 A;  2P0P A;  3QDF A;  3OMC A;  3CMA Q;  2KAF A;  2X3W D;  4HCC A;  2A37 A;  4XTW A;  1S1N A;  1ZBJ A;  4QQ6 A;  1BI2 A;  2EWN A;  2PVG B;  1TUG B;  5KYU A;  4OB0 B;  2RJC A;  4X9C A;  1S72 Q;  4ME7 A;  2F2X A;  3CCU T;  1NBE B;  2O2O A;  5KYU B;  4RG8 A;  1UTI A;  3OMG A;  2VVK A;  2EJG A;  2E3I A;  2CP7 A;  2KRN A;  5IXF A;  3CCJ Q;  4C92 E;  3JB9 J;  3PNW C;  1X01 A;  1QVG S;  3N5B B;  3VS5 A;  1JO8 A;  3HPW A;  2O88 A;  2P0Q A;  1I5L A;  5FRN A;  4RCB A;  1T3S A;  1TWB A;  1V29 B;  3CXC S;  2BUD A;  5FWB A;  1YI2 A;  2BKD N;  4ANJ A;  4CC2 A;  1D0Z A;  2NWM A;  3DKM A;  1AVZ C;  5D6Y A;  3JCM P;  1OZ3 A;  5KYX A;  4R56 A;  2M0O A;  2QK0 A;  3PFS A;  4HCZ A;  4J6W A;  5KYX B;  2RQU A;  2QEX A;  3VU3 C;  2V8I A;  3M0S A;  3O8V A;  4CC3 A;  4LXC A;  4KUI A;  1PG5 B;  1WJR A;  5GAN e;  2RI2 A;  5LJ3 h;  4XTX A;  1PCX A;  4DEY A;  2G6F X;  2VGN A;  3D7S B;  2O31 A;  3FLG A;  4JS4 A;  2KQW A;  4A63 B;  2G3R A;  3CC7 T;  4RMO A;  1YJ9 T;  3RKY A;  2JTF A;  4F7U G;  4KGV B;  3S3N A;  3P8D A;  1RAE B;  4E47 A;  3VUZ A;  3P8H A;  4D6W A;  1ZQ1 A;  2GTO A;  1BYM A;  3L2W A;  1XOV A;  3CC2 Q;  3CD6 A;  2KXD A;  3L42 A;  1QVF A;  1YWP A;  4XU1 A;  2HSP A;  8ATC B;  3JCM b;  4ZGE B;  2I0N A;  4J9C A;  3EFO A;  2Y4Y A;  3QKJ A;  1D3B A;  4EMK C;  3G1J A;  4PJL A;  2CGH A;  3EFO B;  5LJ3 d;  2GTJ A;  3QBY A;  5KH6 A;  4B9X A;  5KE2 A;  3JCM J;  1D3B B;  2EYY A;  2BE7 D;  2LZ6 B;  2M0Y A;  4GY5 A;  2CRE A;  3V8L A;  3A5Z B;  2LCS A;  3X24 B;  5GAM j;  4XTV A;  5AT1 B;  1YWO A;  2QI2 A;  1QKW A;  5GAO p;  4HT8 A;  1UGV A;  4C92 D;  2X3X D;  1MMN A;  1BU1 A;  4J83 A;  4XAX B;  1NZ9 A;  4EIK A;  3EGX A;  1PSE A;  2EJF A;  2M16 A;  2RQV A;  3LWI A;  3QG1 A;  2K57 A;  3EGX B;  4MMK A;  4C8Q E;  2FL7 A;  2D8H A;  4FYX B;  4HCK A;  3V8J A;  4M78 A;  1JJ2 A;  3JCM g;  1WNL A;  4IUU A;  2PUO B;  4FT2 A;  2DZ9 A;  4M78 B;  1W6X A;  1MMG A;  1RAC B;  1UB4 A;  1M4Z A;  1OYX A;  2O9S A;  1VQO A;  3ULR B;  3EG1 A;  2DER A;  2WSF E;  2VUB A;  1PC0 A;  2ZCF B;  4M7A A;  2EFI A;  3NMZ C;  3H6Z A;  1M3A A;  5FU7 C;  4PJN A;  1PNJ A;  2W10 A;  2P4R A;  2CP3 A;  4M7A B;  1UGP B;  2GGR A;  4BY6 B;  2DKG A;  1Y57 A;  1QP3 A;  4OGC A;  2OJ2 A;  1U1T A;  5GAN 5;  4BDY A;  3TRE A;  1U3O A;  2FZC B;  2HEQ A;  1VQ6 A;  4GLK A;  3QWX X;  4M75 D;  4QW2 A;  2DVE A;  4PJO A;  3RDV A;  2QGG A;  2D0N A;  2EVR A;  2R5A A;  2IVW A;  2AZV A;  1B7T A;  2DL4 A;  4PJO B;  4OML A;  1OOT A;  5J3B A;  1E6G A;  4E7L A;  1YJW A;  2BZ8 A;  3M55 A;  1WYX A;  1K8A U;  3ZFJ A;  2KBT