2RNKA

Nmr structure of the domain 513-651 of the sars-cov nonstructural protein nsp3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
143
structure length
143
Chain Sequence
GSHMVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nuclear magnetic resonance structure shows that the severe acute respiratory syndrome coronavirus-unique domain contains a macrodomain fold.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 35
structure length 143
sequence length 143
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11633 SUD-M Single-stranded poly(A) binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2rnkA01
2JZEA 2JZDA 2RNKA 2JZFA 2KQVA 2WCTA 2W2GA
chains in the Genus database with same CATH superfamily
5CB3A 4ZY2A 2AFCA 1LAMA 4ESSA 2DX6A 1BPNA 2LGRA 3GQOA 4R6TA 5E3BA 4ETKA 3V2BA 3EKEA 2J9AA 4ZY1A 5CBMA 4ABKA 2FXKA 2JZFA 3EWRA 3EW5A 1ZR5A 1TY8A 4ZI6A 1NJRA 3IJ3A 3ETIA 2RNKA 1ZR3A 5AILA 3H8FA 4ZX9A 4R76A 4GUAA 4JCAA 4ZX8A 3SIIA 4UMLA 5DUSA 5FSVA 2ACFA 4X2TA 2EWBA 1HJZA 3Q6ZA 4J5RA 2X47A 1SPVA 4ZYQA 3GPGA 5FSXA 3JZTA 3GPOA 1BLLE 4IQYA 3EJGA 3GPQA 1TXZA 4ETJA 4TU0A 4JLLA 3V45A 5FSUA 4J4ZA 3JRUA 3KQXA 4JVVA 2VRIA 3Q71A 2WCTA 3SIGA 2XD7A 3T8WA 3IIDA 4J5SA 4ZY0A 3EWOA 3KZWA 2BFRA 3SIHA 3H8GA 5FSYA 4K0CA 5HIHA 3IIFA 4ABLA 2W2GA 1LCPA 4K3NA 2FAVA 3EWQA 4KSIA 1YD9A 3KR4A 5FSZA 3GQEA 5HOLA 5CB5A 1GYTA 2BFQA 3EWPA 1VHUA 3H8EA 2JZEA 2JZDA 4GVVA 4J5QA 2L8RA 4D86A 5D8NA 3EJFA 4GVWA 3VFQA 2FG1A 5CMSA 3KR5A 3SIJA 1LANA 4JGKA 1BPMA 3KQZA 3PEIA 4KYBA 4R7MA 2EEEA 2KQVA 1LAPA
chains in the Genus database with same CATH topology
2JZEA 2JZDA 2RNKA 2JZFA 2KQVA 2WCTA 2W2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZE A;  2JZD A;  2RNK A;  2JZF A;  2KQV A;  2WCT A;  2W2G A; 
#chains in the Genus database with same CATH topology
 5CB3 A;  4ZY2 A;  2AFC A;  1LAM A;  4ESS A;  2DX6 A;  1BPN A;  2LGR A;  3GQO A;  4R6T A;  5E3B A;  4ETK A;  3V2B A;  3EKE A;  2J9A A;  4ZY1 A;  5CBM A;  4ABK A;  2FXK A;  2JZF A;  3EWR A;  3EW5 A;  1ZR5 A;  1TY8 A;  4ZI6 A;  1NJR A;  3IJ3 A;  3ETI A;  2RNK A;  1ZR3 A;  5AIL A;  3H8F A;  4ZX9 A;  4R76 A;  4GUA A;  4JCA A;  4ZX8 A;  3SII A;  4UML A;  5DUS A;  5FSV A;  2ACF A;  4X2T A;  2EWB A;  1HJZ A;  3Q6Z A;  4J5R A;  2X47 A;  1SPV A;  4ZYQ A;  3GPG A;  5FSX A;  3JZT A;  3GPO A;  1BLL E;  4IQY A;  3EJG A;  3GPQ A;  1TXZ A;  4ETJ A;  4TU0 A;  4JLL A;  3V45 A;  5FSU A;  4J4Z A;  3JRU A;  3KQX A;  4JVV A;  2VRI A;  3Q71 A;  2WCT A;  3SIG A;  2XD7 A;  3T8W A;  3IID A;  4J5S A;  4ZY0 A;  3EWO A;  3KZW A;  2BFR A;  3SIH A;  3H8G A;  5FSY A;  4K0C A;  5HIH A;  3IIF A;  4ABL A;  2W2G A;  1LCP A;  4K3N A;  2FAV A;  3EWQ A;  4KSI A;  1YD9 A;  3KR4 A;  5FSZ A;  3GQE A;  5HOL A;  5CB5 A;  1GYT A;  2BFQ A;  3EWP A;  1VHU A;  3H8E A;  2JZE A;  2JZD A;  4GVV A;  4J5Q A;  2L8R A;  4D86 A;  5D8N A;  3EJF A;  4GVW A;  3VFQ A;  2FG1 A;  5CMS A;  3KR5 A;  3SIJ A;  1LAN A;  4JGK A;  1BPM A;  3KQZ A;  3PEI A;  4KYB A;  4R7M A;  2EEE A;  2KQV A;  1LAP A; 
#chains in the Genus database with same CATH homology
 2JZE A;  2JZD A;  2RNK A;  2JZF A;  2KQV A;  2WCT A;  2W2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...