2RNKA

Nmr structure of the domain 513-651 of the sars-cov nonstructural protein nsp3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
143
structure length
143
Chain Sequence
GSHMVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nuclear magnetic resonance structure shows that the severe acute respiratory syndrome coronavirus-unique domain contains a macrodomain fold.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 35
structure length 143
sequence length 143
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11633 SUD-M Single-stranded poly(A) binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2rnkA01
2JZFA 2RNKA 2WCTA 2KQVA 2W2GA 2JZDA 2JZEA
chains in the Genus database with same CATH superfamily
4ABKA 4ETJA 4J5QA 4R76A 4ABLA 4ZI6A 4K0CA 5E3BA 2JZEA 4JGKA 2L8RA 4ZY0A 3KQZA 1HJZA 5CB3A 1GYTA 2EWBA 1BPNA 2ACFA 5FSUA 5HIHA 4J5RA 3EW5A 2JZDA 3SIJA 5FSXA 1TXZA 3Q6ZA 2WCTA 3GPQA 4ZYQA 4X2TA 1VHUA 3IJ3A 3EJFA 1TY8A 1NJRA 2VRIA 3EWQA 3JZTA 4JCAA 3VFQA 2FG1A 5D8NA 4D86A 4ESSA 3GQEA 4TU0A 2FXKA 3ETIA 5FSVA 1SPVA 4KYBA 3GPOA 4R7MA 2JZFA 5FSYA 3IIFA 4GVVA 2EEEA 2XD7A 3H8GA 3KR5A 3Q71A 2DX6A 3EKEA 5CB5A 2J9AA 4K3NA 4ZY2A 3SIIA 2W2GA 2BFRA 3EWOA 3EJGA 2BFQA 4JLLA 3GQOA 3V45A 3EWPA 3JRUA 5AILA 5HOLA 1LANA 4J4ZA 4J5SA 4IQYA 4KSIA 3SIHA 4GUAA 5DUSA 2RNKA 2AFCA 2KQVA 2X47A 3KQXA 3KR4A 1LCPA 3H8EA 4ZX8A 5FSZA 3IIDA 3PEIA 3H8FA 1BLLE 3EWRA 4GVWA 3T8WA 4ETKA 4ZY1A 5CMSA 1LAPA 4R6TA 4JVVA 1LAMA 1ZR5A 4UMLA 5CBMA 2LGRA 1BPMA 3KZWA 3SIGA 4ZX9A 1ZR3A 3V2BA 1YD9A 3GPGA 2FAVA
chains in the Genus database with same CATH topology
2JZFA 2RNKA 2WCTA 2KQVA 2W2GA 2JZDA 2JZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZF A;  2RNK A;  2WCT A;  2KQV A;  2W2G A;  2JZD A;  2JZE A; 
#chains in the Genus database with same CATH topology
 4ABK A;  4ETJ A;  4J5Q A;  4R76 A;  4ABL A;  4ZI6 A;  4K0C A;  5E3B A;  2JZE A;  4JGK A;  2L8R A;  4ZY0 A;  3KQZ A;  1HJZ A;  5CB3 A;  1GYT A;  2EWB A;  1BPN A;  2ACF A;  5FSU A;  5HIH A;  4J5R A;  3EW5 A;  2JZD A;  3SIJ A;  5FSX A;  1TXZ A;  3Q6Z A;  2WCT A;  3GPQ A;  4ZYQ A;  4X2T A;  1VHU A;  3IJ3 A;  3EJF A;  1TY8 A;  1NJR A;  2VRI A;  3EWQ A;  3JZT A;  4JCA A;  3VFQ A;  2FG1 A;  5D8N A;  4D86 A;  4ESS A;  3GQE A;  4TU0 A;  2FXK A;  3ETI A;  5FSV A;  1SPV A;  4KYB A;  3GPO A;  4R7M A;  2JZF A;  5FSY A;  3IIF A;  4GVV A;  2EEE A;  2XD7 A;  3H8G A;  3KR5 A;  3Q71 A;  2DX6 A;  3EKE A;  5CB5 A;  2J9A A;  4K3N A;  4ZY2 A;  3SII A;  2W2G A;  2BFR A;  3EWO A;  3EJG A;  2BFQ A;  4JLL A;  3GQO A;  3V45 A;  3EWP A;  3JRU A;  5AIL A;  5HOL A;  1LAN A;  4J4Z A;  4J5S A;  4IQY A;  4KSI A;  3SIH A;  4GUA A;  5DUS A;  2RNK A;  2AFC A;  2KQV A;  2X47 A;  3KQX A;  3KR4 A;  1LCP A;  3H8E A;  4ZX8 A;  5FSZ A;  3IID A;  3PEI A;  3H8F A;  1BLL E;  3EWR A;  4GVW A;  3T8W A;  4ETK A;  4ZY1 A;  5CMS A;  1LAP A;  4R6T A;  4JVV A;  1LAM A;  1ZR5 A;  4UML A;  5CBM A;  2LGR A;  1BPM A;  3KZW A;  3SIG A;  4ZX9 A;  1ZR3 A;  3V2B A;  1YD9 A;  3GPG A;  2FAV A; 
#chains in the Genus database with same CATH homology
 2JZF A;  2RNK A;  2WCT A;  2KQV A;  2W2G A;  2JZD A;  2JZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...