A;  5IHK A;  3CCL Q;  4JLG A;  3L2Q A;  3TVT A;  4HVW A;  3G6E A;  1VQ7 A;  2MPX C;  1YIT A;  1OPK A;  2XU8 A;  4V2S A;  2K5F A;  5GAN 2;  2OI3 A;  4M78 F;  2M51 A;  3L1A A;  3EHQ A;  1M2O A;  2ZZD A;  1EZZ B;  4RCC A;  3CCU A;  2C06 A;  2VV5 A;  3I35 A;  1OEB A;  2L3P A;  1TG0 A;  5HKC A;  1VQ8 Q;  4M7A F;  2YUP A;  5CKE A;  4WCI A;  1RAD B;  1P92 A;  2YWW A;  1AWO A;  4FM4 B;  2ZGW A;  2CUD A;  1AWX A;  2SRC A;  2GF7 A;  5DLO A;  3CCV Q;  2JNG A;  1IRE B;  1NJI U;  2V8K A;  5GAN j;  1WIE A;  4QVZ A;  5FU6 C;  4M7D D;  2K9G A;  3QZ5 B;  4LDV A;  4OVA A;  1K76 A;  2AKK A;  1KQ1 A;  1HXD A;  2FVU A;  3QDR B;  2KRM A;  1KIK A;  4PJO F;  1O9S A;  5GJV B;  1VOM A;  1QVG P;  1SRL A;  3EH2 A;  1XTD A;  4AMC A;  1WI7 A;  3MEA A;  4R0K A;  2LCC A;  3CXC P;  4J9H A;  2MWP A;  2K3X A;  4BE0 A;  2YUO A;  3LYI A;  1KG1 A;  2DJZ A;  3EFR A;  2MWO A;  4EMG A;  4K11 A;  2LJ0 A;  4QVD A;  1CKB A;  3CC7 A;  1YJ9 A;  1QP2 A;  3PTA A;  1LJO A;  5CK9 A;  3RKX A;  3SDZ A;  1AZE A;  2X9H A;  3CEY A;  5KCO A;  3CCM A;  4OMQ A;  3CCE T;  2W0Z A;  1GL5 A;  5CO7 A;  1VQP T;  5D6W A;  2KSS A;  2E5Q A;  4PJO E;  1BIB A;  1H3Z A;  2E12 A;  4N4H A;  5KYW A;  5CKH A;  2RN8 A;  4JLI A;  1NYF A;  2CP2 A;  4J9G A;  1WZO A;  4NL3 A;  3EHR A;  1VQM A;  1QWF A;  5KYW B;  1YJN Q;  1JXM A;  2VAS A;  1ZUK A;  4FCY A;  1RAI B;  2VC8 A;  2LTO A;  5A0G A;  1G3W A;  1UFF A;  4E7K A;  2LJ3 A;  3A8G B;  4B6M A;  1GXI E;  1N27 A;  2KYM A;  3UDC A;  3PIO A;  2DIG A;  3P8B B;  5IHI A;  2NYS A;  4M77 D;  1G3S A;  2L89 A;  2CZ6 B;  4N4I A;  2QQB A;  3VRZ A;  2JN0 A;  1TS9 A;  3H0I A;  3OY9 A;  2KDS A;  1HD3 A;  3C4S A;  2OTJ A;  2GNC A;  3VS3 A;  3IQL A;  1YCS B;  3M53 A;  4ZTF A;  4IUP A;  5CR2 A;  1VQ4 A;  1PD1 A;  3FIF A;  1W70 A;  3GP8 A;  4RUG A;  1ACM B;  2E5K A;  1Q81 R;  5CVI A;  1RI9 A;  1MNE A;  3CCS T;  1G3T A;  2O4X A;  4Y91 A;  4LDW A;  2J05 A;  4HVV A;  4ZTJ A;  1ABQ A;  1T3L A;  4Y92 A;  2LQK A;  1N8R C;  1AEY A;  2F2V A;  2KE9 A;  2E1H A;  2LRQ A;  2O4X B;  3WXM B;  2DZC A;  3MP6 A;  5GAN d;  4C8Q G;  3CCQ T;  2KR3 A;  3NHN A;  1KD1 R;  2J6O A;  1YHQ T;  1C0M A;  1MMA A;  1YI2 Q;  1Q81 C;  4N0A C;  1I0C A;  1KQS A;  1XNI A;  1OZ2 A;  1I5O B;  1QKX A;  3A8L B;  4F17 A;  5IXB A;  4LE9 A;  2E70 A;  4MZM A;  2EW3 A;  1SHG A;  2COZ A;  4OF1 A;  2OTL T;  1Q81 U;  1KD1 C;  2HL3 A;  4C92 A;  3S6W A;  3I56 A;  4L59 A;  2RK1 A;  1EX4 A;  3OS1 A;  2VYT A;  4LDY A;  3URG A;  1ZBX A;  4E2F B;  2DX1 A;  4C92 B;  5GAM e;  2QYZ A;  1SPK A;  2EGA A;  3CC4 T;  3HRU A;  4NOY A;  1KD1 U;  1G83 A;  3LGF A;  2NUP A;  2QA4 T;  4A4E A;  1MHN A;  3EAE A;  1TOV A;  3VS2 A;  2NUP B;  1D0X A;  4LDX A;  2F5K A;  3CMA T;  3GPL A;  1JU5 C;  1LVK A;  4RTZ A;  2L3S A;  3R6N A;  4YTL A;  4OMF B;  4FW2 A;  2QDY B;  1RAA B;  2SEM A;  2VWF A;  1S72 T;  2JVV A;  2YRD A;  4E7Z A;  4BD3 A;  3PVQ A;  2PVO B;  2WSE E;  3QII A;  5GAO l;  2ATC B;  3RR6 A;  3SWN C;  3JAM E;  3CCJ T;  2K5I A;  4C0D B;  3DLL A;  1Z9Z A;  1H64 1;  2E65 A;  1VYV A;  5GAO q;  3JSC A;  4J5Y A;  1WHJ A;  1E7O A;  1XJW B;  2CKK A;  1WLP B;  5LJ3 g;  3HFN A;  3JRZ A;  4AG2 C;  3OYK A;  4M75 B;  2HQE A;  4JZ4 A;  4RG2 A;  4BI4 A;  3BDL A;  2DA9 A;  4MDW A;  2HSE B;  3VS6 A;  1RLP C;  2J7I A;  2R5M A;  1KFZ A;  4C92 F;  4OGE A;  4E7H A;  3I5S A;  1TUD A;  2K5L A;  2P84 A;  1VQL A;  4F14 A;  4ZN1 A;  2Y90 A;  2EQJ A;  3OYI A;  3MCA B;  3M0R A;  3EG3 A;  2A36 A;  1UGR B;  5DY9 A;  3J80 E;  3OYE A;  5GJW B;  1RI0 A;  4OB2 B;  4IIO A;  1UJ0 A;  5CQX A;  2EYW A;  4KGZ B;  1Q82 R;  1PSF A;  1KQ2 A;  3M59 A;  1K73 U;  1NPR A;  2HMA A;  4M7A G;  4C0Z A;  4JJN K;  1YP5 A;  4KUL A;  1U06 A;  4C0F A;  2XKO C;  4JRP A;  2HAX A;  3CC2 T;  2KRS A;  1X75 C;  4C8Q A;  2QQ9 A;  3CCE A;  4DEX A;  1WFW A;  4C8Q B;  4MML A;  1A0N B;  4JJD A;  1B07 A;  1T0H A;  3TEE A;  4HA8 A;  1VQN Q;  2NUT A;  4FYV B;  5GAM f;  2COW A;  1OV3 A;  3HTR A;  2X35 A;  3M0U A;  4PJO G;  1ARK A;  5IAY A;  2NUT B;  3C94 A;  2MYS A;  3E9G A;  4FYY B;  2AHJ B;  1ZA1 B;  3HKS A;  4M75 F;  1D09 B;  2OAW A;  1Q82 U;  1QCF A;  3BW1 A;  2XI9 A;  2K6D A;  5AYF A;  3ZBD A;  2LT4 A;  3I55 Q;  1J3T A;  2RHU A;  1B3Q A;  5CCA A;  4FYW B;  2LC4 A;  1HJD A;  1FMK A;  2IG0 A;  4UC4 A;  1VQ7 Q;  2WAC A;  3KBG A;  4DQ2 A;  4FT4 A;  3RER A;  5I2M A;  3QXE B;  3Q1J A;  3CCS A;  4M75 E;  3CPW S;  1GCQ C;  4IUV A;  2GBQ A;  3DB3 A;  1W2B S;  2JW4 A;  5A0D A;  2KEA A;  1VUB A;  2LQW A;  1C6V X;  1OPL A;  5A2Q E;  4FSX A;  1UEB A;  2JS2 A;  5GAM g;  3CME Q;  3CCQ A;  2V26 A;  1O75 A;  1ZHI A;  1UUE A;  4Z8A A;  2M9U A;  1LCK A;  4C8Q F;  1JRI A;  4RTU A;  3G71 Q;  2DLP A;  5I2S A;  2E6Z A;  3C0C A;  1M1K R;  1BCM A;  2RK2 A;  3KXT A;  2E4H A;  3OYC A;  1Q95 G;  1RLQ C;  2NLU A;  2CT4 A;  2RHY A;  3QZ9 B;  5IHN A;  4Z89 A;  2V1Q A;  2DNU A;  4M7D F;  3SD4 A;  2EYZ A;  2JTM A;  5GMK j;  4QQG A;  2OTL A;  2DO3 A;  2DET A;  1VIF A;  1U5S A;  2DL7 A;  3V7R A;  2XIC A;  1ABO A;  3MJX A;  1U1S A;  7AT1 B;  2MK5 A;  2QQS A;  3M56 A;  1D1B A;  3HHT B;  3OW2 S;  2ROT A;  4WTO B;  4FSS A;  2HZY A;  2EQM A;  3VRY A;  2FG0 A;  3EG9 A;  3FB9 A;  2VXE A;  2P4T A;  1X2K A;  5J26 A;  4IUQ A;  4P5N A;  1AOJ A;  2PZ1 A;  3KUF A;  3EG9 B;  1QLY A;  3CCM Q;  4OP0 A;  5GAN 3;  2QGF B;  1H3H A;  1V76 A;  1QCO A;  1M1K U;  4CC7 A;  4M7D E;  5LL6 S;  4DBH A;  2FZK B;  2EQI A;  3CMA A;  5LJ5 e;  2LDM A;  3BE3 A;  1K8A R;  1GBQ A;  1IB8 A;  3EFS A;  3RBB B;  1D1A A;  1VQM Q;  2O9V A;  4WF2 A;  2Z0W A;  1Q86 R;  1Y7X A;  2X51 A;  3E1S A;  3CCR A;  2ESW A;  1S72 A;  4DOV A;  1WHM A;  5J39 A;  1RAF B;  1IHW A;  2F69 A;  5FW9 A;  1UHF A;  1AZG B;  2HBW A;  2LVM A;  5GAM h;  2L2P A;  5GAN f;  2QAS A;  2DXB A;  1AHJ B;  1RAB B;  3F70 A;  3MET A;  1PKS A;  5IN1 A;  1YIJ A;  1VQ8 T;  3CCJ A;  4M4Z A;  1NEG A;  2YDL A;  1RUW A;  1K8A C;  2DL3 A;  5GAO r;  2FRW A;  5ECA A;  3CCV T;  2OTJ Q;  4M77 F;  2LCL A;  2BE9 B;  2CS7 A;  2K2M A;  2EKO A;  1Q86 C;  1VQ4 Q;  1I4K 1;  3RMS A;  2E64 A;  3G7Z A;  2AZS A;  4ATO A;  2DL5 A;  1NJI R;  2ROL A;  3FEO A;  2GQV A;  4HXJ A;  2K3Y A;  4E6R A;  1Q86 U;  3M58 A;  1K9M R;  4KRT A;  3THK A;  2L0A A;  2EQU A;  1QVG A;  1WQW A;  1M3B A;  3PE0 A;  5IT9 E;  3CQT A;  1WQ7 A;  3CXC A;  2YT6 A;  2DXU A;  1IGQ A;  2E3H A;  5GAM d;  2MOX A;  3OYN A;  4M77 E;  1VQK Q;  2CZ0 B;  1JEG A;  2ZPF B;  1KSW A;  2CP6 A;  3OS2 A;  3G4S Q;  4XTU A;  2QAZ A;  1BB9 A;  2QTX A;  1NJI C;  5GAN g;  1VYT A;  4J6Y A;  4JDS A;  1QMC A;  1K9M C;  2LQN A;  1KJW A;  1R8O B;  3CC2 A;  1FYN A;  3UAT A;  4C92 G;  2AIR B;  2CH4 A;  2BIV A;  2XG8 D;  3OYJ A;  5A0L A;  4CC4 B;  3I56 Q;  1YJN T;  1K9A A;  2RJE A;  3FJP A;  1K9M U;  1BBZ A;  1ZSZ A;  2VGM A;  2VKN A;  2RHX A;  1FWZ A;  3FRN A;  4EPC A;  1ZSZ B;  2J6F A;  5FWC A;  3X26 B;  3A8H B;  1OI1 A;  1HSQ A;  4ESR A;  4LD6 A;  2XDD A;  1VQ9 Q;  2CUB A;  4C5H A;  5I22 A;  2M02 A;  2KRO A;  2YRV A;  3V8K A;  2PNI A;  2OX7 A;  4JRI A;  4J7F A;  1SG5 A;  3REB B;  2B86 A;  2MIO A;  2DEQ A;  2RO0 A;  2HQX A;  2KGT A;  5LJ5 f;  3ZL7 C;  1MV3 A;  2GFU A;  3EG0 A;  2FYK A;  1WXT A;  3OBY A;  2L3R A;  2RJD A;  4Z02 A;  4PFO A;  1FMV A;  4PK4 A;  3ME9 A;  5DLQ E;  5I21 A;  1NPP A;  3RKW A;  4HKE A;  4FU6 A;  4A4H A;  1UEC A;  4Q5W A;  2DEU A;  3JB9 H;  2EGE A;  1UE9 A;  4MDX A;  4JZ3 A;  2RD1 A;  1GFD A;  2LNV A;  3FJ5 A;  4M78 C;  2MI6 A;  4HCB A;  2RMO A;  4M75 G;  2DM1 A;  4FIB A;  1OX9 A;  3H9N A;  5GAN h;  5GAN 7;  2YLC A;  1YI2 T;  4DOW A;  1G8X A;  1R0C B;  2QDL A;  3PGG A;  2FB7 A;  1JXO A;  5GAN 6;  2J06 A;  3VS4 A;  2RQR A;  2KT8 A;  3LWH A;  4VUB A;  3JCM Q;  4M7A C;  4BY6 C;  2QXF A;  5GMK l;  1B34 A;  2L3Q A;  1D0Y A;  1W2B P;  1IXD A;  1VQL Q;  2DTH A;  1H8K A;  1XQH A;  1B34 B;  1QWE A;  1Y96 A;  1WJQ A;  3NTK A;  2CSI A;  5GAO m;  4F7U E;  1Y96 B;  3J81 E;  4MZP A;  1Y71 A;  4RTW A;  1AWJ A;  3C12 A;  2DBK A;  3OYY A;  4E7J A;  4A4F A;  1ZSG A;  1RAG B;  3M0Q A;  5LJ5 j;  4PJO C;  4J9E A;  1BIA A;  2MF2 A;  2HL5 C;  4AFU C;  2A3L A;  2DE0 X;  2NUZ A;  2PTK A;  1SF9 A;  2M1H A;  4F16 A;  4J9I A;  2ZPH B;  3GOX A;  1U8R A;  1TH7 A;  4BDZ A;  1UDL A;  1VA7 A;  2MCN A;  2L5Q A;  2KT1 A;  1OX8 A;  2RF0 A;  3NTH A;  3UT1 A;  4BAC A;  1VQ5 T;  1TUC A;  2C0I A;  4DBQ A;  3SHW A;  3OW2 P;  2KNB B;  1FMW A;  4M7D G;  3QJY A;  1M8V A;  1PM3 A;  3RUX A;  3QYH B;  4KH1 B;  1H92 A;  1YFN A;  4IUT A;  2ECZ A;  2QEX Q;  4PFZ A;  4LD9 K;  2JM8 A;  4XU3 A;  1QVF S;  4HT9 A;  2IIM A;  4LNP A;  4C5E A;  3M4G A;  1M30 A;  4ORZ A;  2VXF A;  1YNZ A;  1OQK A;  2DIL A;  3NFC A;  4RTT A;  3OYH A;  3MKD A;  3PMT A;  4NL2 A;  5GMK e;  3UA6 A;  3CPF A;  3VS0 A;  2ENM A;  2R57 A;  1PRM C;  1WHL A;  5LJ5 h;  1BI0 A;  4RTY A;  3EH1 A;  3CD6 Q;  3I9Q A;  4QVC A;  4MZT A;  5KYN A;  4F04 B;  2RNA A;  1M9S A;  1R77 A;  4OMN A;  4RTV A;  5GAN 8;  2HDA A;  3OSV A;  4AT1 B;  1KC8 R;  5FRO A;  2LMJ A;  1YN8 A;  2YRC A;  1ZUU A;  2XDB A;  2FPD A;  5KYY A;  4EMK A;  1Y0M A;  2HCK A;  2VB6 A;  4PJM A;  3RMQ A;  4A54 A;  3QSU A;  1JB0 E;  5KYY B;  4EMK B;  1SHF A;  1X2Q A;  4JRQ A;  4J6X A;  1QCN A;  1NM7 A;  4AFS C;  4C5I A;  3OSS C;  2RQT A;  1AWW A;  4M77 G;  2COY A;  1K73 R;  1JJ2 S;  4OMO A;  3VS7 A;  2X4J A;  1FX7 A;  1WPY A;  4M75 A;  5HK0 A;  3VJP A;  1M90 R;  5GMK i;  2JOY A;  4O6J A;  3QPH A;  1K1Z A;  1VQN T;  3JCM e;  5LJ5 d;  1MV0 B;  4PL6 A;  3H0F A;  1KC8 U;  3GNF B;  2X4Y A;  1NLO C;  5D6X A;  3VUB A;  1K73 C;  1X6B A;  3RES A;  4ELY C;  3QWY A;  4D8D A;  3J7A F;  3I55 T;  4JJC A;  5EG2 A;  2YUN A;  4CRI A;  1M90 C;  3PVL A;  1AT1 B;  4KH0 B;  3L2R A;  2RM4 A;  1VQO Q;  1VQ7 T;  2DYI A;  3C95 A;  3HRT A;  4J7I A;  3SB2 A;  1NYG A;  2LNH B;  3UA7 A;  2JJ9 A;  2KVQ G;  4ZN3 A;  1M90 U;  2JTE A;  2RJF A;  3I5R A;  5FU7 B;  1WGS A;  3CCR Q;  2C0O A;  2XMF A;  3QHS A;  1AD5 A;  1VQP A;  2HBP A;  4AFQ C;  1Q82 C;  1M1G A;  1E6H A;  2LP5 A;  1YIJ Q;  4L6V 5;  4X34 A;  1VQ6 Q;  3CME T;  2DYB A;  4M7D A;  2BTT A;  3OQ5 A;  3CBO A;  1WXU A;  1Z9Q A;  5GAO n;  2PQW A;  3G71 T;  4M7D B;  2PU9 B;  2KI7 A;  2DD4 A;  2K79 A;  3HL8 A;  3LLR A;  3JCM V;  3S3O A;  3M5A A;  1YJW Q;  1MND A;  1W4S A;  2RI5 A;  4EDU A;  1N5Z A;  4O5V A;  5CIU A;  3TQ7 P;  2DXT A;  2EIF A;  3R6O A;  3PT9 A;  2IPO B;  3G6E Q;  4OMP A;  1YIT Q;  2HD0 A;  5CKD A;  3UF4 A;  2F2W A;  2YHT A;  4PLL A;  2D1X A;  4C0G A;  4C92 C;  3X20 B;  3HP9 A;  3SFM A;  5I11 A;  4XQ3 A;  3CCU Q;  3MP1 A;  5L23 A;  3GBQ A;  2QQA A;  4KGX B;  2OAU A;  2FHD A;  2E10 A;  3CCM T;  1GBR A;  4II1 A;  3OB9 A;  2AT1 B;  2R58 A;  3M0P A;  4IUR A;  3MEW A;  3JB9 I;  4BE2 A;  1TU0 B;  3CBM A;  4QQD A;  1QVP A;  1SSH A;  1SSF A;  1SRM A;  3VV0 A;  3X25 B;  3JCM f;  4LN2 A;  1VQ5 A;  3INZ A;  1YHQ A;  1VQM T;  6AT1 B;  4J9D A;  3GIB A;  4LUE A;  3L2V A;  5FU6 B;  4XTZ A;  4AG1 C;  2CZ7 B;  4M77 A;  3M57 A;  2V8J A;  4XK8 E;  4Z88 A;  1IO6 A;  2CP5 A;  4ZGJ B;  1SKU B;  4M77 B;  2PUK B;  4C0D C;  2KXC A;  3QYG B;  1QW1 A;  2FRY A;  2A7Y A;  2JS0 A;  3JB9 D;  5CAI A;  3DB4 A;  2O01 E;  4JRK A;  2HQH A;  2FO0 A;  2DJQ A;  2OTJ T;  1M1K C;  2BZY A;  1WDX A;  3REA B;  3CC4 A;  4M75 C;  1VQ4 T;  3CC7 Q;  1YJ9 Q;  2H3E B;  2XID A;  2XHC A;  1T0J A;  1GRI A;  3CCL T;  2QA4 A;  1WA7 A;  3ASK A;  2MMP A;  1QVF P;  3BY7 A;  2L8D A;  4DA4 A;  2DFU A;  5CKF A;  2JUF A;  3JCM W;  1X43 A;  2EPD A;  2D8J A;  5HK3 A;  1KHC A;  2QG9 B;  2YXY A;  2DMO A;  1Q7Y R;  1TXQ A;  1VQK T;  2DBM A;  1D1C A;  1G2B A;  2EAY A;  3G4S T;  3OYB A;  3A1P A;  1BKB A;  1X69 A;  2QQR A;  3TCJ A;  2JMA A;  2CP0 A;  4QKU A;  2XDP A;  1MGQ A;  3MP8 A;  3E2U A;  2ZPE B;  3OA6 A;  3EGD A;  5GMK h;  3ZEH A;  1PWT A;  2HKQ B;  2X4W A;  3S3M A;  3VYG A;  3OYA A;  4C8Q C;  5KCH A;  4DBR A;  5CQY A;  3EGD B;  1Q7Y C;  2RHI A;  3I56 T;  2YUQ A;  1M2V A;  8AT1 B;  1HK9 A;  2EBP A;  2JT4 A;  4LDU A;  4GBQ A;  1VQN A;  2DF6 A;  5M9O A;  1M2V B;  2FEI A;  3PMI A;  2FZG B;  2KK4 A;  2E41 A;  4X1V A;  1KQS S;  4BE1 A;  5FRM A;  2GCX A;  4FW1 A;  4BUG A;  5KE3 A;  4M7D C;  1Q7Y U;  1VQ9 T;  2BZX A;  3M54 A;  1JJ2 P;  3GNG A;  4LUD A;  1ZLM A;  2K4Y A;  3OYG A;  3I55 A;  3LX7 A;  2ABL A;  1NE8 A;  1YCY A;  1NG2 A;  9ATC B;  3AT1 B;  1I1J A;  2DRM A;  4N4G A;  2LX7 A;  1K0S A;  1N9R A;  4N0A A;  5GMK m;  2GQI A;  3GLX A;  2LJ1 A;  4GLM A;  4F7U A;  3H41 A;  4JJB A;  1JBM A;  4A4K A;  4R55 A;  3RIR A;  1C1A A;  3NPF A;  4D8K A;  3OBW A;  4F7U B;  1M8M A;  3JCM h;  3HFO A;  1UJY A;  1M1F A;  1V1C A;  2K3B A;  4QT7 A;  5DM7 R;  1TTH B;  1K4U S;  1ZX6 A;  3E19 A;  3U23 A;  1G3Y A;  3H8Z A;  2MAM A;  4C8Q D;  1K0X A;  3JB9 G;  2DK3 A;  2HKN A;  3CME A;  1WX6 A;  3EG2 A;  5C0M A;  2CSQ A;  2RA2 A;  3RNJ A;  3AHU A;  5HY6 A; 
#chains in the Genus database with same CATH homology
 1MUZ A;  3TSZ A;  1BK2 A;  2RQV A;  1H92 A;  1UG1 A;  1YP5 A;  2ECZ A;  1CKA A;  1U06 A;  2D8H A;  2JM8 A;  2KYB A;  4HCK A;  2KRS A;  4AFZ C;  2ED0 A;  2IIM A;  4LNP A;  4DEX A;  1WFW A;  1M30 A;  1W6X A;  4J9B A;  4ORZ A;  1YNZ A;  1A0N B;  2DIL A;  4JJD A;  1B07 A;  1T0H A;  4RTT A;  2O9S A;  3ULR B;  5IH2 A;  1WXB A;  3EG1 A;  1OV3 A;  3M0U A;  1ARK A;  1GCP A;  3LH5 A;  3UA6 A;  3NMZ C;  1M3A A;  1M3C A;  3VS0 A;  1PNJ A;  2W10 A;  2ENM A;  2P4R A;  1PRM C;  1M27 C;  2RQW A;  2OAW A;  2CDT A;  1QCF A;  2GGR A;  4RTY A;  2A28 A;  3I9Q A;  2K6D A;  1Y57 A;  2OJ2 A;  1J3T A;  3M0T A;  2RNA A;  1B3Q A;  4RTV A;  4OMN A;  2JXB A;  2HDA A;  2LMJ A;  1YN8 A;  1U3O A;  1HJD A;  2HEQ A;  1FMK A;  1ZUU A;  2FPD A;  3QWX X;  3SEM A;  1Y0M A;  2HCK A;  4ZNX A;  1W1F A;  2D0N A;  2EVR A;  1SHF A;  2AZV A;  1X2Q A;  2DL4 A;  4OML A;  1OOT A;  1E6G A;  1NM7 A;  4AFS C;  1AWW A;  2RQT A;  3O5Z A;  4HVU A;  2V1R A;  2BZ8 A;  4OMO A;  1GCQ C;  1WYX A;  3VS7 A;  2GBQ A;  2KBT A;  5IHK A;  2JW4 A;  2KEA A;  2LQW A;  3TVT A;  1OPL A;  2K7A A;  4HVW A;  1NEB A;  2JS2 A;  4OMM A;  3VS1 A;  1OPK A;  1K1Z A;  2DVJ A;  2YSQ A;  1UUE A;  4Z8A A;  1MV0 B;  2DRK A;  1LCK A;  2OI3 A;  4JPB W;  2EGC A;  2M51 A;  3H0F A;  4RTU A;  2DLP A;  3EHQ A;  1NLO C;  3C0C A;  1X6B A;  3QWY A;  4D8D A;  1RLQ C;  3I35 A;  2CT4 A;  1OEB A;  4JJC A;  2YUN A;  5IHN A;  2L3P A;  4Z89 A;  2V1Q A;  1TG0 A;  2DNU A;  3PVL A;  2YUP A;  4WCI A;  2EYZ A;  1UHC A;  2JM9 A;  1PHT A;  1EFN A;  1U5S A;  1AWO A;  1JQQ A;  2DL7 A;  1ABO A;  2EKH A;  2CUD A;  1AWX A;  2SRC A;  1SEM A;  1NYG A;  2LNH B;  3UA7 A;  1WIE A;  2ROT A;  4FSS A;  2JTE A;  3I5R A;  2K9G A;  3VRY A;  2FG0 A;  2C0O A;  1K76 A;  4RTX A;  2AKK A;  1X2K A;  2XMF A;  1AOJ A;  2PZ1 A;  1AD5 A;  2C0T A;  1CSK A;  2FPE A;  2KRM A;  5HCK A;  1NLP C;  1QLY A;  4AFQ C;  2JMC A;  1KIK A;  5GJV B;  1H3H A;  1SRL A;  1E6H A;  1GFC A;  2LP5 A;  4CC7 A;  1WI7 A;  3JV3 A;  2EQI A;  4R0K A;  1VYU A;  4J9H A;  1GBQ A;  2DYB A;  3KFV A;  3RBB B;  2BTT A;  2YUO A;  1WXU A;  2O9V A;  1Z9Q A;  1X6G A;  4K11 A;  2LJ0 A;  1CKB A;  2ESW A;  2K79 A;  1GCQ A;  1AZE A;  2CH4 W;  1PKT A;  1N5Z A;  4OMQ A;  5FW9 A;  1UHF A;  1AZG B;  2HBW A;  2W0Z A;  4J9F A;  2L2P A;  3A98 A;  1GL5 A;  1PKS A;  4IIM A;  4M4Z A;  2RPN A;  1NEG A;  2YDL A;  4OMP A;  5EC7 A;  1RUW A;  2DL3 A;  2RN8 A;  1NYF A;  4J9G A;  2FRW A;  3EHR A;  5ECA A;  3UF4 A;  2F2W A;  1QWF A;  2AK5 A;  2D1X A;  3H0H A;  2K2M A;  1JXM A;  1ZUK A;  2ED1 A;  1I07 A;  1UFF A;  2LJ3 A;  5I11 A;  3EGU A;  5L23 A;  3GBQ A;  2KYM A;  2AZS A;  2DL5 A;  2ROL A;  5IHI A;  2A08 A;  4HXJ A;  4E6R A;  2DL8 A;  1GBR A;  4KRT A;  3VRZ A;  1PRL C;  2EYX A;  2L0A A;  3THK A;  3H0I A;  3M0P A;  1HD3 A;  2CT3 A;  1M3B A;  3PE0 A;  2GNC A;  3TSW A;  3VS3 A;  3IQL A;  1YCS B;  1SSH A;  3CQT A;  1SRM A;  4LN2 A;  2YT6 A;  2MOX A;  4J9D A;  1W70 A;  1JEG A;  4LUE A;  1KSW A;  2FPF A;  4RUG A;  1X27 A;  2E5K A;  4AG1 C;  1BB9 A;  3NGP A;  1RI9 A;  4Z88 A;  1IO6 A;  1VYT A;  2LQN A;  2J05 A;  2H8H A;  4HVV A;  1ABQ A;  1T3L A;  4Y92 A;  1AEY A;  1ZUY A;  1KJW A;  2KXC A;  2F2V A;  2AKL A;  2KE9 A;  2FRY A;  1FYN A;  3UAT A;  2J6K A;  2JS0 A;  2CH4 A;  2KR3 A;  2X3W D;  3NHN A;  2FO0 A;  2A37 A;  2DJQ A;  4CC4 B;  1S1N A;  1ZBJ A;  2BZY A;  1K9A A;  1WDX A;  3REA B;  1BBZ A;  2VKN A;  2J6O A;  1T0J A;  2F2X A;  2J6F A;  1I0C A;  2O2O A;  5FWC A;  1GRI A;  1UTI A;  2VVK A;  1WA7 A;  1HSQ A;  4ESR A;  1QKX A;  2CUB A;  2KRN A;  4F17 A;  5I22 A;  5IXF A;  5IXB A;  4LE9 A;  2KRO A;  2EW3 A;  1SHG A;  2PNI A;  3VS5 A;  1JO8 A;  2O88 A;  3REB B;  1X43 A;  2B86 A;  2D8J A;  2EPD A;  2MIO A;  1T3S A;  2KGT A;  3ZL7 C;  2DMO A;  1MV3 A;  2DX1 A;  5FWB A;  3EG0 A;  1SPK A;  1WXT A;  2DBM A;  2EGA A;  4CC2 A;  2NWM A;  1G2B A;  1AVZ C;  1X69 A;  2JMA A;  1G83 A;  2RQU A;  1UEC A;  3M0S A;  3VS2 A;  4CC3 A;  1PWT A;  2EGE A;  1UE9 A;  4JZ3 A;  1GFD A;  3FJ5 A;  1JU5 C;  2RMO A;  4DEY A;  2G6F X;  4RTZ A;  2L3S A;  2YUQ A;  2O31 A;  2DM1 A;  3R6N A;  2EBP A;  2JT4 A;  4A63 B;  4GBQ A;  2DF6 A;  2FEI A;  2SEM A;  2VWF A;  2QDL A;  1JXO A;  4X1V A;  2J06 A;  3VS4 A;  2RQR A;  2KT8 A;  3PVQ A;  2GTO A;  2BZX A;  4LUD A;  1XOV A;  1Z9Z A;  2L3Q A;  2KXD A;  1VYV A;  1ZLM A;  1YWP A;  1H8K A;  2ABL A;  1QWE A;  1NG2 A;  2HSP A;  1E7O A;  1I1J A;  2DRM A;  2CSI A;  2LX7 A;  1WLP B;  1K0S A;  2I0N A;  4J9C A;  4AG2 C;  4RTW A;  2GQI A;  4JZ4 A;  2LJ1 A;  4GLM A;  1AWJ A;  2DA9 A;  3VS6 A;  2DBK A;  1RLP C;  2J7I A;  3H41 A;  4JJB A;  1KFZ A;  1ZSG A;  3M0Q A;  2GTJ A;  4J9E A;  2EYY A;  3NPF A;  4AFU C;  4D8K A;  2LZ6 B;  2M0Y A;  1M8M A;  2DE0 X;  2CRE A;  1TUD A;  1UJY A;  3I5S A;  1V1C A;  2K3B A;  2NUZ A;  2PTK A;  4F14 A;  4QT7 A;  4J9I A;  4F16 A;  2LCS A;  1UDL A;  1VA7 A;  3M0R A;  2MCN A;  1K4U S;  1YWO A;  1ZX6 A;  2KT1 A;  3EG3 A;  1QKW A;  2A36 A;  2RF0 A;  3U23 A;  1UGV A;  5GJW B;  1K0X A;  4IIO A;  1UJ0 A;  1TUC A;  2X3X D;  2EYW A;  2C0I A;  1BU1 A;  1WX6 A;  3SHW A;  3EG2 A;  2CSQ A;  2KNB B;  3RNJ A;  4EIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...